SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482903906|ref|YP_007902466.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482903906|ref|YP_007902466.1|
Domain Number 1 Region: 37-433
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.52e-105
Family GABA-aminotransferase-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|482903906|ref|YP_007902466.1|
Sequence length 437
Comment lipopolysaccharide biosynthesis protein RfbH [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MTANNLREQISQLVAQYANEALSPKPFVAGTSVVPPSGKVIGAKELQLMVEASLDGWLTT
GRFNDAFEKKLGEFIGVPHVLTTTSGSSANLLALTALTSPKLGERALKPGDEVITVAAGF
PTTVNPAIQNGLIPVFVDVDIPTYNIDASLIEAAVTEKSKAIMIAHTLGNAFNLSEVRRI
ADKYNLWLIEDCCDALGTTYEGQMVGTFGDIGTVSFYPAHHITMGEGGAVFTKSGELKKI
IESFRDWGRDCYCAPGCDNTCGKRFGQQLGSLPQGYDHKYTYSHLGYNLKITDMQAACGL
AQLERVEEFVEQRKANFSYLKQGLQSCTEFLELPEATEKSDPSWFGFPITLKETSGVNRV
ELVKFLDEAKIGTRLLFAGNLIRQPYFANVKYRVVGELTNTDRIMNQTFWIGIYPGLTTE
HLDYVVSKFEEFFGLNF
Download sequence
Identical sequences A0A0D6FGI8 A0A0F6B3D9 A0A0F7JAY0 A0A0G2NPK4 A0A0H3ND26 A0A0N1TUP3 A0A0U1FQV6 A0A1R3BTG2 A0A1Z3QEH6 A0A265B619 A0A271CCE2 A0A2C9NZH4 A0A2H9YI52 A0A2K2ZWG8 B5EXR7 B5RBT1 E8XC44 H8YV68 M7RGI3 P26398 S4J248 S5R5C1
gi|205353233|ref|YP_002227034.1| 272994.SPAB_00940 439843.SeSA_A2323 439851.SeD_A2430 454166.SeAg_B2215 454169.SeHA_C2316 550537.SEN2086 550538.SG2121 99287.STM2090 gi|194451848|ref|YP_002046140.1| gi|563653563|ref|YP_008861637.1| gi|537436123|ref|YP_008480500.1| gi|207857526|ref|YP_002244177.1| gi|378700003|ref|YP_005181960.1| ABAM02000001|CDS_2631338-2630025 ABAN01000008|CDS_36993-35680 ABAO01000005|CDS_76025-74712 ABEH02000005|CDS_93119-91806 ABEJ01000005|CDS_48317-47004 ABEL01000004|CDS_77937-76624 AE006468|CDS_2172239-2170926 AM933172|CDS_2176874-2175561 AM933173|CDS_2167882-2166569 CP000886|CDS_873560-874873 CP001120|CDS_2219858-2218545 CP001127|CDS_2193781-2192468 CP001138|CDS_2130104-2128791 CP001144|CDS_2303891-2302578 CP001363|CDS_2223791-2222478 FN424405|CDS_2195894-2194581 gi|378954553|ref|YP_005212040.1| gi|16765420|ref|NP_461035.1| gi|378984653|ref|YP_005247808.1| gi|378450766|ref|YP_005238125.1| NP_461035.1.58477 WP_000126349.1.100010 WP_000126349.1.100017 WP_000126349.1.100077 WP_000126349.1.10013 WP_000126349.1.100149 WP_000126349.1.100191 WP_000126349.1.100234 WP_000126349.1.100258 WP_000126349.1.100376 WP_000126349.1.100392 WP_000126349.1.100412 WP_000126349.1.100424 WP_000126349.1.100432 WP_000126349.1.100436 WP_000126349.1.100457 WP_000126349.1.100484 WP_000126349.1.100488 WP_000126349.1.100519 WP_000126349.1.100541 WP_000126349.1.100557 WP_000126349.1.100597 WP_000126349.1.100605 WP_000126349.1.100650 WP_000126349.1.100707 WP_000126349.1.100721 WP_000126349.1.10076 WP_000126349.1.100776 WP_000126349.1.100781 WP_000126349.1.100790 WP_000126349.1.100793 WP_000126349.1.10081 WP_000126349.1.100857 WP_000126349.1.100869 WP_000126349.1.100871 WP_000126349.1.100882 WP_000126349.1.100895 WP_000126349.1.100932 WP_000126349.1.100948 WP_000126349.1.101007 WP_000126349.1.101020 WP_000126349.1.101042 WP_000126349.1.101074 WP_000126349.1.101078 WP_000126349.1.101112 WP_000126349.1.101147 WP_000126349.1.101180 WP_000126349.1.101259 WP_000126349.1.101284 WP_000126349.1.101291 WP_000126349.1.1013 WP_000126349.1.101320 WP_000126349.1.101353 WP_000126349.1.101386 WP_000126349.1.101404 WP_000126349.1.101420 WP_000126349.1.101541 WP_000126349.1.101589 WP_000126349.1.101634 WP_000126349.1.10164 WP_000126349.1.101674 WP_000126349.1.101707 WP_000126349.1.101734 WP_000126349.1.101832 WP_000126349.1.101841 WP_000126349.1.101878 WP_000126349.1.10191 WP_000126349.1.101917 WP_000126349.1.101927 WP_000126349.1.101953 WP_000126349.1.102111 WP_000126349.1.10220 WP_000126349.1.10231 WP_000126349.1.10266 WP_000126349.1.10300 WP_000126349.1.10310 WP_000126349.1.10429 WP_000126349.1.10439 WP_000126349.1.10498 WP_000126349.1.10507 WP_000126349.1.10521 WP_000126349.1.10631 WP_000126349.1.10678 WP_000126349.1.10753 WP_000126349.1.10755 WP_000126349.1.10797 WP_000126349.1.10868 WP_000126349.1.10898 WP_000126349.1.10992 WP_000126349.1.11000 WP_000126349.1.11024 WP_000126349.1.11031 WP_000126349.1.11098 WP_000126349.1.1110 WP_000126349.1.11119 WP_000126349.1.11156 WP_000126349.1.11168 WP_000126349.1.11190 WP_000126349.1.11216 WP_000126349.1.11295 WP_000126349.1.11369 WP_000126349.1.11444 WP_000126349.1.11455 WP_000126349.1.11458 WP_000126349.1.1150 WP_000126349.1.11518 WP_000126349.1.11526 WP_000126349.1.11528 WP_000126349.1.11532 WP_000126349.1.11543 WP_000126349.1.1156 WP_000126349.1.11588 WP_000126349.1.11621 WP_000126349.1.11687 WP_000126349.1.1169 WP_000126349.1.11735 WP_000126349.1.1174 WP_000126349.1.11763 WP_000126349.1.11772 WP_000126349.1.11824 WP_000126349.1.11834 WP_000126349.1.11841 WP_000126349.1.11865 WP_000126349.1.11897 WP_000126349.1.11900 WP_000126349.1.11978 WP_000126349.1.12017 WP_000126349.1.12025 WP_000126349.1.12027 WP_000126349.1.12059 WP_000126349.1.12063 WP_000126349.1.12106 WP_000126349.1.12114 WP_000126349.1.12168 WP_000126349.1.12340 WP_000126349.1.12351 WP_000126349.1.12370 WP_000126349.1.12374 WP_000126349.1.1239 WP_000126349.1.12456 WP_000126349.1.12485 WP_000126349.1.12546 WP_000126349.1.12568 WP_000126349.1.12569 WP_000126349.1.12585 WP_000126349.1.1264 WP_000126349.1.12650 WP_000126349.1.12696 WP_000126349.1.12728 WP_000126349.1.12879 WP_000126349.1.12936 WP_000126349.1.12995 WP_000126349.1.1300 WP_000126349.1.13027 WP_000126349.1.13076 WP_000126349.1.13101 WP_000126349.1.13102 WP_000126349.1.13106 WP_000126349.1.13130 WP_000126349.1.13207 WP_000126349.1.13247 WP_000126349.1.13274 WP_000126349.1.13311 WP_000126349.1.13334 WP_000126349.1.13367 WP_000126349.1.13391 WP_000126349.1.13414 WP_000126349.1.1346 WP_000126349.1.13488 WP_000126349.1.13509 WP_000126349.1.13528 WP_000126349.1.13573 WP_000126349.1.13625 WP_000126349.1.13661 WP_000126349.1.13669 WP_000126349.1.13677 WP_000126349.1.13741 WP_000126349.1.13827 WP_000126349.1.13829 WP_000126349.1.1387 WP_000126349.1.13908 WP_000126349.1.13932 WP_000126349.1.13968 WP_000126349.1.14001 WP_000126349.1.14111 WP_000126349.1.1412 WP_000126349.1.14151 WP_000126349.1.14239 WP_000126349.1.14296 WP_000126349.1.14320 WP_000126349.1.14379 WP_000126349.1.14406 WP_000126349.1.14410 WP_000126349.1.14436 WP_000126349.1.14458 WP_000126349.1.14466 WP_000126349.1.14524 WP_000126349.1.14528 WP_000126349.1.14554 WP_000126349.1.146 WP_000126349.1.14618 WP_000126349.1.14688 WP_000126349.1.14708 WP_000126349.1.14725 WP_000126349.1.14737 WP_000126349.1.14793 