SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482902753|ref|YP_007901313.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482902753|ref|YP_007901313.1|
Domain Number 1 Region: 2-425
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.07e-137
Family GABA-aminotransferase-like 0.000000000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|482902753|ref|YP_007901313.1|
Sequence length 426
Comment glutamate-1-semialdehyde aminotransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWG
PMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVPTMDMVRMVNSGTEATM
SAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCT
YNDLTSVRAAFEQYPQEIASIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVM
TGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSG
NPIAMAAGFACLNEVAQPGIHETLDELTTRLAEGLCEAAQEAGIPLVVNHVGGMFGIFFT
DAESVTCYQDVMACDVERFKRFFHLMLEEGVYLAPSAFEAGFMSVAHSMDDINNTIDAAR
RVFAKL
Download sequence
Identical sequences A0A0D6HHT6 A0A0F6AX05 A0A0F7J651 A0A0U1JIY0 A0A0W4PPM2 A0A2D3AL14 A0A2H9YFZ9 E1W874 E8XI00 P0CL07
gi|549722926|ref|YP_008643116.1| gi|378443655|ref|YP_005231287.1| gi|482902753|ref|YP_007901313.1| gi|383495025|ref|YP_005395714.1| gi|378698181|ref|YP_005180138.1| gi|379699423|ref|YP_005241151.1| gi|550899623|ref|YP_008668715.1| gi|378448513|ref|YP_005235872.1| gi|16763592|ref|NP_459207.1| 99287.STM0202 NP_459207.1.58477 WP_000045268.1.100010 WP_000045268.1.100234 WP_000045268.1.100376 WP_000045268.1.100424 WP_000045268.1.100436 WP_000045268.1.100484 WP_000045268.1.100488 WP_000045268.1.100597 WP_000045268.1.10076 WP_000045268.1.100781 WP_000045268.1.100793 WP_000045268.1.100869 WP_000045268.1.100871 WP_000045268.1.100882 WP_000045268.1.101007 WP_000045268.1.101020 WP_000045268.1.101074 WP_000045268.1.101078 WP_000045268.1.101180 WP_000045268.1.101259 WP_000045268.1.101284 WP_000045268.1.101291 WP_000045268.1.101353 WP_000045268.1.101386 WP_000045268.1.101404 WP_000045268.1.101420 WP_000045268.1.101589 WP_000045268.1.101707 WP_000045268.1.101734 WP_000045268.1.101878 WP_000045268.1.101953 WP_000045268.1.10220 WP_000045268.1.10266 WP_000045268.1.10429 WP_000045268.1.10439 WP_000045268.1.10678 WP_000045268.1.10753 WP_000045268.1.10992 WP_000045268.1.11024 WP_000045268.1.11031 WP_000045268.1.11098 WP_000045268.1.11168 WP_000045268.1.11190 WP_000045268.1.11295 WP_000045268.1.11455 WP_000045268.1.11458 WP_000045268.1.11518 WP_000045268.1.11532 WP_000045268.1.11543 WP_000045268.1.11763 WP_000045268.1.11772 WP_000045268.1.11897 WP_000045268.1.12351 WP_000045268.1.12370 WP_000045268.1.12546 WP_000045268.1.1264 WP_000045268.1.12728 WP_000045268.1.12879 WP_000045268.1.12936 WP_000045268.1.12995 WP_000045268.1.13027 WP_000045268.1.13106 WP_000045268.1.13130 WP_000045268.1.13414 WP_000045268.1.13488 WP_000045268.1.13509 WP_000045268.1.13669 WP_000045268.1.13741 WP_000045268.1.1387 WP_000045268.1.13908 WP_000045268.1.13932 WP_000045268.1.13968 WP_000045268.1.14001 WP_000045268.1.14151 WP_000045268.1.14239 WP_000045268.1.14320 WP_000045268.1.14379 WP_000045268.1.14406 