SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482903368|ref|YP_007901928.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482903368|ref|YP_007901928.1|
Domain Number 1 Region: 2-388
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.77e-94
Family Cystathionine synthase-like 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|482903368|ref|YP_007901928.1|
Sequence length 400
Comment aminotransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MDFNQIINRNNTGSVKWDFIERHFGDGAGKLLPMWVSDFDFACPPEVQAALHQRIEHGVF
GYSERDEAYFNALLHWFSSRHQLTLKQEWVCSVEGVVPGLALLVQMLTHPGDGVVVQGPY
YGSFAKIITLNGRKLLENPLSESPDDGYQMDFCQLERLFRHERPPLMILCNPHNPTGRCW
SANELEQLLLLCEAYDVTLISDEIWADLLLPGETFTSVLHLGVRWHKRVISATAASKTFG
LSSLRISNFLIPDPTLRQRFLSRLDAHGLDVFNALSVQAATTAWNESRQWLDSLLDYLAE
NRRWFVEHATEHLPWARIVPAQGTYLLWMDCKKLGLDDEQLKWVMADVAGIAPSMGSGFG
PAGSGFIRLNLGCPRTYLEMAIDGLKRISVKTIKGIPTGG
Download sequence
Identical sequences A0A0F6B1G9 A0A0F7J6B1 A0A0H3NBN4 A0A0M2IUG5 A0A0W3WTF1 A0A249UYR0 A0A2H9YKG5 E8XJ04 Q8ZPF3
gi|16764901|ref|NP_460516.1| gi|482903368|ref|YP_007901928.1| gi|378450088|ref|YP_005237447.1| gi|526220203|ref|YP_008265761.1| 99287.STM1557 gi|378988898|ref|YP_005252062.1| gi|525838252|ref|YP_008255241.1| gi|378699437|ref|YP_005181394.1| gi|379700727|ref|YP_005242455.1| gi|383496256|ref|YP_005396945.1| ABAM02000001|CDS_2094660-2095862 ABAO01000018|CDS_44556-45758 AE006468|CDS_1634745-1635947 CP001363|CDS_1644722-1645924 FN424405|CDS_1627260-1628462 NP_460516.1.58477 WP_000347159.1.100258 WP_000347159.1.100376 WP_000347159.1.100436 WP_000347159.1.100488 WP_000347159.1.100597 WP_000347159.1.10076 WP_000347159.1.100781 WP_000347159.1.100869 WP_000347159.1.100871 WP_000347159.1.100882 WP_000347159.1.101007 WP_000347159.1.101020 WP_000347159.1.101078 WP_000347159.1.101320 WP_000347159.1.101386 WP_000347159.1.101404 WP_000347159.1.101420 WP_000347159.1.101707 WP_000347159.1.101734 WP_000347159.1.101878 WP_000347159.1.10266 WP_000347159.1.10429 WP_000347159.1.10678 WP_000347159.1.10992 WP_000347159.1.11000 WP_000347159.1.11024 WP_000347159.1.11098 WP_000347159.1.11168 WP_000347159.1.11190 WP_000347159.1.11295 WP_000347159.1.11455 WP_000347159.1.11458 WP_000347159.1.11518 WP_000347159.1.11543 WP_000347159.1.11772 WP_000347159.1.11897 WP_000347159.1.12025 WP_000347159.1.12370 WP_000347159.1.1264 WP_000347159.1.12728 WP_000347159.1.13106 WP_000347159.1.13130 WP_000347159.1.13334 WP_000347159.1.13414 WP_000347159.1.13488 WP_000347159.1.13509 WP_000347159.1.13669 WP_000347159.1.13741 WP_000347159.1.1387 WP_000347159.1.13932 WP_000347159.1.14239 WP_000347159.1.14379 WP_000347159.1.14406 WP_000347159.1.14466 WP_000347159.1.14554 WP_000347159.1.14852 WP_000347159.1.1489 WP_000347159.1.15124 WP_000347159.1.15226 WP_000347159.1.15508 WP_000347159.1.15784 