WP_000126349.1.14819 WP_000126349.1.14852 WP_000126349.1.1489 WP_000126349.1.14913 WP_000126349.1.14932 WP_000126349.1.15054 WP_000126349.1.15055 WP_000126349.1.15067 WP_000126349.1.15079 WP_000126349.1.15124 WP_000126349.1.15214 WP_000126349.1.15223 WP_000126349.1.15226 WP_000126349.1.15276 WP_000126349.1.15316 WP_000126349.1.15318 WP_000126349.1.15369 WP_000126349.1.1540 WP_000126349.1.15479 WP_000126349.1.15508 WP_000126349.1.15585 WP_000126349.1.1568 WP_000126349.1.15775 WP_000126349.1.15777 WP_000126349.1.15784 WP_000126349.1.15830 WP_000126349.1.15835 WP_000126349.1.15862 WP_000126349.1.15909 WP_000126349.1.15910 WP_000126349.1.15978 WP_000126349.1.15986 WP_000126349.1.16032 WP_000126349.1.16047 WP_000126349.1.16052 WP_000126349.1.16062 WP_000126349.1.16063 WP_000126349.1.16103 WP_000126349.1.16125 WP_000126349.1.16158 WP_000126349.1.16233 WP_000126349.1.16244 WP_000126349.1.16284 WP_000126349.1.16328 WP_000126349.1.1635 WP_000126349.1.16361 WP_000126349.1.16363 WP_000126349.1.16365 WP_000126349.1.16366 WP_000126349.1.16394 WP_000126349.1.16453 WP_000126349.1.16468 WP_000126349.1.16474 WP_000126349.1.16525 WP_000126349.1.16614 WP_000126349.1.16650 WP_000126349.1.16656 WP_000126349.1.16686 WP_000126349.1.16691 WP_000126349.1.167 WP_000126349.1.16729 WP_000126349.1.16732 WP_000126349.1.16735 WP_000126349.1.16786 WP_000126349.1.16804 WP_000126349.1.16817 WP_000126349.1.16826 WP_000126349.1.16858 WP_000126349.1.16873 WP_000126349.1.16896 WP_000126349.1.16903 WP_000126349.1.16916 WP_000126349.1.16944 WP_000126349.1.16949 WP_000126349.1.16965 WP_000126349.1.16972 WP_000126349.1.1700 WP_000126349.1.17060 WP_000126349.1.17093 WP_000126349.1.17096 WP_000126349.1.17105 WP_000126349.1.17270 WP_000126349.1.17307 WP_000126349.1.1733 WP_000126349.1.174 WP_000126349.1.17480 WP_000126349.1.17482 WP_000126349.1.17525 WP_000126349.1.17546 WP_000126349.1.17583 WP_000126349.1.17702 WP_000126349.1.17705 WP_000126349.1.17732 WP_000126349.1.17743 WP_000126349.1.17747 WP_000126349.1.17865 WP_000126349.1.17886 WP_000126349.1.17891 WP_000126349.1.17914 WP_000126349.1.17919 WP_000126349.1.17936 WP_000126349.1.17949 WP_000126349.1.18019 WP_000126349.1.18056 WP_000126349.1.18061 WP_000126349.1.18092 WP_000126349.1.18103 WP_000126349.1.18109 WP_000126349.1.18111 WP_000126349.1.18122 WP_000126349.1.18149 WP_000126349.1.18163 WP_000126349.1.1818 WP_000126349.1.18249 WP_000126349.1.18254 WP_000126349.1.18265 WP_000126349.1.18267 WP_000126349.1.18277 WP_000126349.1.18282 WP_000126349.1.18384 WP_000126349.1.18445 WP_000126349.1.18468 WP_000126349.1.18607 WP_000126349.1.18641 WP_000126349.1.18686 WP_000126349.1.18705 WP_000126349.1.18715 WP_000126349.1.18737 WP_000126349.1.18776 WP_000126349.1.18822 WP_000126349.1.18847 WP_000126349.1.18881 WP_000126349.1.18886 WP_000126349.1.18919 WP_000126349.1.18940 WP_000126349.1.18949 WP_000126349.1.1895 WP_000126349.1.19053 WP_000126349.1.19093 WP_000126349.1.19174 WP_000126349.1.19273 WP_000126349.1.19320 WP_000126349.1.19373 WP_000126349.1.19405 WP_000126349.1.19433 WP_000126349.1.19458 WP_000126349.1.19460 WP_000126349.1.19461 WP_000126349.1.19469 WP_000126349.1.1955 WP_000126349.1.19588 WP_000126349.1.19614 WP_000126349.1.19616 WP_000126349.1.19642 WP_000126349.1.19656 WP_000126349.1.19702 WP_000126349.1.19706 WP_000126349.1.19724 WP_000126349.1.19749 WP_000126349.1.19784 WP_000126349.1.19793 WP_000126349.1.19802 WP_000126349.1.19809 WP_000126349.1.19834 WP_000126349.1.19867 WP_000126349.1.19938 WP_000126349.1.19975 WP_000126349.1.1998 WP_000126349.1.20 WP_000126349.1.20081 WP_000126349.1.20086 WP_000126349.1.2010 WP_000126349.1.20212 WP_000126349.1.20261 WP_000126349.1.20266 WP_000126349.1.20271 WP_000126349.1.20330 WP_000126349.1.20349 WP_000126349.1.2036 WP_000126349.1.2041 WP_000126349.1.20418 WP_000126349.1.20437 WP_000126349.1.20443 WP_000126349.1.20446 WP_000126349.1.2047 WP_000126349.1.20525 WP_000126349.1.2054 WP_000126349.1.20553 WP_000126349.1.20614 WP_000126349.1.20626 WP_000126349.1.20646 WP_000126349.1.20700 WP_000126349.1.20767 WP_000126349.1.20795 WP_000126349.1.20810 WP_000126349.1.20886 WP_000126349.1.20908 WP_000126349.1.21049 WP_000126349.1.2107 WP_000126349.1.21079 WP_000126349.1.21103 WP_000126349.1.21136 WP_000126349.1.2116 WP_000126349.1.21194 WP_000126349.1.21202 WP_000126349.1.21241 WP_000126349.1.21245 WP_000126349.1.21246 WP_000126349.1.21269 WP_000126349.1.2130 WP_000126349.1.21332 WP_000126349.1.21351 WP_000126349.1.21400 WP_000126349.1.21473 WP_000126349.1.21497 WP_000126349.1.21499 WP_000126349.1.21548 WP_000126349.1.21603 WP_000126349.1.21616 WP_000126349.1.21681 WP_000126349.1.21715 WP_000126349.1.21751 WP_000126349.1.21757 WP_000126349.1.21909 WP_000126349.1.21950 WP_000126349.1.21991 WP_000126349.1.22024 WP_000126349.1.2205 WP_000126349.1.22051 WP_000126349.1.22062 WP_000126349.1.22067 WP_000126349.1.22096 WP_000126349.1.22136 WP_000126349.1.22158 WP_000126349.1.22162 WP_000126349.1.2221 WP_000126349.1.22235 WP_000126349.1.22296 WP_000126349.1.22346 WP_000126349.1.2235 WP_000126349.1.22379 WP_000126349.1.22388 WP_000126349.1.22427 WP_000126349.1.22449 WP_000126349.1.22454 WP_000126349.1.2246 WP_000126349.1.22460 WP_000126349.1.22485 WP_000126349.1.22537 WP_000126349.1.22590 WP_000126349.1.22595 WP_000126349.1.22605 WP_000126349.1.22620 WP_000126349.1.22623 WP_000126349.1.22692 WP_000126349.1.22758 WP_000126349.1.22760 WP_000126349.1.22857 WP_000126349.1.22870 WP_000126349.1.22880 WP_000126349.1.22902 WP_000126349.1.22947 WP_000126349.1.22966 WP_000126349.1.22979 WP_000126349.1.23080 WP_000126349.1.23102 WP_000126349.1.23114 WP_000126349.1.2314 WP_000126349.1.23172 WP_000126349.1.23192 WP_000126349.1.23201 WP_000126349.1.2324 WP_000126349.1.23258 WP_000126349.1.23259 WP_000126349.1.23329 WP_000126349.1.23409 WP_000126349.1.23442 WP_000126349.1.23460 WP_000126349.1.23472 WP_000126349.1.23482 WP_000126349.1.23509 WP_000126349.1.2358 WP_000126349.1.23631 WP_000126349.1.23634 WP_000126349.1.2364 WP_000126349.1.23675 WP_000126349.1.23746 WP_000126349.1.23755 WP_000126349.1.23819 WP_000126349.1.23932 WP_000126349.1.24017 WP_000126349.1.24082 WP_000126349.1.24145 WP_000126349.1.24163 WP_000126349.1.24206 WP_000126349.1.24214 WP_000126349.1.24250 WP_000126349.1.24297 WP_000126349.1.24308 WP_000126349.1.24361 WP_000126349.1.24408 WP_000126349.1.24409 WP_000126349.1.24412 WP_000126349.1.24433 WP_000126349.1.24476 WP_000126349.1.24494 WP_000126349.1.24521 WP_000126349.1.24578 WP_000126349.1.24673 WP_000126349.1.24696 