WP_000045268.1.14410 WP_000045268.1.14466 WP_000045268.1.14524 WP_000045268.1.14554 WP_000045268.1.14725 WP_000045268.1.14852 WP_000045268.1.1489 WP_000045268.1.14932 WP_000045268.1.15055 WP_000045268.1.15124 WP_000045268.1.15223 WP_000045268.1.15226 WP_000045268.1.15316 WP_000045268.1.15369 WP_000045268.1.1540 WP_000045268.1.15508 WP_000045268.1.15784 WP_000045268.1.15830 WP_000045268.1.16062 WP_000045268.1.16063 WP_000045268.1.16103 WP_000045268.1.16226 WP_000045268.1.16233 WP_000045268.1.16284 WP_000045268.1.16328 WP_000045268.1.1635 WP_000045268.1.16468 WP_000045268.1.16614 WP_000045268.1.16650 WP_000045268.1.16686 WP_000045268.1.16732 WP_000045268.1.16735 WP_000045268.1.16786 WP_000045268.1.16858 WP_000045268.1.16896 WP_000045268.1.16916 WP_000045268.1.16965 WP_000045268.1.1700 WP_000045268.1.17307 WP_000045268.1.174 WP_000045268.1.17480 WP_000045268.1.17546 WP_000045268.1.17702 WP_000045268.1.17705 WP_000045268.1.18019 WP_000045268.1.18111 WP_000045268.1.18163 WP_000045268.1.18265 WP_000045268.1.18267 WP_000045268.1.18468 WP_000045268.1.18607 WP_000045268.1.18705 WP_000045268.1.18715 WP_000045268.1.18776 WP_000045268.1.18822 WP_000045268.1.18881 WP_000045268.1.18940 WP_000045268.1.18949 WP_000045268.1.19053 WP_000045268.1.19320 WP_000045268.1.19458 WP_000045268.1.19460 WP_000045268.1.19461 WP_000045268.1.19614 WP_000045268.1.19702 WP_000045268.1.19706 WP_000045268.1.19724 WP_000045268.1.19749 WP_000045268.1.19784 WP_000045268.1.19802 WP_000045268.1.19809 WP_000045268.1.19867 WP_000045268.1.1998 WP_000045268.1.20 WP_000045268.1.2010 WP_000045268.1.20212 WP_000045268.1.20266 WP_000045268.1.20271 WP_000045268.1.20362 WP_000045268.1.20443 WP_000045268.1.20525 WP_000045268.1.2054 WP_000045268.1.20553 WP_000045268.1.20626 WP_000045268.1.20646 WP_000045268.1.20886 WP_000045268.1.20908 WP_000045268.1.21049 WP_000045268.1.21146 WP_000045268.1.21245 WP_000045268.1.21269 WP_000045268.1.21400 WP_000045268.1.21497 WP_000045268.1.21499 WP_000045268.1.21603 WP_000045268.1.21751 WP_000045268.1.21757 WP_000045268.1.22024 WP_000045268.1.2205 WP_000045268.1.22062 WP_000045268.1.22067 WP_000045268.1.2221 WP_000045268.1.2235 WP_000045268.1.22379 WP_000045268.1.22427 WP_000045268.1.2246 WP_000045268.1.22485 WP_000045268.1.22620 WP_000045268.1.22870 WP_000045268.1.22979 WP_000045268.1.23114 WP_000045268.1.2314 WP_000045268.1.23192 WP_000045268.1.23259 WP_000045268.1.23460 WP_000045268.1.23472 WP_000045268.1.23482 WP_000045268.1.23634 WP_000045268.1.2364 WP_000045268.1.23932 WP_000045268.1.24017 WP_000045268.1.24206 WP_000045268.1.24308 WP_000045268.1.24578 WP_000045268.1.24737 WP_000045268.1.24779 WP_000045268.1.25008 WP_000045268.1.25015 WP_000045268.1.25405 WP_000045268.1.25454 WP_000045268.1.25493 WP_000045268.1.25668 WP_000045268.1.25690 WP_000045268.1.2570 WP_000045268.1.25740 WP_000045268.1.25814 WP_000045268.1.25988 WP_000045268.1.26282 WP_000045268.1.26311 WP_000045268.1.26319 WP_000045268.1.26429 WP_000045268.1.26440 WP_000045268.1.26493 WP_000045268.1.26551 WP_000045268.1.26567 