SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060958 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060958
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily Histone-fold 1.77e-59
Family Nucleosome core histones 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060958   Gene: ENSPTRG00000030417   Transcript: ENSPTRT00000072314
Sequence length 134
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:127952341:127981957:-1 gene:ENSPTRG00000030417 transcript:ENSPTRT00000072314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSKLIGPILWK
Download sequence
Identical sequences A0A2J8VEH1 A0A2K5S8V5 H2R8P8
ENSP00000445831 gi|238624110|ref|NP_001154806.1| ENSP00000445831 ENSP00000462132 ENSPTRP00000060958 NP_001154806.1.87134 NP_001154806.1.92137 XP_003780285.1.23681 XP_003808845.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]