WP_000126349.1.24737 WP_000126349.1.24779 WP_000126349.1.24803 WP_000126349.1.24837 WP_000126349.1.24901 WP_000126349.1.24944 WP_000126349.1.25008 WP_000126349.1.25015 WP_000126349.1.25119 WP_000126349.1.25159 WP_000126349.1.25175 WP_000126349.1.25205 WP_000126349.1.25206 WP_000126349.1.25354 WP_000126349.1.25397 WP_000126349.1.25405 WP_000126349.1.25421 WP_000126349.1.25426 WP_000126349.1.25454 WP_000126349.1.25493 WP_000126349.1.25514 WP_000126349.1.25618 WP_000126349.1.25668 WP_000126349.1.2568 WP_000126349.1.25690 WP_000126349.1.2570 WP_000126349.1.25709 WP_000126349.1.25722 WP_000126349.1.25740 WP_000126349.1.25780 WP_000126349.1.25793 WP_000126349.1.25814 WP_000126349.1.25932 WP_000126349.1.25951 WP_000126349.1.25988 WP_000126349.1.26083 WP_000126349.1.26194 WP_000126349.1.26282 WP_000126349.1.26311 WP_000126349.1.26319 WP_000126349.1.26429 WP_000126349.1.26440 WP_000126349.1.26441 WP_000126349.1.26493 WP_000126349.1.26532 WP_000126349.1.26551 WP_000126349.1.26563 WP_000126349.1.26567 WP_000126349.1.26587 WP_000126349.1.26687 WP_000126349.1.2672 WP_000126349.1.26741 WP_000126349.1.26758 WP_000126349.1.26794 WP_000126349.1.26833 WP_000126349.1.26883 WP_000126349.1.26919 WP_000126349.1.26936 WP_000126349.1.27010 WP_000126349.1.27084 WP_000126349.1.27122 WP_000126349.1.27173 WP_000126349.1.272 WP_000126349.1.27206 WP_000126349.1.27223 WP_000126349.1.2723 WP_000126349.1.27272 WP_000126349.1.27314 WP_000126349.1.27383 WP_000126349.1.27423 WP_000126349.1.27544 WP_000126349.1.27547 WP_000126349.1.27561 WP_000126349.1.2763 WP_000126349.1.27632 WP_000126349.1.27638 WP_000126349.1.27655 WP_000126349.1.27658 WP_000126349.1.27665 WP_000126349.1.27707 WP_000126349.1.27713 WP_000126349.1.27761 WP_000126349.1.2777 WP_000126349.1.27800 WP_000126349.1.27833 WP_000126349.1.27857 WP_000126349.1.27883 WP_000126349.1.27977 WP_000126349.1.27995 WP_000126349.1.28002 WP_000126349.1.28032 WP_000126349.1.28037 WP_000126349.1.28056 WP_000126349.1.2806 WP_000126349.1.28094 WP_000126349.1.28126 WP_000126349.1.28139 WP_000126349.1.28170 WP_000126349.1.28174 WP_000126349.1.28200 WP_000126349.1.28232 WP_000126349.1.28233 WP_000126349.1.28302 WP_000126349.1.28303 WP_000126349.1.2835 WP_000126349.1.28370 WP_000126349.1.28462 WP_000126349.1.2853 WP_000126349.1.28538 WP_000126349.1.28570 WP_000126349.1.28575 WP_000126349.1.28620 WP_000126349.1.28625 WP_000126349.1.28655 WP_000126349.1.28694 WP_000126349.1.287 WP_000126349.1.28733 WP_000126349.1.28773 WP_000126349.1.2879 WP_000126349.1.28811 WP_000126349.1.2890 WP_000126349.1.28938 WP_000126349.1.28946 WP_000126349.1.28963 WP_000126349.1.28977 WP_000126349.1.29006 WP_000126349.1.29010 WP_000126349.1.29099 WP_000126349.1.2910 WP_000126349.1.29113 WP_000126349.1.29168 WP_000126349.1.29218 WP_000126349.1.2924 WP_000126349.1.29255 WP_000126349.1.29265 WP_000126349.1.29274 WP_000126349.1.2932 WP_000126349.1.29379 WP_000126349.1.29422 WP_000126349.1.29436 WP_000126349.1.29509 WP_000126349.1.29576 WP_000126349.1.29588 WP_000126349.1.29601 WP_000126349.1.29606 WP_000126349.1.29615 WP_000126349.1.29619 WP_000126349.1.29704 WP_000126349.1.29711 WP_000126349.1.29732 WP_000126349.1.29827 WP_000126349.1.2984 WP_000126349.1.29845 WP_000126349.1.29969 WP_000126349.1.29990 WP_000126349.1.30006 WP_000126349.1.30022 WP_000126349.1.30027 WP_000126349.1.3005 WP_000126349.1.30059 WP_000126349.1.30165 WP_000126349.1.3017 WP_000126349.1.30180 WP_000126349.1.30202 WP_000126349.1.30225 WP_000126349.1.30238 WP_000126349.1.30246 WP_000126349.1.30278 WP_000126349.1.30331 WP_000126349.1.30469 WP_000126349.1.30492 WP_000126349.1.30505 WP_000126349.1.30507 WP_000126349.1.30535 WP_000126349.1.30547 WP_000126349.1.30548 WP_000126349.1.30589 WP_000126349.1.30602 WP_000126349.1.30627 WP_000126349.1.30635 WP_000126349.1.3066 WP_000126349.1.3067 WP_000126349.1.30696 WP_000126349.1.30752 WP_000126349.1.30794 WP_000126349.1.30803 WP_000126349.1.30833 WP_000126349.1.30835 WP_000126349.1.30951 WP_000126349.1.30968 WP_000126349.1.30972 WP_000126349.1.31 WP_000126349.1.31092 WP_000126349.1.31122 WP_000126349.1.3113 WP_000126349.1.31155 WP_000126349.1.31167 WP_000126349.1.31185 WP_000126349.1.3119 WP_000126349.1.31190 WP_000126349.1.31195 WP_000126349.1.31196 WP_000126349.1.31219 WP_000126349.1.3124 WP_000126349.1.31272 WP_000126349.1.31281 WP_000126349.1.31335 WP_000126349.1.31362 WP_000126349.1.31435 WP_000126349.1.31451 WP_000126349.1.31504 WP_000126349.1.31515 WP_000126349.1.31578 WP_000126349.1.31585 WP_000126349.1.31658 WP_000126349.1.3167 WP_000126349.1.31720 WP_000126349.1.3185 WP_000126349.1.31895 WP_000126349.1.31901 WP_000126349.1.31940 WP_000126349.1.31952 WP_000126349.1.31967 WP_000126349.1.31972 WP_000126349.1.31983 WP_000126349.1.32109 WP_000126349.1.32116 WP_000126349.1.32192 WP_000126349.1.32206 WP_000126349.1.32252 WP_000126349.1.32255 WP_000126349.1.32260 WP_000126349.1.32274 WP_000126349.1.32277 WP_000126349.1.32309 WP_000126349.1.32438 WP_000126349.1.32515 WP_000126349.1.32519 WP_000126349.1.32527 WP_000126349.1.32660 WP_000126349.1.32668 WP_000126349.1.32702 WP_000126349.1.32714 WP_000126349.1.32740 WP_000126349.1.3278 WP_000126349.1.32786 WP_000126349.1.32804 WP_000126349.1.32832 WP_000126349.1.32860 WP_000126349.1.32881 WP_000126349.1.32899 WP_000126349.1.32907 WP_000126349.1.32977 WP_000126349.1.33030 WP_000126349.1.3310 WP_000126349.1.33114 WP_000126349.1.33127 WP_000126349.1.33143 WP_000126349.1.33248 WP_000126349.1.33253 WP_000126349.1.33261 WP_000126349.1.33270 WP_000126349.1.333 WP_000126349.1.33409 WP_000126349.1.33492 WP_000126349.1.335 WP_000126349.1.33553 WP_000126349.1.3356 WP_000126349.1.33580 WP_000126349.1.33586 WP_000126349.1.33592 WP_000126349.1.3364 WP_000126349.1.33817 WP_000126349.1.33825 WP_000126349.1.33865 WP_000126349.1.33894 WP_000126349.1.3394 WP_000126349.1.3396 WP_000126349.1.34 WP_000126349.1.34022 WP_000126349.1.34043 WP_000126349.1.34075 WP_000126349.1.34084 WP_000126349.1.34091 WP_000126349.1.34107 WP_000126349.1.34184 WP_000126349.1.34185 WP_000126349.1.34257 WP_000126349.1.34279 WP_000126349.1.34292 WP_000126349.1.34319 WP_000126349.1.3438 WP_000126349.1.34417 WP_000126349.1.34431 WP_000126349.1.3445 WP_000126349.1.34453 WP_000126349.1.34454 WP_000126349.1.34610 WP_000126349.1.34614 WP_000126349.1.34684 WP_000126349.1.34711 WP_000126349.1.3476 WP_000126349.1.34817 WP_000126349.1.34820 WP_000126349.1.34856 WP_000126349.1.34881 WP_000126349.1.34975 WP_000126349.1.34977 WP_000126349.1.35045 WP_000126349.1.35129 WP_000126349.1.35184 