SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482903889|ref|YP_007902449.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482903889|ref|YP_007902449.1|
Domain Number 1 Region: 5-310
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.05e-74
Family AAT-like 0.00000000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|482903889|ref|YP_007902449.1|
Sequence length 314
Comment histidinol-phosphate aminotransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MEFQLTQQTLNRYPECQPKAVIENYAQYAGVKPEQVLVSRGADEGIELVIRAFCEPGKDA
ILYCPPTYGMYSVSAETIGVERRTVPALENWQLDLQGISDNLDGTKVVFVCSPNNPTGQL
INPQDLRTLLELTRGKAIVVADEAYIEFCPQATLTGWLVEYPHLVILRTLSKAFALAGLR
CGFTLANEEVINLLLKVIAPYPLSTPVADIAAQALCPQGINAMRDRVAQTVQERQYLVNA
LQQTACVEHVFDSETNYILARFTASSSVFKSLWDQGIILRDQNKQPSLSGCLRITVGTRQ
ENQRVIDALRAEPV
Download sequence
Identical sequences gi|482903889|ref|YP_007902449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]