SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482903113|ref|YP_007901673.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482903113|ref|YP_007901673.1|
Domain Number 1 Region: 13-395
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.04e-128
Family GABA-aminotransferase-like 0.000000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|482903113|ref|YP_007901673.1|
Sequence length 408
Comment bifunctional succinylornithine transaminase/acetylornithine transaminase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MSLSVTRENFDEWMVPVYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPAL
REALNEQANRFWHIGNGYTNEPALRLAKKLIDATFAERVFFCNSGAEANEAALKLARKYA
HDRVGNHKSGIVAFKNAFHGRTLFTVSAGGQPTYSQDFAPLPPDIRHAAYNDLNSASALI
DDNTCAVIVEPVQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMH
YGVTPDILTTAKALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGKVLDIIN
TPEMQNGVRQRHDAFIERLNTLNVRFGMFSEIRGLGLLLGCVLQTEFAGKAKLIAQEAAK
AGVMVLIAGGDVVRFAPALNVSDEEIATGLDRFALACERLQTGGVPCG
Download sequence
Identical sequences A0A0D6GDJ4 A0A0F6B0N4 A0A0F7J8J2 A0A0H3NAY0 A0A0U1FGQ1 A0A0W4U7L6 A0A249UZG3 A0A2D3AQH9 A0A2H9YH89 E8XGA9 Q8ZPV2
gi|379700475|ref|YP_005242203.1| gi|378983861|ref|YP_005247016.1| gi|550900673|ref|YP_008669765.1| gi|383496017|ref|YP_005396706.1| gi|482903113|ref|YP_007901673.1| gi|378444733|ref|YP_005232365.1| gi|378449798|ref|YP_005237157.1| gi|378988644|ref|YP_005251808.1| gi|525838455|ref|YP_008255501.1| IDP00959 99287.STM1303 gi|16764654|ref|NP_460269.1| gi|549723941|ref|YP_008644131.1| gi|526219999|ref|YP_008265502.1| NP_460269.1.58477 WP_000059493.1.100010 WP_000059493.1.100234 WP_000059493.1.100258 WP_000059493.1.100376 WP_000059493.1.100424 WP_000059493.1.100436 WP_000059493.1.100484 WP_000059493.1.100488 WP_000059493.1.100597 WP_000059493.1.10076 WP_000059493.1.100781 WP_000059493.1.100793 WP_000059493.1.100869 WP_000059493.1.100871 WP_000059493.1.100882 WP_000059493.1.101007 WP_000059493.1.101020 WP_000059493.1.101074 WP_000059493.1.101078 WP_000059493.1.101180 WP_000059493.1.101259 WP_000059493.1.101284 WP_000059493.1.101291 WP_000059493.1.101320 WP_000059493.1.101353 WP_000059493.1.101386 WP_000059493.1.101404 WP_000059493.1.101420 WP_000059493.1.101589 WP_000059493.1.101707 WP_000059493.1.101734 WP_000059493.1.101878 WP_000059493.1.101953 WP_000059493.1.10220 WP_000059493.1.10266 WP_000059493.1.10429 WP_000059493.1.10439 WP_000059493.1.10678 WP_000059493.1.10753 WP_000059493.1.10992 WP_000059493.1.11000 WP_000059493.1.11024 WP_000059493.1.11031 WP_000059493.1.11098 WP_000059493.1.11168 WP_000059493.1.11190 WP_000059493.1.11295 WP_000059493.1.11455 WP_000059493.1.11458 WP_000059493.1.11518 WP_000059493.1.11532 WP_000059493.1.11543 WP_000059493.1.11763 WP_000059493.1.11772 WP_000059493.1.11897 WP_000059493.1.12025 WP_000059493.1.12351 WP_000059493.1.12370 WP_000059493.1.12546 WP_000059493.1.1264 WP_000059493.1.12728 WP_000059493.1.12879 WP_000059493.1.12936 WP_000059493.1.12995 WP_000059493.1.13027 WP_000059493.1.13106 WP_000059493.1.13130 WP_000059493.1.13334 WP_000059493.1.13414 WP_000059493.1.13488 WP_000059493.1.13509 WP_000059493.1.13669 WP_000059493.1.13741 WP_000059493.1.1387 WP_000059493.1.13908 