WP_000126349.1.35193 WP_000126349.1.35219 WP_000126349.1.35298 WP_000126349.1.35321 WP_000126349.1.35332 WP_000126349.1.35404 WP_000126349.1.35408 WP_000126349.1.3541 WP_000126349.1.35425 WP_000126349.1.35429 WP_000126349.1.35446 WP_000126349.1.35463 WP_000126349.1.35503 WP_000126349.1.35509 WP_000126349.1.35563 WP_000126349.1.35570 WP_000126349.1.35590 WP_000126349.1.35594 WP_000126349.1.35619 WP_000126349.1.35624 WP_000126349.1.3566 WP_000126349.1.3572 WP_000126349.1.35835 WP_000126349.1.35887 WP_000126349.1.35936 WP_000126349.1.35940 WP_000126349.1.35961 WP_000126349.1.36003 WP_000126349.1.3601 WP_000126349.1.36017 WP_000126349.1.36037 WP_000126349.1.36063 WP_000126349.1.36229 WP_000126349.1.36409 WP_000126349.1.36445 WP_000126349.1.36547 WP_000126349.1.36584 WP_000126349.1.36609 WP_000126349.1.36652 WP_000126349.1.36685 WP_000126349.1.36690 WP_000126349.1.3670 WP_000126349.1.36705 WP_000126349.1.36721 WP_000126349.1.36751 WP_000126349.1.36764 WP_000126349.1.36885 WP_000126349.1.36889 WP_000126349.1.36918 WP_000126349.1.36931 WP_000126349.1.37021 WP_000126349.1.37029 WP_000126349.1.37063 WP_000126349.1.37073 WP_000126349.1.37100 WP_000126349.1.37111 WP_000126349.1.37112 WP_000126349.1.37114 WP_000126349.1.37147 WP_000126349.1.37158 WP_000126349.1.37191 WP_000126349.1.37256 WP_000126349.1.3726 WP_000126349.1.3728 WP_000126349.1.37293 WP_000126349.1.37297 WP_000126349.1.37370 WP_000126349.1.37376 WP_000126349.1.37405 WP_000126349.1.3744 WP_000126349.1.3748 WP_000126349.1.37498 WP_000126349.1.37504 WP_000126349.1.3756 WP_000126349.1.37618 WP_000126349.1.37666 WP_000126349.1.37687 WP_000126349.1.3771 WP_000126349.1.3778 WP_000126349.1.37808 WP_000126349.1.37864 WP_000126349.1.3790 WP_000126349.1.37968 WP_000126349.1.37978 WP_000126349.1.38037 WP_000126349.1.38047 WP_000126349.1.38055 WP_000126349.1.38113 WP_000126349.1.38125 WP_000126349.1.38145 WP_000126349.1.3828 WP_000126349.1.383 WP_000126349.1.38344 WP_000126349.1.38393 WP_000126349.1.3848 WP_000126349.1.38569 WP_000126349.1.38613 WP_000126349.1.38673 WP_000126349.1.3869 WP_000126349.1.38693 WP_000126349.1.38773 WP_000126349.1.38781 WP_000126349.1.38882 WP_000126349.1.38913 WP_000126349.1.38995 WP_000126349.1.39003 WP_000126349.1.39048 WP_000126349.1.39055 WP_000126349.1.39065 WP_000126349.1.39136 WP_000126349.1.39197 WP_000126349.1.39229 WP_000126349.1.39265 WP_000126349.1.39312 WP_000126349.1.39385 WP_000126349.1.39395 WP_000126349.1.39405 WP_000126349.1.39414 WP_000126349.1.39420 WP_000126349.1.39449 WP_000126349.1.39512 WP_000126349.1.39556 WP_000126349.1.39584 WP_000126349.1.39614 WP_000126349.1.39629 WP_000126349.1.39723 WP_000126349.1.39724 WP_000126349.1.39763 WP_000126349.1.39862 WP_000126349.1.39921 WP_000126349.1.39923 WP_000126349.1.40017 WP_000126349.1.40072 WP_000126349.1.40073 WP_000126349.1.40081 WP_000126349.1.4011 WP_000126349.1.40158 WP_000126349.1.40208 WP_000126349.1.40240 WP_000126349.1.40257 WP_000126349.1.40259 WP_000126349.1.40284 WP_000126349.1.40292 WP_000126349.1.40305 WP_000126349.1.40307 WP_000126349.1.40311 WP_000126349.1.40341 WP_000126349.1.40380 WP_000126349.1.40395 WP_000126349.1.40465 WP_000126349.1.40493 WP_000126349.1.40508 WP_000126349.1.40533 WP_000126349.1.40577 WP_000126349.1.40622 WP_000126349.1.40693 WP_000126349.1.40695 WP_000126349.1.40710 WP_000126349.1.40745 WP_000126349.1.4075 WP_000126349.1.40788 WP_000126349.1.40849 WP_000126349.1.4087 WP_000126349.1.40877 WP_000126349.1.40910 WP_000126349.1.40930 WP_000126349.1.40973 WP_000126349.1.41017 WP_000126349.1.41018 WP_000126349.1.41086 WP_000126349.1.4109 WP_000126349.1.41091 WP_000126349.1.41116 WP_000126349.1.41128 WP_000126349.1.41192 WP_000126349.1.41226 WP_000126349.1.41265 WP_000126349.1.41277 WP_000126349.1.41279 WP_000126349.1.41308 WP_000126349.1.4141 WP_000126349.1.41427 WP_000126349.1.41434 WP_000126349.1.41516 WP_000126349.1.41528 WP_000126349.1.41554 WP_000126349.1.41572 WP_000126349.1.41591 WP_000126349.1.41610 WP_000126349.1.41628 WP_000126349.1.41662 WP_000126349.1.41688 WP_000126349.1.41690 WP_000126349.1.41708 WP_000126349.1.41761 WP_000126349.1.41799 WP_000126349.1.41802 WP_000126349.1.4184 WP_000126349.1.41859 WP_000126349.1.41882 WP_000126349.1.41911 WP_000126349.1.41949 WP_000126349.1.41978 WP_000126349.1.41979 WP_000126349.1.41985 WP_000126349.1.42104 WP_000126349.1.42136 WP_000126349.1.42156 WP_000126349.1.422 WP_000126349.1.4222 WP_000126349.1.42243 WP_000126349.1.42263 WP_000126349.1.42320 WP_000126349.1.42322 WP_000126349.1.42342 WP_000126349.1.42356 WP_000126349.1.4239 WP_000126349.1.42392 WP_000126349.1.42422 WP_000126349.1.42444 WP_000126349.1.42453 WP_000126349.1.42595 WP_000126349.1.42666 WP_000126349.1.42675 WP_000126349.1.42676 WP_000126349.1.42683 WP_000126349.1.42734 WP_000126349.1.4276 WP_000126349.1.42767 WP_000126349.1.42864 WP_000126349.1.4288 WP_000126349.1.42892 WP_000126349.1.42932 WP_000126349.1.42978 WP_000126349.1.43018 WP_000126349.1.43041 WP_000126349.1.43077 WP_000126349.1.43086 WP_000126349.1.43201 WP_000126349.1.43244 WP_000126349.1.43312 WP_000126349.1.43334 WP_000126349.1.43339 WP_000126349.1.43351 WP_000126349.1.43371 WP_000126349.1.43437 WP_000126349.1.4344 WP_000126349.1.43522 WP_000126349.1.43528 WP_000126349.1.43535 WP_000126349.1.43613 WP_000126349.1.43654 WP_000126349.1.43668 WP_000126349.1.43676 WP_000126349.1.43685 WP_000126349.1.43711 WP_000126349.1.4373 WP_000126349.1.43778 WP_000126349.1.43785 WP_000126349.1.43828 WP_000126349.1.43886 WP_000126349.1.43951 WP_000126349.1.44005 WP_000126349.1.44010 WP_000126349.1.44043 WP_000126349.1.44099 WP_000126349.1.44121 WP_000126349.1.44187 WP_000126349.1.44250 WP_000126349.1.44291 WP_000126349.1.44310 WP_000126349.1.44337 WP_000126349.1.44339 WP_000126349.1.44359 WP_000126349.1.44386 WP_000126349.1.44397 WP_000126349.1.4440 WP_000126349.1.44433 WP_000126349.1.44453 WP_000126349.1.44474 WP_000126349.1.44479 WP_000126349.1.44636 WP_000126349.1.44640 WP_000126349.1.4467 WP_000126349.1.44705 WP_000126349.1.44747 WP_000126349.1.44831 WP_000126349.1.4485 WP_000126349.1.44877 WP_000126349.1.44927 WP_000126349.1.44966 WP_000126349.1.44971 WP_000126349.1.44978 WP_000126349.1.44997 WP_000126349.1.4500 WP_000126349.1.45067 WP_000126349.1.45074 WP_000126349.1.45079 WP_000126349.1.45134 WP_000126349.1.45145 WP_000126349.1.45173 WP_000126349.1.45177 WP_000126349.1.45184 WP_000126349.1.45259 WP_000126349.1.45302 WP_000126349.1.4531 WP_000126349.1.45344 WP_000126349.1.45349 WP_000126349.1.45365 WP_000126349.1.45432 