WP_000045268.1.27010 WP_000045268.1.27173 WP_000045268.1.27206 WP_000045268.1.27423 WP_000045268.1.27561 WP_000045268.1.2763 WP_000045268.1.27665 WP_000045268.1.27707 WP_000045268.1.27761 WP_000045268.1.2777 WP_000045268.1.27857 WP_000045268.1.27977 WP_000045268.1.28094 WP_000045268.1.28170 WP_000045268.1.28302 WP_000045268.1.2835 WP_000045268.1.28370 WP_000045268.1.28538 WP_000045268.1.28575 WP_000045268.1.28625 WP_000045268.1.28655 WP_000045268.1.28694 WP_000045268.1.2879 WP_000045268.1.2890 WP_000045268.1.28938 WP_000045268.1.28946 WP_000045268.1.29006 WP_000045268.1.29010 WP_000045268.1.2910 WP_000045268.1.29588 WP_000045268.1.29601 WP_000045268.1.29606 WP_000045268.1.29615 WP_000045268.1.29619 WP_000045268.1.29704 WP_000045268.1.29969 WP_000045268.1.30006 WP_000045268.1.30027 WP_000045268.1.30180 WP_000045268.1.30469 WP_000045268.1.30505 WP_000045268.1.30507 WP_000045268.1.30535 WP_000045268.1.30547 WP_000045268.1.30794 WP_000045268.1.30833 WP_000045268.1.30835 WP_000045268.1.30972 WP_000045268.1.31 WP_000045268.1.3113 WP_000045268.1.31185 WP_000045268.1.3119 WP_000045268.1.31190 WP_000045268.1.31195 WP_000045268.1.31196 WP_000045268.1.31281 WP_000045268.1.31362 WP_000045268.1.31504 WP_000045268.1.31515 WP_000045268.1.31578 WP_000045268.1.31658 WP_000045268.1.31940 WP_000045268.1.31967 WP_000045268.1.31972 WP_000045268.1.32192 WP_000045268.1.32206 WP_000045268.1.32438 WP_000045268.1.32515 WP_000045268.1.32660 WP_000045268.1.32702 WP_000045268.1.32714 WP_000045268.1.32786 WP_000045268.1.32804 WP_000045268.1.32907 WP_000045268.1.33030 WP_000045268.1.33127 WP_000045268.1.33143 WP_000045268.1.33248 WP_000045268.1.33261 WP_000045268.1.333 WP_000045268.1.33492 WP_000045268.1.33553 WP_000045268.1.33592 WP_000045268.1.33894 WP_000045268.1.34043 WP_000045268.1.34075 WP_000045268.1.34257 WP_000045268.1.34279 WP_000045268.1.34319 WP_000045268.1.34453 WP_000045268.1.34610 WP_000045268.1.34856 WP_000045268.1.34975 WP_000045268.1.35129 WP_000045268.1.35184 WP_000045268.1.35404 WP_000045268.1.35408 WP_000045268.1.35425 WP_000045268.1.35446 WP_000045268.1.35463 WP_000045268.1.35503 WP_000045268.1.35509 WP_000045268.1.35590 WP_000045268.1.35940 WP_000045268.1.36003 WP_000045268.1.3601 WP_000045268.1.36609 WP_000045268.1.36690 WP_000045268.1.3670 WP_000045268.1.36705 WP_000045268.1.36918 WP_000045268.1.36931 WP_000045268.1.37073 WP_000045268.1.37111 WP_000045268.1.37112 WP_000045268.1.37256 WP_000045268.1.37293 WP_000045268.1.37370 WP_000045268.1.37376 WP_000045268.1.3744 WP_000045268.1.37498 WP_000045268.1.37504 WP_000045268.1.37618 WP_000045268.1.37968 WP_000045268.1.37978 WP_000045268.1.38125 WP_000045268.1.38145 WP_000045268.1.383 WP_000045268.1.3848 WP_000045268.1.38613 WP_000045268.1.38673 WP_000045268.1.38693 WP_000045268.1.38773 WP_000045268.1.38882 WP_000045268.1.38913 WP_000045268.1.39003 WP_000045268.1.39136 WP_000045268.1.39197 WP_000045268.1.39229 WP_000045268.1.39405 WP_000045268.1.39420 WP_000045268.1.39449 WP_000045268.1.39512 WP_000045268.1.39629 WP_000045268.1.39763 WP_000045268.1.39862 