WP_000059493.1.13932 WP_000059493.1.13968 WP_000059493.1.14001 WP_000059493.1.14151 WP_000059493.1.14239 WP_000059493.1.14320 WP_000059493.1.14379 WP_000059493.1.14406 WP_000059493.1.14410 WP_000059493.1.14466 WP_000059493.1.14524 WP_000059493.1.14554 WP_000059493.1.14725 WP_000059493.1.14852 WP_000059493.1.1489 WP_000059493.1.14932 WP_000059493.1.15055 WP_000059493.1.15124 WP_000059493.1.15223 WP_000059493.1.15226 WP_000059493.1.15316 WP_000059493.1.15369 WP_000059493.1.1540 WP_000059493.1.15508 WP_000059493.1.15784 WP_000059493.1.15830 WP_000059493.1.16062 WP_000059493.1.16063 WP_000059493.1.16103 WP_000059493.1.16226 WP_000059493.1.16233 WP_000059493.1.16284 WP_000059493.1.1635 WP_000059493.1.16468 WP_000059493.1.16614 WP_000059493.1.16650 WP_000059493.1.16686 WP_000059493.1.16691 WP_000059493.1.16732 WP_000059493.1.16735 WP_000059493.1.16786 WP_000059493.1.16858 WP_000059493.1.16896 WP_000059493.1.16965 WP_000059493.1.1700 WP_000059493.1.17307 WP_000059493.1.17480 WP_000059493.1.17546 WP_000059493.1.17702 WP_000059493.1.17705 WP_000059493.1.17747 WP_000059493.1.18019 WP_000059493.1.18111 WP_000059493.1.18163 WP_000059493.1.18267 WP_000059493.1.18282 WP_000059493.1.18468 WP_000059493.1.18607 WP_000059493.1.18705 WP_000059493.1.18715 WP_000059493.1.18776 WP_000059493.1.18822 WP_000059493.1.18881 WP_000059493.1.18940 WP_000059493.1.18949 WP_000059493.1.19053 WP_000059493.1.19320 WP_000059493.1.19458 WP_000059493.1.19460 WP_000059493.1.19461 WP_000059493.1.19614 WP_000059493.1.19642 WP_000059493.1.19702 WP_000059493.1.19706 WP_000059493.1.19724 WP_000059493.1.19749 WP_000059493.1.19784 WP_000059493.1.19802 WP_000059493.1.19809 WP_000059493.1.19867 WP_000059493.1.1998 WP_000059493.1.20 WP_000059493.1.2010 WP_000059493.1.20212 WP_000059493.1.20266 WP_000059493.1.20271 WP_000059493.1.20330 WP_000059493.1.20362 WP_000059493.1.20418 WP_000059493.1.20443 WP_000059493.1.20525 WP_000059493.1.2054 WP_000059493.1.20626 WP_000059493.1.20646 WP_000059493.1.20886 WP_000059493.1.20908 WP_000059493.1.21049 WP_000059493.1.21146 WP_000059493.1.21245 WP_000059493.1.21246 WP_000059493.1.21269 WP_000059493.1.21400 WP_000059493.1.21497 WP_000059493.1.21499 WP_000059493.1.21548 WP_000059493.1.21603 WP_000059493.1.21751 WP_000059493.1.21757 WP_000059493.1.22024 WP_000059493.1.2205 WP_000059493.1.22062 WP_000059493.1.22067 WP_000059493.1.2221 WP_000059493.1.2235 WP_000059493.1.22379 WP_000059493.1.22427 WP_000059493.1.2246 WP_000059493.1.22485 WP_000059493.1.22537 WP_000059493.1.22620 WP_000059493.1.22870 WP_000059493.1.22979 WP_000059493.1.23102 WP_000059493.1.23114 WP_000059493.1.2314 WP_000059493.1.23192 WP_000059493.1.23259 WP_000059493.1.23460 WP_000059493.1.23472 WP_000059493.1.23482 WP_000059493.1.23634 WP_000059493.1.2364 WP_000059493.1.23932 WP_000059493.1.24017 WP_000059493.1.24206 WP_000059493.1.24308 WP_000059493.1.24578 WP_000059493.1.24737 WP_000059493.1.24779 WP_000059493.1.25008 WP_000059493.1.25015 WP_000059493.1.25206 WP_000059493.1.25405 WP_000059493.1.25454 WP_000059493.1.25493 WP_000059493.1.25668 WP_000059493.1.25690 WP_000059493.1.2570 WP_000059493.1.25740 WP_000059493.1.25814 WP_000059493.1.25988 