WP_000126349.1.45434 WP_000126349.1.45549 WP_000126349.1.45550 WP_000126349.1.45566 WP_000126349.1.45569 WP_000126349.1.45571 WP_000126349.1.45582 WP_000126349.1.45583 WP_000126349.1.45585 WP_000126349.1.45622 WP_000126349.1.45660 WP_000126349.1.45690 WP_000126349.1.45706 WP_000126349.1.45797 WP_000126349.1.458 WP_000126349.1.45844 WP_000126349.1.45906 WP_000126349.1.45918 WP_000126349.1.4592 WP_000126349.1.46011 WP_000126349.1.46069 WP_000126349.1.46112 WP_000126349.1.46173 WP_000126349.1.46174 WP_000126349.1.46187 WP_000126349.1.46215 WP_000126349.1.46232 WP_000126349.1.46278 WP_000126349.1.46303 WP_000126349.1.46358 WP_000126349.1.46578 WP_000126349.1.46595 WP_000126349.1.46637 WP_000126349.1.46675 WP_000126349.1.46726 WP_000126349.1.4674 WP_000126349.1.4686 WP_000126349.1.46930 WP_000126349.1.46967 WP_000126349.1.46976 WP_000126349.1.47008 WP_000126349.1.47057 WP_000126349.1.47058 WP_000126349.1.47214 WP_000126349.1.47389 WP_000126349.1.47429 WP_000126349.1.47448 WP_000126349.1.47460 WP_000126349.1.4747 WP_000126349.1.47472 WP_000126349.1.47478 WP_000126349.1.47492 WP_000126349.1.47507 WP_000126349.1.47567 WP_000126349.1.47576 WP_000126349.1.47579 WP_000126349.1.4758 WP_000126349.1.47614 WP_000126349.1.47621 WP_000126349.1.4775 WP_000126349.1.47767 WP_000126349.1.47799 WP_000126349.1.47829 WP_000126349.1.47850 WP_000126349.1.47875 WP_000126349.1.47911 WP_000126349.1.47928 WP_000126349.1.4795 WP_000126349.1.47988 WP_000126349.1.48242 WP_000126349.1.48253 WP_000126349.1.48268 WP_000126349.1.483 WP_000126349.1.48367 WP_000126349.1.48377 WP_000126349.1.4839 WP_000126349.1.48493 WP_000126349.1.48524 WP_000126349.1.4853 WP_000126349.1.48651 WP_000126349.1.48751 WP_000126349.1.48788 WP_000126349.1.48797 WP_000126349.1.4885 WP_000126349.1.48876 WP_000126349.1.48894 WP_000126349.1.48919 WP_000126349.1.49084 WP_000126349.1.49090 WP_000126349.1.49113 WP_000126349.1.49155 WP_000126349.1.49204 WP_000126349.1.49214 WP_000126349.1.49233 WP_000126349.1.49239 WP_000126349.1.49256 WP_000126349.1.49276 WP_000126349.1.49290 WP_000126349.1.49311 WP_000126349.1.49334 WP_000126349.1.49340 WP_000126349.1.49358 WP_000126349.1.49366 WP_000126349.1.49443 WP_000126349.1.49490 WP_000126349.1.49515 WP_000126349.1.49572 WP_000126349.1.49686 WP_000126349.1.49770 WP_000126349.1.4979 WP_000126349.1.49803 WP_000126349.1.49805 WP_000126349.1.49929 WP_000126349.1.50080 WP_000126349.1.50128 WP_000126349.1.50161 WP_000126349.1.50211 WP_000126349.1.50238 WP_000126349.1.50332 WP_000126349.1.50376 WP_000126349.1.50389 WP_000126349.1.50404 WP_000126349.1.50449 WP_000126349.1.50652 WP_000126349.1.50676 WP_000126349.1.50684 WP_000126349.1.50774 WP_000126349.1.50804 WP_000126349.1.50808 WP_000126349.1.5088 WP_000126349.1.50882 WP_000126349.1.50893 WP_000126349.1.50905 WP_000126349.1.50941 WP_000126349.1.50960 WP_000126349.1.50999 WP_000126349.1.51014 WP_000126349.1.51022 WP_000126349.1.51025 WP_000126349.1.51036 WP_000126349.1.51066 WP_000126349.1.5114 WP_000126349.1.51179 WP_000126349.1.51182 WP_000126349.1.51186 WP_000126349.1.51224 WP_000126349.1.5125 WP_000126349.1.51356 WP_000126349.1.51412 WP_000126349.1.51451 WP_000126349.1.51464 WP_000126349.1.51487 WP_000126349.1.51488 WP_000126349.1.51502 WP_000126349.1.51518 WP_000126349.1.51594 WP_000126349.1.51634 WP_000126349.1.51642 WP_000126349.1.51649 WP_000126349.1.51686 WP_000126349.1.51704 WP_000126349.1.51756 WP_000126349.1.51764 WP_000126349.1.51810 WP_000126349.1.51841 WP_000126349.1.51868 WP_000126349.1.51888 WP_000126349.1.51910 WP_000126349.1.51911 WP_000126349.1.51930 WP_000126349.1.51932 WP_000126349.1.51989 WP_000126349.1.51994 WP_000126349.1.520 WP_000126349.1.52047 WP_000126349.1.5211 WP_000126349.1.52121 WP_000126349.1.52148 WP_000126349.1.52170 WP_000126349.1.52255 WP_000126349.1.52321 WP_000126349.1.52336 WP_000126349.1.52346 WP_000126349.1.52353 WP_000126349.1.52361 WP_000126349.1.52456 WP_000126349.1.52582 WP_000126349.1.52586 WP_000126349.1.52653 WP_000126349.1.52656 WP_000126349.1.52675 WP_000126349.1.52692 WP_000126349.1.52743 WP_000126349.1.52833 WP_000126349.1.52851 WP_000126349.1.52857 WP_000126349.1.52858 WP_000126349.1.52866 WP_000126349.1.52898 WP_000126349.1.52915 WP_000126349.1.52949 WP_000126349.1.53107 WP_000126349.1.53119 WP_000126349.1.5313 WP_000126349.1.53190 WP_000126349.1.53198 WP_000126349.1.53206 WP_000126349.1.53234 WP_000126349.1.53272 WP_000126349.1.53315 WP_000126349.1.53362 WP_000126349.1.53385 WP_000126349.1.53406 WP_000126349.1.53436 WP_000126349.1.53466 WP_000126349.1.53529 WP_000126349.1.53543 WP_000126349.1.53567 WP_000126349.1.53664 WP_000126349.1.53688 WP_000126349.1.53757 WP_000126349.1.53778 WP_000126349.1.53781 WP_000126349.1.53812 WP_000126349.1.53814 WP_000126349.1.53896 WP_000126349.1.53905 WP_000126349.1.5392 WP_000126349.1.53961 WP_000126349.1.54033 WP_000126349.1.54068 WP_000126349.1.54075 WP_000126349.1.5415 WP_000126349.1.54196 WP_000126349.1.542 WP_000126349.1.54209 WP_000126349.1.54271 WP_000126349.1.54273 WP_000126349.1.54274 WP_000126349.1.54283 WP_000126349.1.54319 WP_000126349.1.54324 WP_000126349.1.54364 WP_000126349.1.54366 WP_000126349.1.54400 WP_000126349.1.54469 WP_000126349.1.54526 WP_000126349.1.5459 WP_000126349.1.54615 WP_000126349.1.54644 WP_000126349.1.54662 WP_000126349.1.54722 WP_000126349.1.54749 WP_000126349.1.54764 WP_000126349.1.54822 WP_000126349.1.54833 WP_000126349.1.54877 WP_000126349.1.54936 WP_000126349.1.55008 WP_000126349.1.55152 WP_000126349.1.55156 WP_000126349.1.55166 WP_000126349.1.55178 WP_000126349.1.55285 WP_000126349.1.55325 WP_000126349.1.55361 WP_000126349.1.55430 WP_000126349.1.55475 WP_000126349.1.55559 WP_000126349.1.5560 WP_000126349.1.55623 WP_000126349.1.55640 WP_000126349.1.55647 WP_000126349.1.5572 WP_000126349.1.55743 WP_000126349.1.55768 WP_000126349.1.5577 WP_000126349.1.55782 WP_000126349.1.55796 WP_000126349.1.55803 WP_000126349.1.55853 WP_000126349.1.55923 WP_000126349.1.55948 WP_000126349.1.55993 WP_000126349.1.56002 WP_000126349.1.56004 WP_000126349.1.56012 WP_000126349.1.56097 WP_000126349.1.56105 WP_000126349.1.56152 WP_000126349.1.56222 WP_000126349.1.56235 WP_000126349.1.56238 WP_000126349.1.56244 WP_000126349.1.56263 WP_000126349.1.56286 WP_000126349.1.56303 WP_000126349.1.56304 WP_000126349.1.56370 WP_000126349.1.56413 WP_000126349.1.56414 WP_000126349.1.56438 WP_000126349.1.56559 WP_000126349.1.56560 WP_000126349.1.56597 WP_000126349.1.56601 WP_000126349.1.56614 WP_000126349.1.56660 WP_000126349.1.56671 WP_000126349.1.5668 