SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061086 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061086
Domain Number 1 Region: 8-103
Classification Level Classification E-value
Superfamily Histone-fold 6.65e-31
Family Nucleosome core histones 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061086   Gene: ENSPTRG00000042217   Transcript: ENSPTRT00000073716
Sequence length 115
Comment pep:novel chromosome:CHIMP2.1.4:X:155554007:155554523:1 gene:ENSPTRG00000042217 transcript:ENSPTRT00000073716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRRRHRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGQYAQRLSRTAPVYLAAVI
EYLTAKVLELAGNEAQNSGARNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
Download sequence
Identical sequences H2RHT0
ENSPTRP00000038729 ENSPTRP00000061086 9598.ENSPTRP00000038729 XP_003317840.1.37143 XP_003810007.1.60992 XP_016800117.1.37143 XP_016800128.1.37143 ENSPTRP00000038729 ENSPTRP00000061086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]