WP_000045268.1.39921 WP_000045268.1.39923 WP_000045268.1.40017 WP_000045268.1.40072 WP_000045268.1.40073 WP_000045268.1.4011 WP_000045268.1.40208 WP_000045268.1.40240 WP_000045268.1.40257 WP_000045268.1.40292 WP_000045268.1.40305 WP_000045268.1.40311 WP_000045268.1.40380 WP_000045268.1.40395 WP_000045268.1.40465 WP_000045268.1.40710 WP_000045268.1.4075 WP_000045268.1.4087 WP_000045268.1.40877 WP_000045268.1.41017 WP_000045268.1.41086 WP_000045268.1.41091 WP_000045268.1.41226 WP_000045268.1.41279 WP_000045268.1.41516 WP_000045268.1.41554 WP_000045268.1.41572 WP_000045268.1.41591 WP_000045268.1.41662 WP_000045268.1.41761 WP_000045268.1.41882 WP_000045268.1.41979 WP_000045268.1.41985 WP_000045268.1.42320 WP_000045268.1.42342 WP_000045268.1.42422 WP_000045268.1.4276 WP_000045268.1.42864 WP_000045268.1.4288 WP_000045268.1.43018 WP_000045268.1.43041 WP_000045268.1.43244 WP_000045268.1.43312 WP_000045268.1.43334 WP_000045268.1.43437 WP_000045268.1.43522 WP_000045268.1.43613 WP_000045268.1.43668 WP_000045268.1.43886 WP_000045268.1.44005 WP_000045268.1.44043 WP_000045268.1.44099 WP_000045268.1.44121 WP_000045268.1.44291 WP_000045268.1.44310 WP_000045268.1.44479 WP_000045268.1.44640 WP_000045268.1.4467 WP_000045268.1.44747 WP_000045268.1.4485 WP_000045268.1.44877 WP_000045268.1.44927 WP_000045268.1.45067 WP_000045268.1.45074 WP_000045268.1.45079 WP_000045268.1.45098 WP_000045268.1.45177 WP_000045268.1.45184 WP_000045268.1.45259 WP_000045268.1.45349 WP_000045268.1.45365 WP_000045268.1.45550 WP_000045268.1.45585 WP_000045268.1.45660 WP_000045268.1.45690 WP_000045268.1.458 WP_000045268.1.46011 WP_000045268.1.46069 WP_000045268.1.46112 WP_000045268.1.46173 WP_000045268.1.46174 WP_000045268.1.46187 WP_000045268.1.46303 WP_000045268.1.46595 WP_000045268.1.46675 WP_000045268.1.47057 WP_000045268.1.47214 WP_000045268.1.47429 WP_000045268.1.47448 WP_000045268.1.4747 WP_000045268.1.47472 WP_000045268.1.47478 WP_000045268.1.47621 WP_000045268.1.47799 WP_000045268.1.48242 WP_000045268.1.48253 WP_000045268.1.483 WP_000045268.1.48367 WP_000045268.1.48377 WP_000045268.1.4853 WP_000045268.1.48788 WP_000045268.1.4885 WP_000045268.1.48876 WP_000045268.1.48894 WP_000045268.1.48919 WP_000045268.1.49084 WP_000045268.1.49155 WP_000045268.1.49204 WP_000045268.1.49239 WP_000045268.1.49256 WP_000045268.1.49290 WP_000045268.1.49340 WP_000045268.1.49366 WP_000045268.1.49490 WP_000045268.1.49515 WP_000045268.1.49572 WP_000045268.1.4979 WP_000045268.1.49803 WP_000045268.1.49805 WP_000045268.1.49929 WP_000045268.1.50080 WP_000045268.1.50161 WP_000045268.1.50211 WP_000045268.1.50376 WP_000045268.1.50389 WP_000045268.1.50676 WP_000045268.1.50804 WP_000045268.1.50808 WP_000045268.1.5088 WP_000045268.1.50908 WP_000045268.1.50941 WP_000045268.1.51014 WP_000045268.1.51022 WP_000045268.1.51179 WP_000045268.1.51182 WP_000045268.1.51186 WP_000045268.1.51487 WP_000045268.1.51488 WP_000045268.1.51634 WP_000045268.1.51649 WP_000045268.1.51686 WP_000045268.1.51756 WP_000045268.1.51911 WP_000045268.1.51932 WP_000045268.1.51989 