WP_000126349.1.56682 WP_000126349.1.56851 WP_000126349.1.56861 WP_000126349.1.56877 WP_000126349.1.56898 WP_000126349.1.56950 WP_000126349.1.57026 WP_000126349.1.57039 WP_000126349.1.57056 WP_000126349.1.57076 WP_000126349.1.5711 WP_000126349.1.57143 WP_000126349.1.57168 WP_000126349.1.57187 WP_000126349.1.57232 WP_000126349.1.57246 WP_000126349.1.57296 WP_000126349.1.57344 WP_000126349.1.57356 WP_000126349.1.57362 WP_000126349.1.57377 WP_000126349.1.57433 WP_000126349.1.57495 WP_000126349.1.57515 WP_000126349.1.57521 WP_000126349.1.57529 WP_000126349.1.57559 WP_000126349.1.57576 WP_000126349.1.57601 WP_000126349.1.57607 WP_000126349.1.57631 WP_000126349.1.57641 WP_000126349.1.5774 WP_000126349.1.57763 WP_000126349.1.57835 WP_000126349.1.57857 WP_000126349.1.57862 WP_000126349.1.57890 WP_000126349.1.57891 WP_000126349.1.57893 WP_000126349.1.57978 WP_000126349.1.5801 WP_000126349.1.58041 WP_000126349.1.58090 WP_000126349.1.58131 WP_000126349.1.58144 WP_000126349.1.58239 WP_000126349.1.58251 WP_000126349.1.5828 WP_000126349.1.58290 WP_000126349.1.58358 WP_000126349.1.58416 WP_000126349.1.58418 WP_000126349.1.58443 WP_000126349.1.58451 WP_000126349.1.58486 WP_000126349.1.58489 WP_000126349.1.5854 WP_000126349.1.58548 WP_000126349.1.5858 WP_000126349.1.58662 WP_000126349.1.58669 WP_000126349.1.58698 WP_000126349.1.587 WP_000126349.1.58745 WP_000126349.1.58749 WP_000126349.1.58803 WP_000126349.1.58831 WP_000126349.1.5886 WP_000126349.1.58884 WP_000126349.1.58926 WP_000126349.1.58932 WP_000126349.1.59006 WP_000126349.1.59094 WP_000126349.1.59142 WP_000126349.1.59163 WP_000126349.1.59224 WP_000126349.1.5929 WP_000126349.1.59321 WP_000126349.1.59335 WP_000126349.1.59375 WP_000126349.1.59420 WP_000126349.1.59427 WP_000126349.1.59458 WP_000126349.1.59490 WP_000126349.1.59508 WP_000126349.1.5953 WP_000126349.1.59538 WP_000126349.1.59548 WP_000126349.1.59646 WP_000126349.1.59684 WP_000126349.1.59694 WP_000126349.1.59755 WP_000126349.1.59771 WP_000126349.1.5979 WP_000126349.1.59848 WP_000126349.1.59933 WP_000126349.1.59953 WP_000126349.1.59979 WP_000126349.1.60004 WP_000126349.1.60008 WP_000126349.1.60021 WP_000126349.1.60052 WP_000126349.1.60069 WP_000126349.1.60126 WP_000126349.1.60137 WP_000126349.1.60140 WP_000126349.1.60155 WP_000126349.1.60226 WP_000126349.1.60285 WP_000126349.1.60320 WP_000126349.1.6033 WP_000126349.1.60379 WP_000126349.1.60425 WP_000126349.1.60464 WP_000126349.1.60503 WP_000126349.1.60545 WP_000126349.1.60560 WP_000126349.1.60561 WP_000126349.1.60622 WP_000126349.1.60713 WP_000126349.1.60760 WP_000126349.1.60772 WP_000126349.1.608 WP_000126349.1.60855 WP_000126349.1.60863 WP_000126349.1.60866 WP_000126349.1.60874 WP_000126349.1.60897 WP_000126349.1.60941 WP_000126349.1.61078 WP_000126349.1.6114 WP_000126349.1.61146 WP_000126349.1.61232 WP_000126349.1.6129 WP_000126349.1.61296 WP_000126349.1.61345 WP_000126349.1.61356 WP_000126349.1.61381 WP_000126349.1.61417 WP_000126349.1.61501 WP_000126349.1.61574 WP_000126349.1.61594 WP_000126349.1.61595 WP_000126349.1.61609 WP_000126349.1.61671 WP_000126349.1.61712 WP_000126349.1.61730 WP_000126349.1.61732 WP_000126349.1.61857 WP_000126349.1.61908 WP_000126349.1.61918 WP_000126349.1.61952 WP_000126349.1.62007 WP_000126349.1.62020 WP_000126349.1.62025 WP_000126349.1.62076 WP_000126349.1.6209 WP_000126349.1.62144 WP_000126349.1.62158 WP_000126349.1.62201 WP_000126349.1.62204 WP_000126349.1.62210 WP_000126349.1.62219 WP_000126349.1.62241 WP_000126349.1.62245 WP_000126349.1.62257 WP_000126349.1.62304 WP_000126349.1.62364 WP_000126349.1.62374 WP_000126349.1.62403 WP_000126349.1.62404 WP_000126349.1.62412 WP_000126349.1.62486 WP_000126349.1.6253 WP_000126349.1.62570 WP_000126349.1.62693 WP_000126349.1.627 WP_000126349.1.62745 WP_000126349.1.62757 WP_000126349.1.62798 WP_000126349.1.62853 WP_000126349.1.62903 WP_000126349.1.62910 WP_000126349.1.6292 WP_000126349.1.62955 WP_000126349.1.62983 WP_000126349.1.62988 WP_000126349.1.63045 WP_000126349.1.63063 WP_000126349.1.63102 WP_000126349.1.63118 WP_000126349.1.63129 WP_000126349.1.63135 WP_000126349.1.63181 WP_000126349.1.63203 WP_000126349.1.63229 WP_000126349.1.63256 WP_000126349.1.63290 WP_000126349.1.63358 WP_000126349.1.63382 WP_000126349.1.63422 WP_000126349.1.63432 WP_000126349.1.63461 WP_000126349.1.63479 WP_000126349.1.63497 WP_000126349.1.63509 WP_000126349.1.63529 WP_000126349.1.63532 WP_000126349.1.63577 WP_000126349.1.63585 WP_000126349.1.63603 WP_000126349.1.63664 WP_000126349.1.63690 WP_000126349.1.6370 WP_000126349.1.63718 WP_000126349.1.63748 WP_000126349.1.6375 WP_000126349.1.63757 WP_000126349.1.63782 WP_000126349.1.63797 WP_000126349.1.63834 WP_000126349.1.63851 WP_000126349.1.63860 WP_000126349.1.63863 WP_000126349.1.63866 WP_000126349.1.63912 WP_000126349.1.63958 WP_000126349.1.6399 WP_000126349.1.64010 WP_000126349.1.64018 WP_000126349.1.64046 WP_000126349.1.64085 WP_000126349.1.64109 WP_000126349.1.64121 WP_000126349.1.64157 WP_000126349.1.64229 WP_000126349.1.6423 WP_000126349.1.64244 WP_000126349.1.64350 WP_000126349.1.64374 WP_000126349.1.64385 WP_000126349.1.64387 WP_000126349.1.64403 WP_000126349.1.64412 WP_000126349.1.64462 WP_000126349.1.64500 WP_000126349.1.6451 WP_000126349.1.64597 WP_000126349.1.64649 WP_000126349.1.64702 WP_000126349.1.64711 WP_000126349.1.64757 WP_000126349.1.64781 WP_000126349.1.64831 WP_000126349.1.6489 WP_000126349.1.64894 WP_000126349.1.65011 WP_000126349.1.65018 WP_000126349.1.65028 WP_000126349.1.65171 WP_000126349.1.65248 WP_000126349.1.65269 WP_000126349.1.65295 WP_000126349.1.6535 WP_000126349.1.65357 WP_000126349.1.65394 WP_000126349.1.65474 WP_000126349.1.65572 WP_000126349.1.65601 WP_000126349.1.65633 WP_000126349.1.6565 WP_000126349.1.65696 WP_000126349.1.65698 WP_000126349.1.6575 WP_000126349.1.65771 WP_000126349.1.65782 WP_000126349.1.65790 WP_000126349.1.65881 WP_000126349.1.65883 WP_000126349.1.65901 WP_000126349.1.6594 WP_000126349.1.65940 WP_000126349.1.6595 WP_000126349.1.65956 WP_000126349.1.66049 WP_000126349.1.66082 WP_000126349.1.66122 WP_000126349.1.66171 WP_000126349.1.66289 WP_000126349.1.6630 WP_000126349.1.66314 WP_000126349.1.66315 WP_000126349.1.66358 WP_000126349.1.66362 WP_000126349.1.6638 WP_000126349.1.66385 WP_000126349.1.6640 WP_000126349.1.66400 WP_000126349.1.66428 WP_000126349.1.66446 WP_000126349.1.66492 WP_000126349.1.66539 WP_000126349.1.66600 WP_000126349.1.66678 WP_000126349.1.66698 WP_000126349.1.66733 WP_000126349.1.6680 WP_000126349.1.66800 WP_000126349.1.66824 