SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061321 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061321
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-18
Family Laminin G-like module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061321   Gene: ENSPTRG00000009849   Transcript: ENSPTRT00000074952
Sequence length 214
Comment pep:novel chromosome:CHIMP2.1.4:18:9641502:9644543:1 gene:ENSPTRG00000009849 transcript:ENSPTRT00000074952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIGGNIEVHVNPGDGTGLRKALLHAPTGTCGDGQAHSISLVRNRRMITVQLDENNPVEM
KLGALVESRTINVSNLYVGGIPEGEGTSLLTMRRSFHGCIKNLIFNLELLDFNSAVMSKS
TWTPAGCQKGLSWLPMQRTKLLPEPRAFPVGAASFTISQVQSAKEGLGQRELKWGLAVKV
PAKAGAGAGAVLKIRVGTGWERVPQATQMTRPNP
Download sequence
Identical sequences ENSPTRP00000061321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]