SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061269 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061269
Domain Number 1 Region: 168-465
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.55e-41
Family NadC C-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061269   Gene: ENSPTRG00000041649   Transcript: ENSPTRT00000075217
Sequence length 472
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:37028294:37029712:-1 gene:ENSPTRG00000041649 transcript:ENSPTRT00000075217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEK
IQEAKDVYKEHFQDDVVNEKGWNDILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDP
ECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVS
SQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTVTAWGKDHEK
DAFEHIVTQFSSMPVSVVSDSYDIYNTCEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLD
TVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIENIA
FGSGGGLLQKLTRDLLNCSFKCSYVVTNGLGINLFKDPVADPNKRSKKGRLSLHRTPAGN
FVTLEEGKGDLEEYGQDLLHTVFKNGRVTKSYSFDEIRKNAQLNIELEAAHH
Download sequence
Identical sequences ENSPTRP00000061269 ENSPTRP00000061269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]