WP_000059493.1.26282 WP_000059493.1.26311 WP_000059493.1.26319 WP_000059493.1.26429 WP_000059493.1.26440 WP_000059493.1.26493 WP_000059493.1.26551 WP_000059493.1.26567 WP_000059493.1.27010 WP_000059493.1.27173 WP_000059493.1.27206 WP_000059493.1.27423 WP_000059493.1.27561 WP_000059493.1.2763 WP_000059493.1.27665 WP_000059493.1.27707 WP_000059493.1.27761 WP_000059493.1.2777 WP_000059493.1.27857 WP_000059493.1.27977 WP_000059493.1.28094 WP_000059493.1.28126 WP_000059493.1.28170 WP_000059493.1.28302 WP_000059493.1.2835 WP_000059493.1.28370 WP_000059493.1.28538 WP_000059493.1.28575 WP_000059493.1.28625 WP_000059493.1.28655 WP_000059493.1.28694 WP_000059493.1.2879 WP_000059493.1.2890 WP_000059493.1.28938 WP_000059493.1.28946 WP_000059493.1.29006 WP_000059493.1.29010 WP_000059493.1.2910 WP_000059493.1.29588 WP_000059493.1.29601 WP_000059493.1.29606 WP_000059493.1.29615 WP_000059493.1.29619 WP_000059493.1.29704 WP_000059493.1.29969 WP_000059493.1.30006 WP_000059493.1.30027 WP_000059493.1.30180 WP_000059493.1.30469 WP_000059493.1.30505 WP_000059493.1.30507 WP_000059493.1.30535 WP_000059493.1.30547 WP_000059493.1.30794 WP_000059493.1.30833 WP_000059493.1.30835 WP_000059493.1.30972 WP_000059493.1.31 WP_000059493.1.3113 WP_000059493.1.31185 WP_000059493.1.3119 WP_000059493.1.31190 WP_000059493.1.31195 WP_000059493.1.31196 WP_000059493.1.31219 WP_000059493.1.31281 WP_000059493.1.31362 WP_000059493.1.31504 WP_000059493.1.31515 WP_000059493.1.31578 WP_000059493.1.31940 WP_000059493.1.31967 WP_000059493.1.31972 WP_000059493.1.32192 WP_000059493.1.32206 WP_000059493.1.32438 WP_000059493.1.32515 WP_000059493.1.32527 WP_000059493.1.32660 WP_000059493.1.32702 WP_000059493.1.32714 WP_000059493.1.32786 WP_000059493.1.32804 WP_000059493.1.32860 WP_000059493.1.32907 WP_000059493.1.33030 WP_000059493.1.33127 WP_000059493.1.33143 WP_000059493.1.33248 WP_000059493.1.33261 WP_000059493.1.333 WP_000059493.1.33492 WP_000059493.1.33553 WP_000059493.1.33592 WP_000059493.1.33894 WP_000059493.1.34043 WP_000059493.1.34075 WP_000059493.1.34257 WP_000059493.1.34279 WP_000059493.1.34319 WP_000059493.1.34453 WP_000059493.1.34610 WP_000059493.1.34856 WP_000059493.1.34975 WP_000059493.1.34977 WP_000059493.1.35045 WP_000059493.1.35129 WP_000059493.1.35184 WP_000059493.1.35404 WP_000059493.1.35408 WP_000059493.1.35425 WP_000059493.1.35429 WP_000059493.1.35446 WP_000059493.1.35463 WP_000059493.1.35503 WP_000059493.1.35509 WP_000059493.1.35590 WP_000059493.1.35940 WP_000059493.1.36003 WP_000059493.1.3601 WP_000059493.1.36609 WP_000059493.1.36690 WP_000059493.1.3670 WP_000059493.1.36918 WP_000059493.1.36931 WP_000059493.1.37073 WP_000059493.1.37111 WP_000059493.1.37112 WP_000059493.1.37256 WP_000059493.1.37293 WP_000059493.1.37370 WP_000059493.1.37376 WP_000059493.1.3744 WP_000059493.1.37498 WP_000059493.1.37504 WP_000059493.1.37618 WP_000059493.1.37687 WP_000059493.1.37968 WP_000059493.1.37978 WP_000059493.1.38125 WP_000059493.1.38145 WP_000059493.1.383 WP_000059493.1.3848 WP_000059493.1.38613 WP_000059493.1.38673 WP_000059493.1.3869 WP_000059493.1.38693 WP_000059493.1.38773 WP_000059493.1.38882 WP_000059493.1.38913 WP_000059493.1.39003 WP_000059493.1.39136 