SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061316 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061316
Domain Number 1 Region: 4-136
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 5.89e-42
Family Eukaryotic RPB5 N-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 133-206
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 1.15e-23
Family RPB5 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061316   Gene: ENSPTRG00000040965   Transcript: ENSPTRT00000072434
Sequence length 207
Comment pep:novel chromosome:CHIMP2.1.4:11:107925124:107925808:1 gene:ENSPTRG00000040965 transcript:ENSPTRT00000072434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGKEEMYRLWKIRKTIMQLCHDRGYLVTDELNQTLKEFKAQFGDKPSEGQRRRTDLTAL
VAHNDDPTDKMFVFFPEEPKVGIKTLNVYCRRMQQENITRVLIMVQQGMTPSAKCLVDMA
PKYILEQFLQQKLLINITEHELVPEYVVMTKEEVTVLLAYKLRENQLPRIQAGDTVARYF
GIKHGQVVKIIRPSEMAGRYLTYRLMQ
Download sequence
Identical sequences ENSPTRP00000061316 ENSPTRP00000061316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]