WP_000347159.1.15830 WP_000347159.1.16062 WP_000347159.1.16063 WP_000347159.1.16103 WP_000347159.1.16226 WP_000347159.1.16328 WP_000347159.1.1635 WP_000347159.1.16614 WP_000347159.1.16686 WP_000347159.1.16691 WP_000347159.1.167 WP_000347159.1.16732 WP_000347159.1.16786 WP_000347159.1.16896 WP_000347159.1.16916 WP_000347159.1.1700 WP_000347159.1.17307 WP_000347159.1.17546 WP_000347159.1.17705 WP_000347159.1.18111 WP_000347159.1.18267 WP_000347159.1.18282 WP_000347159.1.18468 WP_000347159.1.18705 WP_000347159.1.18776 WP_000347159.1.18822 WP_000347159.1.18881 WP_000347159.1.18940 WP_000347159.1.18949 WP_000347159.1.19053 WP_000347159.1.19320 WP_000347159.1.19460 WP_000347159.1.19642 WP_000347159.1.19702 WP_000347159.1.19706 WP_000347159.1.19749 WP_000347159.1.19802 WP_000347159.1.19809 WP_000347159.1.19867 WP_000347159.1.1998 WP_000347159.1.20 WP_000347159.1.2010 WP_000347159.1.20212 WP_000347159.1.20330 WP_000347159.1.20362 WP_000347159.1.20418 WP_000347159.1.20525 WP_000347159.1.20886 WP_000347159.1.20908 WP_000347159.1.21049 WP_000347159.1.21146 WP_000347159.1.21246 WP_000347159.1.21548 WP_000347159.1.21603 WP_000347159.1.21751 WP_000347159.1.21757 WP_000347159.1.2205 WP_000347159.1.2221 WP_000347159.1.2235 WP_000347159.1.22427 WP_000347159.1.2246 WP_000347159.1.22537 WP_000347159.1.22620 WP_000347159.1.22870 WP_000347159.1.22979 WP_000347159.1.23102 WP_000347159.1.23259 WP_000347159.1.23472 WP_000347159.1.23482 WP_000347159.1.23932 WP_000347159.1.24017 WP_000347159.1.24206 WP_000347159.1.24737 WP_000347159.1.24779 WP_000347159.1.25015 WP_000347159.1.25206 WP_000347159.1.25454 WP_000347159.1.25493 WP_000347159.1.25668 WP_000347159.1.25740 WP_000347159.1.25988 WP_000347159.1.26282 WP_000347159.1.26319 WP_000347159.1.26440 WP_000347159.1.26551 WP_000347159.1.27010 WP_000347159.1.27173 WP_000347159.1.27206 WP_000347159.1.27423 WP_000347159.1.2763 WP_000347159.1.27665 WP_000347159.1.27707 WP_000347159.1.27761 WP_000347159.1.2777 WP_000347159.1.27857 WP_000347159.1.27977 WP_000347159.1.28094 WP_000347159.1.28126 WP_000347159.1.28170 WP_000347159.1.28302 WP_000347159.1.28370 WP_000347159.1.28538 WP_000347159.1.28625 WP_000347159.1.28938 WP_000347159.1.29006 WP_000347159.1.29010 WP_000347159.1.29588 WP_000347159.1.29601 WP_000347159.1.29619 WP_000347159.1.29704 WP_000347159.1.29969 WP_000347159.1.30006 WP_000347159.1.30027 WP_000347159.1.30469 WP_000347159.1.30505 WP_000347159.1.30535 WP_000347159.1.30972 WP_000347159.1.31185 WP_000347159.1.3119 WP_000347159.1.31195 WP_000347159.1.31219 WP_000347159.1.31281 WP_000347159.1.31362 WP_000347159.1.31504 WP_000347159.1.31515 WP_000347159.1.31578 WP_000347159.1.31972 WP_000347159.1.32438 WP_000347159.1.32515 WP_000347159.1.32527 WP_000347159.1.32660 WP_000347159.1.32702 