WP_000059493.1.39197 WP_000059493.1.39229 WP_000059493.1.39405 WP_000059493.1.39420 WP_000059493.1.39449 WP_000059493.1.39512 WP_000059493.1.39556 WP_000059493.1.39629 WP_000059493.1.39763 WP_000059493.1.39862 WP_000059493.1.39921 WP_000059493.1.39923 WP_000059493.1.40017 WP_000059493.1.40072 WP_000059493.1.40073 WP_000059493.1.4011 WP_000059493.1.40208 WP_000059493.1.40240 WP_000059493.1.40257 WP_000059493.1.40292 WP_000059493.1.40305 WP_000059493.1.40311 WP_000059493.1.40380 WP_000059493.1.40395 WP_000059493.1.40465 WP_000059493.1.40508 WP_000059493.1.40710 WP_000059493.1.4075 WP_000059493.1.4087 WP_000059493.1.40877 WP_000059493.1.41017 WP_000059493.1.41086 WP_000059493.1.41226 WP_000059493.1.41279 WP_000059493.1.41516 WP_000059493.1.41554 WP_000059493.1.41572 WP_000059493.1.41591 WP_000059493.1.41662 WP_000059493.1.41708 WP_000059493.1.41859 WP_000059493.1.41882 WP_000059493.1.41979 WP_000059493.1.41985 WP_000059493.1.42104 WP_000059493.1.42320 WP_000059493.1.42342 WP_000059493.1.42422 WP_000059493.1.4276 WP_000059493.1.42864 WP_000059493.1.4288 WP_000059493.1.43018 WP_000059493.1.43041 WP_000059493.1.43244 WP_000059493.1.43312 WP_000059493.1.43334 WP_000059493.1.43351 WP_000059493.1.43437 WP_000059493.1.43522 WP_000059493.1.43613 WP_000059493.1.43668 WP_000059493.1.43886 WP_000059493.1.44043 WP_000059493.1.44099 WP_000059493.1.44121 WP_000059493.1.44291 WP_000059493.1.44310 WP_000059493.1.44386 WP_000059493.1.44479 WP_000059493.1.44640 WP_000059493.1.4467 WP_000059493.1.44747 WP_000059493.1.4485 WP_000059493.1.44877 WP_000059493.1.44927 WP_000059493.1.44971 WP_000059493.1.45067 WP_000059493.1.45074 WP_000059493.1.45079 WP_000059493.1.45098 WP_000059493.1.45177 WP_000059493.1.45184 WP_000059493.1.45259 WP_000059493.1.45344 WP_000059493.1.45349 WP_000059493.1.45365 WP_000059493.1.45550 WP_000059493.1.45585 WP_000059493.1.45660 WP_000059493.1.45690 WP_000059493.1.45797 WP_000059493.1.458 WP_000059493.1.46011 WP_000059493.1.46069 WP_000059493.1.46173 WP_000059493.1.46174 WP_000059493.1.46187 WP_000059493.1.46303 WP_000059493.1.46595 WP_000059493.1.46675 WP_000059493.1.46930 WP_000059493.1.47057 WP_000059493.1.47429 WP_000059493.1.47448 WP_000059493.1.4747 WP_000059493.1.47472 WP_000059493.1.47478 WP_000059493.1.47621 WP_000059493.1.47799 WP_000059493.1.48242 WP_000059493.1.48253 WP_000059493.1.483 WP_000059493.1.48367 WP_000059493.1.48377 WP_000059493.1.4853 WP_000059493.1.48788 WP_000059493.1.4885 WP_000059493.1.48876 WP_000059493.1.48894 WP_000059493.1.48919 WP_000059493.1.49155 WP_000059493.1.49204 WP_000059493.1.49239 WP_000059493.1.49256 WP_000059493.1.49290 WP_000059493.1.49340 WP_000059493.1.49366 WP_000059493.1.49490 WP_000059493.1.49515 WP_000059493.1.49572 WP_000059493.1.4979 WP_000059493.1.49805 WP_000059493.1.49929 WP_000059493.1.50080 WP_000059493.1.50161 WP_000059493.1.50211 WP_000059493.1.50376 WP_000059493.1.50389 WP_000059493.1.50676 WP_000059493.1.50774 WP_000059493.1.50804 WP_000059493.1.50808 WP_000059493.1.5088 WP_000059493.1.50908 WP_000059493.1.50941 WP_000059493.1.51014 WP_000059493.1.51022 WP_000059493.1.51179 WP_000059493.1.51182 WP_000059493.1.51186 WP_000059493.1.51487 WP_000059493.1.51488 