WP_000126349.1.66834 WP_000126349.1.6692 WP_000126349.1.66937 WP_000126349.1.66959 WP_000126349.1.66962 WP_000126349.1.67037 WP_000126349.1.67045 WP_000126349.1.67075 WP_000126349.1.6710 WP_000126349.1.67100 WP_000126349.1.67173 WP_000126349.1.67181 WP_000126349.1.67235 WP_000126349.1.67268 WP_000126349.1.67279 WP_000126349.1.67347 WP_000126349.1.67465 WP_000126349.1.67552 WP_000126349.1.6760 WP_000126349.1.67682 WP_000126349.1.67814 WP_000126349.1.6782 WP_000126349.1.67829 WP_000126349.1.6785 WP_000126349.1.67887 WP_000126349.1.67932 WP_000126349.1.67969 WP_000126349.1.67988 WP_000126349.1.68036 WP_000126349.1.68073 WP_000126349.1.68140 WP_000126349.1.68159 WP_000126349.1.68167 WP_000126349.1.68201 WP_000126349.1.68206 WP_000126349.1.6827 WP_000126349.1.68275 WP_000126349.1.68401 WP_000126349.1.68477 WP_000126349.1.68478 WP_000126349.1.6849 WP_000126349.1.68547 WP_000126349.1.6858 WP_000126349.1.68589 WP_000126349.1.68629 WP_000126349.1.68652 WP_000126349.1.68655 WP_000126349.1.68656 WP_000126349.1.68677 WP_000126349.1.68778 WP_000126349.1.68787 WP_000126349.1.68893 WP_000126349.1.68894 WP_000126349.1.68895 WP_000126349.1.68928 WP_000126349.1.68975 WP_000126349.1.69001 WP_000126349.1.69006 WP_000126349.1.6904 WP_000126349.1.69080 WP_000126349.1.69086 WP_000126349.1.6913 WP_000126349.1.69131 WP_000126349.1.69139 WP_000126349.1.69146 WP_000126349.1.69151 WP_000126349.1.69236 WP_000126349.1.69255 WP_000126349.1.69273 WP_000126349.1.69296 WP_000126349.1.69357 WP_000126349.1.69359 WP_000126349.1.69397 WP_000126349.1.69485 WP_000126349.1.6954 WP_000126349.1.69554 WP_000126349.1.69564 WP_000126349.1.69575 WP_000126349.1.69616 WP_000126349.1.69644 WP_000126349.1.69704 WP_000126349.1.69754 WP_000126349.1.69767 WP_000126349.1.69890 WP_000126349.1.69965 WP_000126349.1.70003 WP_000126349.1.70088 WP_000126349.1.7010 WP_000126349.1.70169 WP_000126349.1.7021 WP_000126349.1.70241 WP_000126349.1.70269 WP_000126349.1.70272 WP_000126349.1.70281 WP_000126349.1.70289 WP_000126349.1.70303 WP_000126349.1.70327 WP_000126349.1.70355 WP_000126349.1.7044 WP_000126349.1.70440 WP_000126349.1.70447 WP_000126349.1.70485 WP_000126349.1.70531 WP_000126349.1.70596 WP_000126349.1.70643 WP_000126349.1.70678 WP_000126349.1.70683 WP_000126349.1.70733 WP_000126349.1.70761 WP_000126349.1.70785 WP_000126349.1.70837 WP_000126349.1.70883 WP_000126349.1.70899 WP_000126349.1.70914 WP_000126349.1.70922 WP_000126349.1.70929 WP_000126349.1.7093 WP_000126349.1.70948 WP_000126349.1.70959 WP_000126349.1.70969 WP_000126349.1.70977 WP_000126349.1.70985 WP_000126349.1.70986 WP_000126349.1.71023 WP_000126349.1.71116 WP_000126349.1.71146 WP_000126349.1.71165 WP_000126349.1.71172 WP_000126349.1.71184 WP_000126349.1.71188 WP_000126349.1.71201 WP_000126349.1.71202 WP_000126349.1.71243 WP_000126349.1.71248 WP_000126349.1.71305 WP_000126349.1.71306 WP_000126349.1.71337 WP_000126349.1.7134 WP_000126349.1.71363 WP_000126349.1.71378 WP_000126349.1.714 WP_000126349.1.71401 WP_000126349.1.71450 WP_000126349.1.71481 WP_000126349.1.71583 WP_000126349.1.71600 WP_000126349.1.71626 WP_000126349.1.71636 WP_000126349.1.71649 WP_000126349.1.71667 WP_000126349.1.71691 WP_000126349.1.71702 WP_000126349.1.71750 WP_000126349.1.71845 WP_000126349.1.71881 WP_000126349.1.71908 WP_000126349.1.71952 WP_000126349.1.71973 WP_000126349.1.71979 WP_000126349.1.71984 WP_000126349.1.720 WP_000126349.1.72100 WP_000126349.1.72105 WP_000126349.1.72182 WP_000126349.1.72190 WP_000126349.1.72203 WP_000126349.1.72221 WP_000126349.1.72243 WP_000126349.1.72300 WP_000126349.1.72325 WP_000126349.1.72339 WP_000126349.1.72372 WP_000126349.1.72376 WP_000126349.1.72403 WP_000126349.1.72470 WP_000126349.1.72532 WP_000126349.1.72594 WP_000126349.1.72602 WP_000126349.1.72625 WP_000126349.1.72716 WP_000126349.1.72718 WP_000126349.1.72728 WP_000126349.1.72793 WP_000126349.1.72843 WP_000126349.1.72865 WP_000126349.1.72871 WP_000126349.1.7295 WP_000126349.1.72975 WP_000126349.1.73062 WP_000126349.1.73068 WP_000126349.1.73125 WP_000126349.1.7315 WP_000126349.1.73200 WP_000126349.1.7334 WP_000126349.1.73377 WP_000126349.1.73461 WP_000126349.1.73481 WP_000126349.1.7356 WP_000126349.1.73561 WP_000126349.1.73581 WP_000126349.1.73617 WP_000126349.1.73667 WP_000126349.1.73708 WP_000126349.1.73753 WP_000126349.1.73758 WP_000126349.1.73764 WP_000126349.1.73794 WP_000126349.1.73847 WP_000126349.1.7387 WP_000126349.1.73924 WP_000126349.1.73926 WP_000126349.1.73965 WP_000126349.1.74029 WP_000126349.1.74089 WP_000126349.1.74174 WP_000126349.1.74181 WP_000126349.1.74191 WP_000126349.1.74207 WP_000126349.1.74248 WP_000126349.1.743 WP_000126349.1.74300 WP_000126349.1.7433 WP_000126349.1.74379 WP_000126349.1.74402 WP_000126349.1.74410 WP_000126349.1.7444 WP_000126349.1.74454 WP_000126349.1.74466 WP_000126349.1.74469 WP_000126349.1.745 WP_000126349.1.74500 WP_000126349.1.74529 WP_000126349.1.74545 WP_000126349.1.74578 WP_000126349.1.74620 WP_000126349.1.74632 WP_000126349.1.74745 WP_000126349.1.74876 WP_000126349.1.7491 WP_000126349.1.74972 WP_000126349.1.75051 WP_000126349.1.75056 WP_000126349.1.75058 WP_000126349.1.75129 WP_000126349.1.75148 WP_000126349.1.75159 WP_000126349.1.75168 WP_000126349.1.75177 WP_000126349.1.75187 WP_000126349.1.75288 WP_000126349.1.75301 WP_000126349.1.75334 WP_000126349.1.75362 WP_000126349.1.75385 WP_000126349.1.75392 WP_000126349.1.75400 WP_000126349.1.75450 WP_000126349.1.7558 WP_000126349.1.75607 WP_000126349.1.75716 WP_000126349.1.75740 WP_000126349.1.75751 WP_000126349.1.75760 WP_000126349.1.75764 WP_000126349.1.75794 WP_000126349.1.75810 WP_000126349.1.75828 WP_000126349.1.75837 WP_000126349.1.75863 WP_000126349.1.75874 WP_000126349.1.75902 WP_000126349.1.75932 WP_000126349.1.75945 WP_000126349.1.76020 WP_000126349.1.76108 WP_000126349.1.76137 WP_000126349.1.76252 WP_000126349.1.76327 WP_000126349.1.76345 WP_000126349.1.76434 WP_000126349.1.76445 WP_000126349.1.76451 WP_000126349.1.76471 WP_000126349.1.76495 WP_000126349.1.7655 WP_000126349.1.7660 WP_000126349.1.76611 WP_000126349.1.76673 WP_000126349.1.76706 WP_000126349.1.76721 WP_000126349.1.76756 WP_000126349.1.76760 WP_000126349.1.76776 WP_000126349.1.76799 WP_000126349.1.7684 WP_000126349.1.76875 WP_000126349.1.76880 WP_000126349.1.76899 WP_000126349.1.76913 WP_000126349.1.76968 WP_000126349.1.77038 WP_000126349.1.77047 WP_000126349.1.77067 WP_000126349.1.77080 WP_000126349.1.7712 WP_000126349.1.77177 WP_000126349.1.77180 WP_000126349.1.77241 WP_000126349.1.77244 WP_000126349.1.77267 WP_000126349.1.77292 