WP_000347159.1.32714 WP_000347159.1.32786 WP_000347159.1.32804 WP_000347159.1.32860 WP_000347159.1.32907 WP_000347159.1.33248 WP_000347159.1.33261 WP_000347159.1.33553 WP_000347159.1.33825 WP_000347159.1.33894 WP_000347159.1.34043 WP_000347159.1.34279 WP_000347159.1.34319 WP_000347159.1.34453 WP_000347159.1.34610 WP_000347159.1.34856 WP_000347159.1.34975 WP_000347159.1.34977 WP_000347159.1.35045 WP_000347159.1.35184 WP_000347159.1.35408 WP_000347159.1.35425 WP_000347159.1.35446 WP_000347159.1.35463 WP_000347159.1.35503 WP_000347159.1.36609 WP_000347159.1.36690 WP_000347159.1.3670 WP_000347159.1.36918 WP_000347159.1.37063 WP_000347159.1.37073 WP_000347159.1.37111 WP_000347159.1.37112 WP_000347159.1.37256 WP_000347159.1.37376 WP_000347159.1.37504 WP_000347159.1.37687 WP_000347159.1.37978 WP_000347159.1.38125 WP_000347159.1.38145 WP_000347159.1.383 WP_000347159.1.3848 WP_000347159.1.38613 WP_000347159.1.3869 WP_000347159.1.38773 WP_000347159.1.38882 WP_000347159.1.38913 WP_000347159.1.39003 WP_000347159.1.39197 WP_000347159.1.39420 WP_000347159.1.39449 WP_000347159.1.39556 WP_000347159.1.39921 WP_000347159.1.39923 WP_000347159.1.4011 WP_000347159.1.40240 WP_000347159.1.40257 WP_000347159.1.40292 WP_000347159.1.40305 WP_000347159.1.40311 WP_000347159.1.40380 WP_000347159.1.40465 WP_000347159.1.40508 WP_000347159.1.4075 WP_000347159.1.4087 WP_000347159.1.41017 WP_000347159.1.41226 WP_000347159.1.41516 WP_000347159.1.41554 WP_000347159.1.41572 WP_000347159.1.41591 WP_000347159.1.41662 WP_000347159.1.41708 WP_000347159.1.41859 WP_000347159.1.41979 WP_000347159.1.41985 WP_000347159.1.42104 WP_000347159.1.42342 WP_000347159.1.4276 WP_000347159.1.42864 WP_000347159.1.4288 WP_000347159.1.43244 WP_000347159.1.43312 WP_000347159.1.43334 WP_000347159.1.43351 WP_000347159.1.43522 WP_000347159.1.43613 WP_000347159.1.44005 WP_000347159.1.44099 WP_000347159.1.44386 WP_000347159.1.44640 WP_000347159.1.4467 WP_000347159.1.44747 WP_000347159.1.44927 WP_000347159.1.44971 WP_000347159.1.45067 WP_000347159.1.45074 WP_000347159.1.45098 WP_000347159.1.45184 WP_000347159.1.45344 WP_000347159.1.45550 WP_000347159.1.45585 WP_000347159.1.45797 WP_000347159.1.458 WP_000347159.1.46011 WP_000347159.1.46112 WP_000347159.1.46173 WP_000347159.1.46187 WP_000347159.1.46303 WP_000347159.1.46675 WP_000347159.1.46930 WP_000347159.1.47429 WP_000347159.1.47448 WP_000347159.1.47472 WP_000347159.1.47478 WP_000347159.1.47621 WP_000347159.1.48242 WP_000347159.1.48253 WP_000347159.1.483 WP_000347159.1.48788 WP_000347159.1.4885 WP_000347159.1.48876 WP_000347159.1.49155 WP_000347159.1.49204 WP_000347159.1.49340 WP_000347159.1.49515 WP_000347159.1.49805 WP_000347159.1.50080 WP_000347159.1.50211 WP_000347159.1.50376 WP_000347159.1.50389 WP_000347159.1.50774 WP_000347159.1.50908 