WP_000059493.1.51634 WP_000059493.1.51649 WP_000059493.1.51686 WP_000059493.1.51756 WP_000059493.1.51911 WP_000059493.1.51932 WP_000059493.1.51989 WP_000059493.1.52121 WP_000059493.1.52148 WP_000059493.1.52346 WP_000059493.1.52361 WP_000059493.1.52653 WP_000059493.1.52656 WP_000059493.1.52743 WP_000059493.1.52857 WP_000059493.1.52898 WP_000059493.1.52915 WP_000059493.1.53190 WP_000059493.1.53406 WP_000059493.1.53436 WP_000059493.1.53529 WP_000059493.1.53543 WP_000059493.1.53812 WP_000059493.1.54033 WP_000059493.1.54075 WP_000059493.1.54196 WP_000059493.1.542 WP_000059493.1.54209 WP_000059493.1.54271 WP_000059493.1.54273 WP_000059493.1.54274 WP_000059493.1.54319 WP_000059493.1.54364 WP_000059493.1.54400 WP_000059493.1.54644 WP_000059493.1.54662 WP_000059493.1.54722 WP_000059493.1.54749 WP_000059493.1.54764 WP_000059493.1.55008 WP_000059493.1.55152 WP_000059493.1.55156 WP_000059493.1.55285 WP_000059493.1.55475 WP_000059493.1.55647 WP_000059493.1.55743 WP_000059493.1.55768 WP_000059493.1.55782 WP_000059493.1.55796 WP_000059493.1.55993 WP_000059493.1.56002 WP_000059493.1.56012 WP_000059493.1.56105 WP_000059493.1.56238 WP_000059493.1.56286 WP_000059493.1.56304 WP_000059493.1.56414 WP_000059493.1.56438 WP_000059493.1.56597 WP_000059493.1.56601 WP_000059493.1.56614 WP_000059493.1.56671 WP_000059493.1.56682 WP_000059493.1.56875 WP_000059493.1.56877 WP_000059493.1.57168 WP_000059493.1.57187 WP_000059493.1.57232 WP_000059493.1.57377 WP_000059493.1.57418 WP_000059493.1.57433 WP_000059493.1.57515 WP_000059493.1.57529 WP_000059493.1.57576 WP_000059493.1.57601 WP_000059493.1.57607 WP_000059493.1.57763 WP_000059493.1.57862 WP_000059493.1.57890 WP_000059493.1.57891 WP_000059493.1.57978 WP_000059493.1.5801 WP_000059493.1.58041 WP_000059493.1.58418 WP_000059493.1.5854 WP_000059493.1.58548 WP_000059493.1.5858 WP_000059493.1.58662 WP_000059493.1.58669 WP_000059493.1.58745 WP_000059493.1.58803 WP_000059493.1.5886 WP_000059493.1.59094 WP_000059493.1.59224 WP_000059493.1.59375 WP_000059493.1.59458 WP_000059493.1.59490 WP_000059493.1.59508 WP_000059493.1.5953 WP_000059493.1.59684 WP_000059493.1.59694 WP_000059493.1.59771 WP_000059493.1.5979 WP_000059493.1.59953 WP_000059493.1.60008 WP_000059493.1.60021 WP_000059493.1.60069 WP_000059493.1.60140 WP_000059493.1.60155 WP_000059493.1.60285 WP_000059493.1.60379 WP_000059493.1.60464 WP_000059493.1.60874 WP_000059493.1.60941 WP_000059493.1.61078 WP_000059493.1.6114 WP_000059493.1.61232 WP_000059493.1.6129 WP_000059493.1.61296 WP_000059493.1.61345 WP_000059493.1.61417 WP_000059493.1.61574 WP_000059493.1.61609 WP_000059493.1.61712 WP_000059493.1.61714 WP_000059493.1.61730 WP_000059493.1.61857 WP_000059493.1.61918 WP_000059493.1.61952 WP_000059493.1.62007 WP_000059493.1.62025 WP_000059493.1.62204 WP_000059493.1.62304 WP_000059493.1.62364 WP_000059493.1.62374 WP_000059493.1.62403 WP_000059493.1.6253 WP_000059493.1.62570 WP_000059493.1.62853 WP_000059493.1.62903 WP_000059493.1.62910 WP_000059493.1.62955 WP_000059493.1.63063 WP_000059493.1.63181 WP_000059493.1.63203 WP_000059493.1.63256 WP_000059493.1.63290 WP_000059493.1.63382 WP_000059493.1.63432 WP_000059493.1.63461 WP_000059493.1.63479 