WP_000045268.1.52121 WP_000045268.1.52346 WP_000045268.1.52353 WP_000045268.1.52361 WP_000045268.1.52653 WP_000045268.1.52743 WP_000045268.1.52857 WP_000045268.1.52898 WP_000045268.1.52915 WP_000045268.1.53190 WP_000045268.1.53406 WP_000045268.1.53466 WP_000045268.1.53529 WP_000045268.1.53543 WP_000045268.1.53757 WP_000045268.1.53812 WP_000045268.1.54033 WP_000045268.1.54075 WP_000045268.1.54196 WP_000045268.1.54209 WP_000045268.1.54271 WP_000045268.1.54274 WP_000045268.1.54319 WP_000045268.1.54364 WP_000045268.1.54400 WP_000045268.1.54644 WP_000045268.1.54662 WP_000045268.1.54722 WP_000045268.1.54749 WP_000045268.1.54764 WP_000045268.1.55008 WP_000045268.1.55152 WP_000045268.1.55156 WP_000045268.1.55285 WP_000045268.1.55475 WP_000045268.1.55647 WP_000045268.1.55743 WP_000045268.1.55768 WP_000045268.1.55782 WP_000045268.1.55796 WP_000045268.1.56002 WP_000045268.1.56012 WP_000045268.1.56105 WP_000045268.1.56238 WP_000045268.1.56286 WP_000045268.1.56304 WP_000045268.1.56414 WP_000045268.1.56438 WP_000045268.1.56560 WP_000045268.1.56601 WP_000045268.1.56614 WP_000045268.1.56671 WP_000045268.1.56682 WP_000045268.1.56877 WP_000045268.1.57168 WP_000045268.1.57187 WP_000045268.1.57377 WP_000045268.1.57418 WP_000045268.1.57433 WP_000045268.1.57515 WP_000045268.1.57529 WP_000045268.1.57576 WP_000045268.1.57601 WP_000045268.1.57607 WP_000045268.1.57763 WP_000045268.1.57862 WP_000045268.1.57890 WP_000045268.1.57891 WP_000045268.1.57978 WP_000045268.1.5801 WP_000045268.1.58041 WP_000045268.1.58418 WP_000045268.1.58548 WP_000045268.1.5858 WP_000045268.1.58662 WP_000045268.1.58669 WP_000045268.1.58745 WP_000045268.1.58803 WP_000045268.1.5886 WP_000045268.1.59094 WP_000045268.1.59224 WP_000045268.1.59321 WP_000045268.1.59375 WP_000045268.1.59458 WP_000045268.1.59490 WP_000045268.1.59508 WP_000045268.1.59684 WP_000045268.1.59694 WP_000045268.1.59771 WP_000045268.1.5979 WP_000045268.1.59953 WP_000045268.1.60008 WP_000045268.1.60021 WP_000045268.1.60069 WP_000045268.1.60140 WP_000045268.1.60155 WP_000045268.1.60285 WP_000045268.1.60379 WP_000045268.1.60464 WP_000045268.1.60874 WP_000045268.1.60941 WP_000045268.1.61078 WP_000045268.1.6114 WP_000045268.1.61232 WP_000045268.1.6129 WP_000045268.1.61296 WP_000045268.1.61345 WP_000045268.1.61417 WP_000045268.1.61574 WP_000045268.1.61712 WP_000045268.1.61714 WP_000045268.1.61730 WP_000045268.1.61857 WP_000045268.1.61918 WP_000045268.1.61952 WP_000045268.1.62007 WP_000045268.1.62025 WP_000045268.1.62204 WP_000045268.1.62304 WP_000045268.1.62364 WP_000045268.1.62374 WP_000045268.1.62403 WP_000045268.1.6253 WP_000045268.1.62853 WP_000045268.1.62903 WP_000045268.1.62910 WP_000045268.1.62955 WP_000045268.1.63181 WP_000045268.1.63203 WP_000045268.1.63256 WP_000045268.1.63290 WP_000045268.1.63382 WP_000045268.1.63432 WP_000045268.1.63461 WP_000045268.1.63479 WP_000045268.1.63577 WP_000045268.1.63664 WP_000045268.1.63718 WP_000045268.1.6375 WP_000045268.1.63757 WP_000045268.1.63834 WP_000045268.1.64046 WP_000045268.1.6423 WP_000045268.1.64244 WP_000045268.1.64403 