SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061277 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061277
Domain Number 1 Region: 32-139
Classification Level Classification E-value
Superfamily Histone-fold 2.58e-36
Family Nucleosome core histones 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061277   Gene: ENSPTRG00000042159   Transcript: ENSPTRT00000049653
Sequence length 141
Comment pep:novel chromosome:CHIMP2.1.4:X:104494105:104494527:1 gene:ENSPTRG00000042159 transcript:ENSPTRT00000049653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASTMVGPSSETPSEEQLITQEPKEANSTTAQKQSKQRKRRCRGPRRCHANCRGDSFA
TYFSRVLKPVHQGLSLSQEAVSVMDSMVPNILDRIGTKAGRLARYTKRMTITSRDIQMAV
RLLLPGKMGKFAESQGTNAAL
Download sequence
Identical sequences ENSPTRP00000061277 ENSPTRP00000061277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]