WP_000059493.1.63577 WP_000059493.1.63664 WP_000059493.1.63718 WP_000059493.1.6375 WP_000059493.1.63757 WP_000059493.1.63834 WP_000059493.1.64046 WP_000059493.1.6423 WP_000059493.1.64244 WP_000059493.1.64403 WP_000059493.1.64649 WP_000059493.1.64702 WP_000059493.1.64757 WP_000059493.1.64781 WP_000059493.1.64831 WP_000059493.1.6489 WP_000059493.1.65018 WP_000059493.1.65028 WP_000059493.1.65171 WP_000059493.1.65248 WP_000059493.1.6535 WP_000059493.1.65474 WP_000059493.1.65572 WP_000059493.1.65633 WP_000059493.1.6565 WP_000059493.1.65696 WP_000059493.1.6575 WP_000059493.1.65782 WP_000059493.1.6630 WP_000059493.1.66314 WP_000059493.1.66358 WP_000059493.1.66362 WP_000059493.1.6638 WP_000059493.1.6640 WP_000059493.1.66600 WP_000059493.1.66698 WP_000059493.1.6680 WP_000059493.1.66834 WP_000059493.1.66901 WP_000059493.1.66962 WP_000059493.1.67037 WP_000059493.1.67045 WP_000059493.1.67181 WP_000059493.1.67268 WP_000059493.1.67347 WP_000059493.1.67465 WP_000059493.1.67552 WP_000059493.1.67682 WP_000059493.1.67887 WP_000059493.1.68073 WP_000059493.1.68206 WP_000059493.1.6827 WP_000059493.1.68275 WP_000059493.1.6849 WP_000059493.1.68547 WP_000059493.1.68589 WP_000059493.1.68655 WP_000059493.1.68656 WP_000059493.1.68778 WP_000059493.1.68787 WP_000059493.1.68894 WP_000059493.1.68928 WP_000059493.1.68975 WP_000059493.1.69006 WP_000059493.1.6913 WP_000059493.1.69146 WP_000059493.1.69255 WP_000059493.1.69397 WP_000059493.1.69564 WP_000059493.1.69644 WP_000059493.1.69704 WP_000059493.1.7021 WP_000059493.1.70241 WP_000059493.1.70269 WP_000059493.1.70289 WP_000059493.1.70447 WP_000059493.1.70485 WP_000059493.1.70643 WP_000059493.1.70683 WP_000059493.1.70883 WP_000059493.1.70922 WP_000059493.1.70948 WP_000059493.1.71116 WP_000059493.1.71146 WP_000059493.1.71165 WP_000059493.1.71188 WP_000059493.1.71202 WP_000059493.1.71243 WP_000059493.1.71337 WP_000059493.1.71378 WP_000059493.1.71401 WP_000059493.1.71691 WP_000059493.1.71702 WP_000059493.1.71750 WP_000059493.1.71845 WP_000059493.1.71881 WP_000059493.1.71908 WP_000059493.1.71952 WP_000059493.1.71973 WP_000059493.1.72105 WP_000059493.1.72203 WP_000059493.1.72372 WP_000059493.1.72376 WP_000059493.1.72594 WP_000059493.1.72871 WP_000059493.1.72975 WP_000059493.1.73062 WP_000059493.1.7315 WP_000059493.1.73200 WP_000059493.1.7334 WP_000059493.1.73377 WP_000059493.1.73481 WP_000059493.1.7356 WP_000059493.1.73561 WP_000059493.1.73581 WP_000059493.1.73617 WP_000059493.1.73667 WP_000059493.1.73753 WP_000059493.1.73758 WP_000059493.1.73794 WP_000059493.1.7387 WP_000059493.1.73924 WP_000059493.1.73926 WP_000059493.1.74029 WP_000059493.1.74191 WP_000059493.1.7433 WP_000059493.1.74379 WP_000059493.1.74410 WP_000059493.1.74466 WP_000059493.1.74529 WP_000059493.1.74545 WP_000059493.1.74745 WP_000059493.1.75129 WP_000059493.1.75187 WP_000059493.1.75288 WP_000059493.1.75334 WP_000059493.1.75362 WP_000059493.1.75385 WP_000059493.1.75392 WP_000059493.1.75760 WP_000059493.1.75764 WP_000059493.1.75828 WP_000059493.1.75837 WP_000059493.1.75874 WP_000059493.1.75945 WP_000059493.1.76020 WP_000059493.1.76252 WP_000059493.1.76445 WP_000059493.1.7660 WP_000059493.1.76673 WP_000059493.1.76706 WP_000059493.1.76721 