WP_000045268.1.64649 WP_000045268.1.64702 WP_000045268.1.64757 WP_000045268.1.64781 WP_000045268.1.64831 WP_000045268.1.6489 WP_000045268.1.65018 WP_000045268.1.65028 WP_000045268.1.65171 WP_000045268.1.65248 WP_000045268.1.6535 WP_000045268.1.65474 WP_000045268.1.65633 WP_000045268.1.6565 WP_000045268.1.65696 WP_000045268.1.6575 WP_000045268.1.65782 WP_000045268.1.6630 WP_000045268.1.66314 WP_000045268.1.66358 WP_000045268.1.66362 WP_000045268.1.6638 WP_000045268.1.6640 WP_000045268.1.66698 WP_000045268.1.6680 WP_000045268.1.66834 WP_000045268.1.66901 WP_000045268.1.66962 WP_000045268.1.67037 WP_000045268.1.67045 WP_000045268.1.67181 WP_000045268.1.67268 WP_000045268.1.67347 WP_000045268.1.67465 WP_000045268.1.67552 WP_000045268.1.67682 WP_000045268.1.67829 WP_000045268.1.67887 WP_000045268.1.68073 WP_000045268.1.68201 WP_000045268.1.68206 WP_000045268.1.6827 WP_000045268.1.68275 WP_000045268.1.6849 WP_000045268.1.68547 WP_000045268.1.68589 WP_000045268.1.68655 WP_000045268.1.68656 WP_000045268.1.68778 WP_000045268.1.68787 WP_000045268.1.68894 WP_000045268.1.68928 WP_000045268.1.68975 WP_000045268.1.69006 WP_000045268.1.6913 WP_000045268.1.69146 WP_000045268.1.69255 WP_000045268.1.69397 WP_000045268.1.69564 WP_000045268.1.69644 WP_000045268.1.69704 WP_000045268.1.7021 WP_000045268.1.70241 WP_000045268.1.70269 WP_000045268.1.70289 WP_000045268.1.70447 WP_000045268.1.70485 WP_000045268.1.70683 WP_000045268.1.70883 WP_000045268.1.70922 WP_000045268.1.70948 WP_000045268.1.71116 WP_000045268.1.71146 WP_000045268.1.71165 WP_000045268.1.71188 WP_000045268.1.71202 WP_000045268.1.71243 WP_000045268.1.71306 WP_000045268.1.71337 WP_000045268.1.71378 WP_000045268.1.71401 WP_000045268.1.71702 WP_000045268.1.71750 WP_000045268.1.71845 WP_000045268.1.71881 WP_000045268.1.71908 WP_000045268.1.71952 WP_000045268.1.71973 WP_000045268.1.72105 WP_000045268.1.72203 WP_000045268.1.72376 WP_000045268.1.72594 WP_000045268.1.72871 WP_000045268.1.72975 WP_000045268.1.7315 WP_000045268.1.73200 WP_000045268.1.7334 WP_000045268.1.73377 WP_000045268.1.73481 WP_000045268.1.7356 WP_000045268.1.73581 WP_000045268.1.73617 WP_000045268.1.73753 WP_000045268.1.73758 WP_000045268.1.73794 WP_000045268.1.7387 WP_000045268.1.73924 WP_000045268.1.74029 WP_000045268.1.74181 WP_000045268.1.74191 WP_000045268.1.7433 WP_000045268.1.74379 WP_000045268.1.74410 WP_000045268.1.74466 WP_000045268.1.74529 WP_000045268.1.74545 WP_000045268.1.74745 WP_000045268.1.75129 WP_000045268.1.75187 WP_000045268.1.75288 WP_000045268.1.75334 WP_000045268.1.75362 WP_000045268.1.75385 WP_000045268.1.75392 WP_000045268.1.75760 WP_000045268.1.75764 WP_000045268.1.75837 WP_000045268.1.75874 WP_000045268.1.75945 WP_000045268.1.76020 WP_000045268.1.76252 WP_000045268.1.76445 WP_000045268.1.7660 WP_000045268.1.76673 WP_000045268.1.76706 WP_000045268.1.76721 WP_000045268.1.76756 WP_000045268.1.76760 WP_000045268.1.76875 WP_000045268.1.76880 WP_000045268.1.76899 WP_000045268.1.77038 WP_000045268.1.77047 WP_000045268.1.77080 WP_000045268.1.7712 