WP_000347159.1.51014 WP_000347159.1.51022 WP_000347159.1.51179 WP_000347159.1.51182 WP_000347159.1.51488 WP_000347159.1.51649 WP_000347159.1.51756 WP_000347159.1.52148 WP_000347159.1.52346 WP_000347159.1.52361 WP_000347159.1.52656 WP_000347159.1.52898 WP_000347159.1.52915 WP_000347159.1.53190 WP_000347159.1.53406 WP_000347159.1.53436 WP_000347159.1.53466 WP_000347159.1.54075 WP_000347159.1.54196 WP_000347159.1.542 WP_000347159.1.54209 WP_000347159.1.54271 WP_000347159.1.54273 WP_000347159.1.54274 WP_000347159.1.54400 WP_000347159.1.54644 WP_000347159.1.54749 WP_000347159.1.55156 WP_000347159.1.55743 WP_000347159.1.55768 WP_000347159.1.55782 WP_000347159.1.55796 WP_000347159.1.55993 WP_000347159.1.56012 WP_000347159.1.56105 WP_000347159.1.56238 WP_000347159.1.56286 WP_000347159.1.56414 WP_000347159.1.56438 WP_000347159.1.56597 WP_000347159.1.56601 WP_000347159.1.56671 WP_000347159.1.56682 WP_000347159.1.57232 WP_000347159.1.57433 WP_000347159.1.57515 WP_000347159.1.57529 WP_000347159.1.57607 WP_000347159.1.57763 WP_000347159.1.57862 WP_000347159.1.57890 WP_000347159.1.57891 WP_000347159.1.57978 WP_000347159.1.5801 WP_000347159.1.58418 WP_000347159.1.5854 WP_000347159.1.58548 WP_000347159.1.58745 WP_000347159.1.58803 WP_000347159.1.5886 WP_000347159.1.59224 WP_000347159.1.59375 WP_000347159.1.59490 WP_000347159.1.59508 WP_000347159.1.5953 WP_000347159.1.59771 WP_000347159.1.5979 WP_000347159.1.60021 WP_000347159.1.60069 WP_000347159.1.60140 WP_000347159.1.60155 WP_000347159.1.60285 WP_000347159.1.60874 WP_000347159.1.60941 WP_000347159.1.61078 WP_000347159.1.6114 WP_000347159.1.61232 WP_000347159.1.61296 WP_000347159.1.61345 WP_000347159.1.61574 WP_000347159.1.61714 WP_000347159.1.61857 WP_000347159.1.61918 WP_000347159.1.61952 WP_000347159.1.62025 WP_000347159.1.62204 WP_000347159.1.62570 WP_000347159.1.62853 WP_000347159.1.62910 WP_000347159.1.62955 WP_000347159.1.63063 WP_000347159.1.63181 WP_000347159.1.63256 WP_000347159.1.63290 WP_000347159.1.63432 WP_000347159.1.63461 WP_000347159.1.63479 WP_000347159.1.63577 WP_000347159.1.63664 WP_000347159.1.6375 WP_000347159.1.63757 WP_000347159.1.64244 WP_000347159.1.64403 WP_000347159.1.64702 WP_000347159.1.64757 WP_000347159.1.6489 WP_000347159.1.65018 WP_000347159.1.6535 WP_000347159.1.65572 WP_000347159.1.6565 WP_000347159.1.6575 WP_000347159.1.65782 WP_000347159.1.6630 WP_000347159.1.66358 WP_000347159.1.66362 WP_000347159.1.6640 WP_000347159.1.66600 WP_000347159.1.6680 WP_000347159.1.66901 WP_000347159.1.66962 WP_000347159.1.67037 WP_000347159.1.67045 WP_000347159.1.67268 WP_000347159.1.67347 WP_000347159.1.67552 WP_000347159.1.67682 WP_000347159.1.67829 WP_000347159.1.67887 WP_000347159.1.68073 WP_000347159.1.68275 WP_000347159.1.6849 WP_000347159.1.68656 