WP_000059493.1.76756 WP_000059493.1.76760 WP_000059493.1.76875 WP_000059493.1.76880 WP_000059493.1.76899 WP_000059493.1.77038 WP_000059493.1.77047 WP_000059493.1.77080 WP_000059493.1.7712 WP_000059493.1.77180 WP_000059493.1.77244 WP_000059493.1.77292 WP_000059493.1.77349 WP_000059493.1.77514 WP_000059493.1.77529 WP_000059493.1.77549 WP_000059493.1.77692 WP_000059493.1.7782 WP_000059493.1.77851 WP_000059493.1.77898 WP_000059493.1.77918 WP_000059493.1.77960 WP_000059493.1.77971 WP_000059493.1.78033 WP_000059493.1.78076 WP_000059493.1.78096 WP_000059493.1.78100 WP_000059493.1.78110 WP_000059493.1.78120 WP_000059493.1.78383 WP_000059493.1.78407 WP_000059493.1.7861 WP_000059493.1.78618 WP_000059493.1.78673 WP_000059493.1.78735 WP_000059493.1.78802 WP_000059493.1.78830 WP_000059493.1.78835 WP_000059493.1.78871 WP_000059493.1.78874 WP_000059493.1.78918 WP_000059493.1.78930 WP_000059493.1.79151 WP_000059493.1.79167 WP_000059493.1.79335 WP_000059493.1.79462 WP_000059493.1.79472 WP_000059493.1.79490 WP_000059493.1.79495 WP_000059493.1.79529 WP_000059493.1.79570 WP_000059493.1.7964 WP_000059493.1.79659 WP_000059493.1.79668 WP_000059493.1.79708 WP_000059493.1.79845 WP_000059493.1.80077 WP_000059493.1.80137 WP_000059493.1.80182 WP_000059493.1.80296 WP_000059493.1.80366 WP_000059493.1.80780 WP_000059493.1.80831 WP_000059493.1.80850 WP_000059493.1.80881 WP_000059493.1.80939 WP_000059493.1.8096 WP_000059493.1.81037 WP_000059493.1.81069 WP_000059493.1.81149 WP_000059493.1.81175 WP_000059493.1.8119 WP_000059493.1.81193 WP_000059493.1.81354 WP_000059493.1.81410 WP_000059493.1.81425 WP_000059493.1.81785 WP_000059493.1.81902 WP_000059493.1.81974 WP_000059493.1.82337 WP_000059493.1.82479 WP_000059493.1.82503 WP_000059493.1.82515 WP_000059493.1.82676 WP_000059493.1.82761 WP_000059493.1.8282 WP_000059493.1.82944 WP_000059493.1.82956 WP_000059493.1.83092 WP_000059493.1.83163 WP_000059493.1.83305 WP_000059493.1.83365 WP_000059493.1.83413 WP_000059493.1.83491 WP_000059493.1.83523 WP_000059493.1.8354 WP_000059493.1.83721 WP_000059493.1.83760 WP_000059493.1.83995 WP_000059493.1.84103 WP_000059493.1.84283 WP_000059493.1.84392 WP_000059493.1.8441 WP_000059493.1.84532 WP_000059493.1.84659 WP_000059493.1.84693 WP_000059493.1.84899 WP_000059493.1.8497 WP_000059493.1.85040 WP_000059493.1.85134 WP_000059493.1.85178 WP_000059493.1.85190 WP_000059493.1.8533 WP_000059493.1.8545 WP_000059493.1.85481 WP_000059493.1.85483 WP_000059493.1.85541 WP_000059493.1.8556 WP_000059493.1.85615 WP_000059493.1.85617 WP_000059493.1.85663 WP_000059493.1.85671 WP_000059493.1.85672 WP_000059493.1.85777 WP_000059493.1.85855 WP_000059493.1.85886 WP_000059493.1.85900 WP_000059493.1.85904 WP_000059493.1.85976 WP_000059493.1.86306 WP_000059493.1.86356 WP_000059493.1.86450 WP_000059493.1.86469 WP_000059493.1.86580 WP_000059493.1.86588 WP_000059493.1.86661 WP_000059493.1.8672 WP_000059493.1.8678 WP_000059493.1.86810 WP_000059493.1.8684 WP_000059493.1.86895 WP_000059493.1.86906 WP_000059493.1.87095 WP_000059493.1.87323 WP_000059493.1.8736 WP_000059493.1.87460 WP_000059493.1.87552 WP_000059493.1.87779 WP_000059493.1.87945 WP_000059493.1.88019 WP_000059493.1.88073 WP_000059493.1.8809 