WP_000045268.1.77180 WP_000045268.1.77244 WP_000045268.1.77292 WP_000045268.1.77349 WP_000045268.1.77514 WP_000045268.1.77529 WP_000045268.1.77549 WP_000045268.1.77692 WP_000045268.1.7782 WP_000045268.1.77851 WP_000045268.1.77898 WP_000045268.1.77918 WP_000045268.1.77960 WP_000045268.1.78033 WP_000045268.1.78076 WP_000045268.1.78096 WP_000045268.1.78100 WP_000045268.1.78110 WP_000045268.1.78120 WP_000045268.1.78383 WP_000045268.1.78407 WP_000045268.1.7861 WP_000045268.1.78618 WP_000045268.1.78673 WP_000045268.1.78735 WP_000045268.1.78802 WP_000045268.1.78830 WP_000045268.1.78835 WP_000045268.1.78871 WP_000045268.1.78874 WP_000045268.1.78918 WP_000045268.1.78930 WP_000045268.1.79151 WP_000045268.1.79167 WP_000045268.1.79335 WP_000045268.1.79462 WP_000045268.1.79472 WP_000045268.1.79490 WP_000045268.1.79495 WP_000045268.1.79529 WP_000045268.1.79570 WP_000045268.1.7964 WP_000045268.1.79659 WP_000045268.1.79668 WP_000045268.1.79708 WP_000045268.1.79845 WP_000045268.1.80077 WP_000045268.1.80137 WP_000045268.1.80182 WP_000045268.1.80296 WP_000045268.1.80366 WP_000045268.1.80780 WP_000045268.1.80831 WP_000045268.1.80850 WP_000045268.1.80881 WP_000045268.1.80939 WP_000045268.1.8096 WP_000045268.1.81037 WP_000045268.1.81069 WP_000045268.1.81149 WP_000045268.1.81175 WP_000045268.1.8119 WP_000045268.1.81193 WP_000045268.1.81354 WP_000045268.1.81425 WP_000045268.1.81750 WP_000045268.1.81785 WP_000045268.1.81902 WP_000045268.1.81974 WP_000045268.1.82337 WP_000045268.1.82479 WP_000045268.1.82503 WP_000045268.1.82515 WP_000045268.1.82676 WP_000045268.1.82761 WP_000045268.1.8282 WP_000045268.1.82944 WP_000045268.1.82956 WP_000045268.1.83092 WP_000045268.1.83163 WP_000045268.1.83305 WP_000045268.1.83413 WP_000045268.1.83491 WP_000045268.1.83523 WP_000045268.1.8354 WP_000045268.1.83721 WP_000045268.1.83760 WP_000045268.1.83995 WP_000045268.1.84103 WP_000045268.1.84283 WP_000045268.1.84392 WP_000045268.1.8441 WP_000045268.1.84532 WP_000045268.1.84659 WP_000045268.1.84899 WP_000045268.1.8497 WP_000045268.1.85040 WP_000045268.1.85134 WP_000045268.1.85178 WP_000045268.1.85180 WP_000045268.1.85190 WP_000045268.1.8533 WP_000045268.1.8545 WP_000045268.1.85481 WP_000045268.1.85483 WP_000045268.1.85541 WP_000045268.1.8556 WP_000045268.1.85615 WP_000045268.1.85617 WP_000045268.1.85663 WP_000045268.1.85671 WP_000045268.1.85672 WP_000045268.1.85777 WP_000045268.1.85886 WP_000045268.1.85900 WP_000045268.1.85904 WP_000045268.1.85976 WP_000045268.1.86306 WP_000045268.1.86356 WP_000045268.1.86450 WP_000045268.1.86469 WP_000045268.1.86580 WP_000045268.1.86588 WP_000045268.1.86661 WP_000045268.1.8672 WP_000045268.1.8678 WP_000045268.1.86810 WP_000045268.1.8684 WP_000045268.1.86895 WP_000045268.1.86906 WP_000045268.1.87095 WP_000045268.1.8736 WP_000045268.1.87460 WP_000045268.1.87552 WP_000045268.1.87779 WP_000045268.1.87945 WP_000045268.1.88019 WP_000045268.1.88073 WP_000045268.1.8809 WP_000045268.1.88291 WP_000045268.1.88293 WP_000045268.1.8837 WP_000045268.1.88393 WP_000045268.1.88703 WP_000045268.1.88792 