WP_000347159.1.68894 WP_000347159.1.69006 WP_000347159.1.69146 WP_000347159.1.69255 WP_000347159.1.69397 WP_000347159.1.69564 WP_000347159.1.69704 WP_000347159.1.7021 WP_000347159.1.70289 WP_000347159.1.70447 WP_000347159.1.70485 WP_000347159.1.70683 WP_000347159.1.70883 WP_000347159.1.70922 WP_000347159.1.71116 WP_000347159.1.71146 WP_000347159.1.71165 WP_000347159.1.71188 WP_000347159.1.71202 WP_000347159.1.71243 WP_000347159.1.71337 WP_000347159.1.71378 WP_000347159.1.71481 WP_000347159.1.71691 WP_000347159.1.71702 WP_000347159.1.71845 WP_000347159.1.71881 WP_000347159.1.72105 WP_000347159.1.72203 WP_000347159.1.72372 WP_000347159.1.72376 WP_000347159.1.72871 WP_000347159.1.73062 WP_000347159.1.7315 WP_000347159.1.73200 WP_000347159.1.7334 WP_000347159.1.73377 WP_000347159.1.73481 WP_000347159.1.73561 WP_000347159.1.73581 WP_000347159.1.73667 WP_000347159.1.73753 WP_000347159.1.73794 WP_000347159.1.7387 WP_000347159.1.73924 WP_000347159.1.73926 WP_000347159.1.74029 WP_000347159.1.74191 WP_000347159.1.7433 WP_000347159.1.74379 WP_000347159.1.74410 WP_000347159.1.74466 WP_000347159.1.74529 WP_000347159.1.74745 WP_000347159.1.75129 WP_000347159.1.75187 WP_000347159.1.75288 WP_000347159.1.75362 WP_000347159.1.75392 WP_000347159.1.75764 WP_000347159.1.75828 WP_000347159.1.75837 WP_000347159.1.75945 WP_000347159.1.76252 WP_000347159.1.7660 WP_000347159.1.76673 WP_000347159.1.76706 WP_000347159.1.76756 WP_000347159.1.76880 WP_000347159.1.77047 WP_000347159.1.77080 WP_000347159.1.7712 WP_000347159.1.77349 WP_000347159.1.77529 WP_000347159.1.77692 WP_000347159.1.7782 WP_000347159.1.77851 WP_000347159.1.77898 WP_000347159.1.77918 WP_000347159.1.77960 WP_000347159.1.78033 WP_000347159.1.78110 WP_000347159.1.78120 WP_000347159.1.78407 WP_000347159.1.7861 WP_000347159.1.78618 WP_000347159.1.78735 WP_000347159.1.78835 WP_000347159.1.78871 WP_000347159.1.78874 WP_000347159.1.79151 WP_000347159.1.79167 WP_000347159.1.79335 WP_000347159.1.79472 WP_000347159.1.79490 WP_000347159.1.79495 WP_000347159.1.79570 WP_000347159.1.79659 WP_000347159.1.79708 WP_000347159.1.79845 WP_000347159.1.80077 WP_000347159.1.80137 WP_000347159.1.80182 WP_000347159.1.80780 WP_000347159.1.80831 WP_000347159.1.80850 WP_000347159.1.80939 WP_000347159.1.81037 WP_000347159.1.81193 WP_000347159.1.81410 WP_000347159.1.81785 WP_000347159.1.81902 WP_000347159.1.81974 WP_000347159.1.82337 WP_000347159.1.82479 WP_000347159.1.82515 WP_000347159.1.82676 WP_000347159.1.82761 WP_000347159.1.8282 WP_000347159.1.82944 WP_000347159.1.82956 WP_000347159.1.83092 WP_000347159.1.83163 WP_000347159.1.83305 WP_000347159.1.83365 WP_000347159.1.83413 WP_000347159.1.83523 WP_000347159.1.8354 WP_000347159.1.83651 WP_000347159.1.83721 WP_000347159.1.84103 WP_000347159.1.84392 