WP_000059493.1.88291 WP_000059493.1.88293 WP_000059493.1.8837 WP_000059493.1.88393 WP_000059493.1.88703 WP_000059493.1.88792 WP_000059493.1.88902 WP_000059493.1.8891 WP_000059493.1.88981 WP_000059493.1.89008 WP_000059493.1.89116 WP_000059493.1.89138 WP_000059493.1.89512 WP_000059493.1.89527 WP_000059493.1.89570 WP_000059493.1.89604 WP_000059493.1.89622 WP_000059493.1.89659 WP_000059493.1.8996 WP_000059493.1.90097 WP_000059493.1.90252 WP_000059493.1.90417 WP_000059493.1.90453 WP_000059493.1.90458 WP_000059493.1.90585 WP_000059493.1.90641 WP_000059493.1.90734 WP_000059493.1.91003 WP_000059493.1.91069 WP_000059493.1.91278 WP_000059493.1.9131 WP_000059493.1.91512 WP_000059493.1.91564 WP_000059493.1.91628 WP_000059493.1.91655 WP_000059493.1.91724 WP_000059493.1.91732 WP_000059493.1.91788 WP_000059493.1.92060 WP_000059493.1.92093 WP_000059493.1.92171 WP_000059493.1.92183 WP_000059493.1.92208 WP_000059493.1.92268 WP_000059493.1.92310 WP_000059493.1.92318 WP_000059493.1.92443 WP_000059493.1.92482 WP_000059493.1.92531 WP_000059493.1.92669 WP_000059493.1.92671 WP_000059493.1.92738 WP_000059493.1.93086 WP_000059493.1.93101 WP_000059493.1.93136 WP_000059493.1.93155 WP_000059493.1.93275 WP_000059493.1.93365 WP_000059493.1.93376 WP_000059493.1.93543 WP_000059493.1.93650 WP_000059493.1.93656 WP_000059493.1.93662 WP_000059493.1.937 WP_000059493.1.93705 WP_000059493.1.93804 WP_000059493.1.9389 WP_000059493.1.93994 WP_000059493.1.94072 WP_000059493.1.94162 WP_000059493.1.94168 WP_000059493.1.94198 WP_000059493.1.9432 WP_000059493.1.94354 WP_000059493.1.94380 WP_000059493.1.94458 WP_000059493.1.94565 WP_000059493.1.94584 WP_000059493.1.94674 WP_000059493.1.94796 WP_000059493.1.94959 WP_000059493.1.95051 WP_000059493.1.95085 WP_000059493.1.95121 WP_000059493.1.95282 WP_000059493.1.95546 WP_000059493.1.95630 WP_000059493.1.95911 WP_000059493.1.96139 WP_000059493.1.96317 WP_000059493.1.96343 WP_000059493.1.9644 WP_000059493.1.96469 WP_000059493.1.96497 WP_000059493.1.96500 WP_000059493.1.96555 WP_000059493.1.96563 WP_000059493.1.96732 WP_000059493.1.96771 WP_000059493.1.97015 WP_000059493.1.97145 WP_000059493.1.97190 WP_000059493.1.97318 WP_000059493.1.97369 WP_000059493.1.97594 WP_000059493.1.97597 WP_000059493.1.97613 WP_000059493.1.97620 WP_000059493.1.97727 WP_000059493.1.97732 WP_000059493.1.97736 WP_000059493.1.9775 WP_000059493.1.97846 WP_000059493.1.98006 WP_000059493.1.98019 WP_000059493.1.98022 WP_000059493.1.98110 WP_000059493.1.98146 WP_000059493.1.98219 WP_000059493.1.9841 WP_000059493.1.98495 WP_000059493.1.98531 WP_000059493.1.98577 WP_000059493.1.98676 WP_000059493.1.98677 WP_000059493.1.98760 WP_000059493.1.98843 WP_000059493.1.9898 WP_000059493.1.99098 WP_000059493.1.99184 WP_000059493.1.99267 WP_000059493.1.99276 WP_000059493.1.99646 WP_000059493.1.99657 WP_000059493.1.99660 WP_000059493.1.99712 WP_000059493.1.99813 WP_000059493.1.99858 WP_000059493.1.99889 WP_000059493.1.99958 ABAM02000001|CDS_1842085-1843311 ABAO01000010|CDS_32199-30973 AE006468|CDS_1382194-1383420 CP001363|CDS_1392170-1393396 FN424405|CDS_1378706-1379932 gi|378699192|ref|YP_005181149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]