WP_000045268.1.88902 WP_000045268.1.8891 WP_000045268.1.89008 WP_000045268.1.89116 WP_000045268.1.89138 WP_000045268.1.89304 WP_000045268.1.89512 WP_000045268.1.89527 WP_000045268.1.89570 WP_000045268.1.89604 WP_000045268.1.89622 WP_000045268.1.89659 WP_000045268.1.89902 WP_000045268.1.8996 WP_000045268.1.90097 WP_000045268.1.90252 WP_000045268.1.90417 WP_000045268.1.90453 WP_000045268.1.90458 WP_000045268.1.90557 WP_000045268.1.90585 WP_000045268.1.90641 WP_000045268.1.90734 WP_000045268.1.91003 WP_000045268.1.91069 WP_000045268.1.91278 WP_000045268.1.91512 WP_000045268.1.91564 WP_000045268.1.91628 WP_000045268.1.91655 WP_000045268.1.91724 WP_000045268.1.91732 WP_000045268.1.91788 WP_000045268.1.92013 WP_000045268.1.92093 WP_000045268.1.92108 WP_000045268.1.92183 WP_000045268.1.92208 WP_000045268.1.92268 WP_000045268.1.92310 WP_000045268.1.92443 WP_000045268.1.92482 WP_000045268.1.92531 WP_000045268.1.92669 WP_000045268.1.92671 WP_000045268.1.92738 WP_000045268.1.93086 WP_000045268.1.93101 WP_000045268.1.93136 WP_000045268.1.93155 WP_000045268.1.93365 WP_000045268.1.93543 WP_000045268.1.93650 WP_000045268.1.93656 WP_000045268.1.93662 WP_000045268.1.937 WP_000045268.1.93705 WP_000045268.1.93804 WP_000045268.1.9389 WP_000045268.1.93994 WP_000045268.1.94072 WP_000045268.1.94162 WP_000045268.1.94168 WP_000045268.1.94198 WP_000045268.1.9432 WP_000045268.1.94354 WP_000045268.1.94380 WP_000045268.1.94458 WP_000045268.1.94565 WP_000045268.1.94584 WP_000045268.1.94674 WP_000045268.1.94796 WP_000045268.1.94959 WP_000045268.1.95051 WP_000045268.1.95085 WP_000045268.1.95121 WP_000045268.1.95282 WP_000045268.1.95546 WP_000045268.1.95630 WP_000045268.1.95911 WP_000045268.1.96139 WP_000045268.1.96317 WP_000045268.1.96343 WP_000045268.1.9644 WP_000045268.1.96469 WP_000045268.1.96500 WP_000045268.1.96555 WP_000045268.1.96563 WP_000045268.1.96732 WP_000045268.1.96771 WP_000045268.1.97015 WP_000045268.1.97145 WP_000045268.1.97190 WP_000045268.1.97318 WP_000045268.1.97369 WP_000045268.1.97594 WP_000045268.1.97597 WP_000045268.1.97613 WP_000045268.1.97620 WP_000045268.1.97727 WP_000045268.1.97732 WP_000045268.1.97736 WP_000045268.1.9775 WP_000045268.1.97846 WP_000045268.1.98006 WP_000045268.1.98019 WP_000045268.1.98022 WP_000045268.1.98110 WP_000045268.1.98146 WP_000045268.1.98219 WP_000045268.1.9841 WP_000045268.1.98495 WP_000045268.1.98531 WP_000045268.1.98577 WP_000045268.1.98676 WP_000045268.1.98677 WP_000045268.1.98760 WP_000045268.1.98843 WP_000045268.1.9898 WP_000045268.1.99098 WP_000045268.1.99184 WP_000045268.1.99267 WP_000045268.1.99276 WP_000045268.1.99646 WP_000045268.1.99657 WP_000045268.1.99660 WP_000045268.1.99712 WP_000045268.1.99813 WP_000045268.1.99858 WP_000045268.1.99889 WP_000045268.1.99958 gi|378982744|ref|YP_005245899.1| gi|525839336|ref|YP_008256618.1| gi|378987607|ref|YP_005250771.1| ABAO01000001|CDS_284773-283493 AE006468|CDS_238491-237211 CP001363|CDS_239195-237915 FN424405|CDS_238483-237203 gi|526219151|ref|YP_008264462.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]