WP_000347159.1.84554 WP_000347159.1.84659 WP_000347159.1.84693 WP_000347159.1.85040 WP_000347159.1.85134 WP_000347159.1.85178 WP_000347159.1.85180 WP_000347159.1.85190 WP_000347159.1.8533 WP_000347159.1.8545 WP_000347159.1.85481 WP_000347159.1.85483 WP_000347159.1.85541 WP_000347159.1.85615 WP_000347159.1.85617 WP_000347159.1.85672 WP_000347159.1.85777 WP_000347159.1.85855 WP_000347159.1.85900 WP_000347159.1.85976 WP_000347159.1.86580 WP_000347159.1.8672 WP_000347159.1.8678 WP_000347159.1.86810 WP_000347159.1.8684 WP_000347159.1.86895 WP_000347159.1.86906 WP_000347159.1.87095 WP_000347159.1.87323 WP_000347159.1.87460 WP_000347159.1.87552 WP_000347159.1.87779 WP_000347159.1.87945 WP_000347159.1.88019 WP_000347159.1.88073 WP_000347159.1.8837 WP_000347159.1.88393 WP_000347159.1.88792 WP_000347159.1.88981 WP_000347159.1.89008 WP_000347159.1.89304 WP_000347159.1.89512 WP_000347159.1.89527 WP_000347159.1.89570 WP_000347159.1.89604 WP_000347159.1.89622 WP_000347159.1.89659 WP_000347159.1.89902 WP_000347159.1.90097 WP_000347159.1.90252 WP_000347159.1.90417 WP_000347159.1.90453 WP_000347159.1.90458 WP_000347159.1.90557 WP_000347159.1.90585 WP_000347159.1.91003 WP_000347159.1.91069 WP_000347159.1.9131 WP_000347159.1.91524 WP_000347159.1.91564 WP_000347159.1.91628 WP_000347159.1.91655 WP_000347159.1.92060 WP_000347159.1.92108 WP_000347159.1.92171 WP_000347159.1.92183 WP_000347159.1.92208 WP_000347159.1.92268 WP_000347159.1.92318 WP_000347159.1.92443 WP_000347159.1.92482 WP_000347159.1.92531 WP_000347159.1.92669 WP_000347159.1.92671 WP_000347159.1.92738 WP_000347159.1.93086 WP_000347159.1.93101 WP_000347159.1.93136 WP_000347159.1.93155 WP_000347159.1.93275 WP_000347159.1.93365 WP_000347159.1.93376 WP_000347159.1.93650 WP_000347159.1.93656 WP_000347159.1.93705 WP_000347159.1.93994 WP_000347159.1.94072 WP_000347159.1.94162 WP_000347159.1.9432 WP_000347159.1.94458 WP_000347159.1.94565 WP_000347159.1.94584 WP_000347159.1.94796 WP_000347159.1.94959 WP_000347159.1.95051 WP_000347159.1.95121 WP_000347159.1.95630 WP_000347159.1.96139 WP_000347159.1.96343 WP_000347159.1.96500 WP_000347159.1.96563 WP_000347159.1.96732 WP_000347159.1.97015 WP_000347159.1.97145 WP_000347159.1.97190 WP_000347159.1.97369 WP_000347159.1.97594 WP_000347159.1.97597 WP_000347159.1.97727 WP_000347159.1.97732 WP_000347159.1.97736 WP_000347159.1.98006 WP_000347159.1.98019 WP_000347159.1.98110 WP_000347159.1.98146 WP_000347159.1.98219 WP_000347159.1.98495 WP_000347159.1.98577 WP_000347159.1.98676 WP_000347159.1.98677 WP_000347159.1.98760 WP_000347159.1.9898 WP_000347159.1.99072 WP_000347159.1.99098 WP_000347159.1.99267 WP_000347159.1.99712 WP_000347159.1.99813 gi|378984117|ref|YP_005247272.1| gi|378444971|ref|YP_005232603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]