WP_000126349.1.77306 WP_000126349.1.77349 WP_000126349.1.77356 WP_000126349.1.77475 WP_000126349.1.77496 WP_000126349.1.77514 WP_000126349.1.77529 WP_000126349.1.77549 WP_000126349.1.77565 WP_000126349.1.77692 WP_000126349.1.77710 WP_000126349.1.7782 WP_000126349.1.77851 WP_000126349.1.77898 WP_000126349.1.77918 WP_000126349.1.7792 WP_000126349.1.7793 WP_000126349.1.77951 WP_000126349.1.77960 WP_000126349.1.77983 WP_000126349.1.77987 WP_000126349.1.77989 WP_000126349.1.7802 WP_000126349.1.78033 WP_000126349.1.78051 WP_000126349.1.78076 WP_000126349.1.78096 WP_000126349.1.78100 WP_000126349.1.78120 WP_000126349.1.7814 WP_000126349.1.78383 WP_000126349.1.78407 WP_000126349.1.78443 WP_000126349.1.78501 WP_000126349.1.78603 WP_000126349.1.7861 WP_000126349.1.78618 WP_000126349.1.78632 WP_000126349.1.78658 WP_000126349.1.78673 WP_000126349.1.78697 WP_000126349.1.78734 WP_000126349.1.78735 WP_000126349.1.7877 WP_000126349.1.78789 WP_000126349.1.78802 WP_000126349.1.78815 WP_000126349.1.78830 WP_000126349.1.78835 WP_000126349.1.78838 WP_000126349.1.78871 WP_000126349.1.78874 WP_000126349.1.78877 WP_000126349.1.78881 WP_000126349.1.78896 WP_000126349.1.78918 WP_000126349.1.78928 WP_000126349.1.7893 WP_000126349.1.78930 WP_000126349.1.79099 WP_000126349.1.79151 WP_000126349.1.79167 WP_000126349.1.79289 WP_000126349.1.79335 WP_000126349.1.79462 WP_000126349.1.79468 WP_000126349.1.79472 WP_000126349.1.79490 WP_000126349.1.79495 WP_000126349.1.79529 WP_000126349.1.79570 WP_000126349.1.79580 WP_000126349.1.79586 WP_000126349.1.7964 WP_000126349.1.79659 WP_000126349.1.79668 WP_000126349.1.79708 WP_000126349.1.79734 WP_000126349.1.79757 WP_000126349.1.7979 WP_000126349.1.7982 WP_000126349.1.79845 WP_000126349.1.7991 WP_000126349.1.79910 WP_000126349.1.79974 WP_000126349.1.80077 WP_000126349.1.80137 WP_000126349.1.80182 WP_000126349.1.80229 WP_000126349.1.8024 WP_000126349.1.80249 WP_000126349.1.80254 WP_000126349.1.80293 WP_000126349.1.80296 WP_000126349.1.80333 WP_000126349.1.80366 WP_000126349.1.80380 WP_000126349.1.80473 WP_000126349.1.80496 WP_000126349.1.80609 WP_000126349.1.80723 WP_000126349.1.80741 WP_000126349.1.80760 WP_000126349.1.80780 WP_000126349.1.80831 WP_000126349.1.80850 WP_000126349.1.80874 WP_000126349.1.80876 WP_000126349.1.80881 WP_000126349.1.80939 WP_000126349.1.8096 WP_000126349.1.81037 WP_000126349.1.8106 WP_000126349.1.81062 WP_000126349.1.81069 WP_000126349.1.81109 WP_000126349.1.81110 WP_000126349.1.81118 WP_000126349.1.81149 WP_000126349.1.81175 WP_000126349.1.8119 WP_000126349.1.81193 WP_000126349.1.81197 WP_000126349.1.81225 WP_000126349.1.8130 WP_000126349.1.81305 WP_000126349.1.81320 WP_000126349.1.81328 WP_000126349.1.8134 WP_000126349.1.81354 WP_000126349.1.81388 WP_000126349.1.81410 WP_000126349.1.81425 WP_000126349.1.81455 WP_000126349.1.81528 WP_000126349.1.81668 WP_000126349.1.81735 WP_000126349.1.81736 WP_000126349.1.81750 WP_000126349.1.81760 WP_000126349.1.81768 WP_000126349.1.81785 WP_000126349.1.81902 WP_000126349.1.81974 WP_000126349.1.82149 WP_000126349.1.82192 WP_000126349.1.82232 WP_000126349.1.82337 WP_000126349.1.82395 WP_000126349.1.82401 WP_000126349.1.82420 WP_000126349.1.82434 WP_000126349.1.82464 WP_000126349.1.8247 WP_000126349.1.82474 WP_000126349.1.82479 WP_000126349.1.82503 WP_000126349.1.82515 WP_000126349.1.82569 WP_000126349.1.82584 WP_000126349.1.82676 WP_000126349.1.82761 WP_000126349.1.8282 WP_000126349.1.82867 WP_000126349.1.82886 WP_000126349.1.82908 WP_000126349.1.82944 WP_000126349.1.82956 WP_000126349.1.83005 WP_000126349.1.83006 WP_000126349.1.83092 WP_000126349.1.83163 WP_000126349.1.83204 WP_000126349.1.83258 WP_000126349.1.83305 WP_000126349.1.83331 WP_000126349.1.83354 WP_000126349.1.83356 WP_000126349.1.83365 WP_000126349.1.83413 WP_000126349.1.83491 WP_000126349.1.83523 WP_000126349.1.8354 WP_000126349.1.83558 WP_000126349.1.83572 WP_000126349.1.83651 WP_000126349.1.83721 WP_000126349.1.83739 WP_000126349.1.83760 WP_000126349.1.8399 WP_000126349.1.83995 WP_000126349.1.84000 WP_000126349.1.84011 WP_000126349.1.84075 WP_000126349.1.84083 WP_000126349.1.84086 WP_000126349.1.84103 WP_000126349.1.84115 WP_000126349.1.84154 WP_000126349.1.84209 WP_000126349.1.8425 WP_000126349.1.84283 WP_000126349.1.84291 WP_000126349.1.84300 WP_000126349.1.84392 WP_000126349.1.8441 WP_000126349.1.84497 WP_000126349.1.84515 WP_000126349.1.84532 WP_000126349.1.84572 WP_000126349.1.84598 WP_000126349.1.84659 WP_000126349.1.84693 WP_000126349.1.84876 WP_000126349.1.84899 WP_000126349.1.8497 WP_000126349.1.84983 WP_000126349.1.85040 WP_000126349.1.85079 WP_000126349.1.85126 WP_000126349.1.85134 WP_000126349.1.85178 WP_000126349.1.85180 WP_000126349.1.85190 WP_000126349.1.85217 WP_000126349.1.8526 WP_000126349.1.85271 WP_000126349.1.85301 WP_000126349.1.85408 WP_000126349.1.8545 WP_000126349.1.85481 WP_000126349.1.85483 WP_000126349.1.85541 WP_000126349.1.8556 WP_000126349.1.85568 WP_000126349.1.85615 WP_000126349.1.85617 WP_000126349.1.85663 WP_000126349.1.85671 WP_000126349.1.85672 WP_000126349.1.85759 WP_000126349.1.85777 WP_000126349.1.85797 WP_000126349.1.85855 WP_000126349.1.85886 WP_000126349.1.85900 WP_000126349.1.85904 WP_000126349.1.85976 WP_000126349.1.85982 WP_000126349.1.86043 WP_000126349.1.86138 WP_000126349.1.86157 WP_000126349.1.86159 WP_000126349.1.8616 WP_000126349.1.86173 WP_000126349.1.86206 WP_000126349.1.86240 WP_000126349.1.86284 WP_000126349.1.86306 WP_000126349.1.86316 WP_000126349.1.86347 WP_000126349.1.86356 WP_000126349.1.86380 WP_000126349.1.86450 WP_000126349.1.86469 WP_000126349.1.8647 WP_000126349.1.86514 WP_000126349.1.86580 WP_000126349.1.86588 WP_000126349.1.86610 WP_000126349.1.86656 WP_000126349.1.86658 WP_000126349.1.86661 WP_000126349.1.86676 WP_000126349.1.8672 WP_000126349.1.8678 WP_000126349.1.86810 WP_000126349.1.8684 WP_000126349.1.86895 WP_000126349.1.86906 WP_000126349.1.8691 WP_000126349.1.86915 WP_000126349.1.87038 WP_000126349.1.87095 WP_000126349.1.87187 WP_000126349.1.87265 WP_000126349.1.87282 WP_000126349.1.87323 WP_000126349.1.8736 WP_000126349.1.87460 WP_000126349.1.87484 WP_000126349.1.87493 WP_000126349.1.87500 WP_000126349.1.87552 WP_000126349.1.87583 WP_000126349.1.87618 WP_000126349.1.87626 WP_000126349.1.87695 WP_000126349.1.87712 WP_000126349.1.87760 WP_000126349.1.87779 WP_000126349.1.87899 WP_000126349.1.87905 WP_000126349.1.8792 WP_000126349.1.87936 WP_000126349.1.87945 WP_000126349.1.88019 WP_000126349.1.88052 WP_000126349.1.88073 WP_000126349.1.8809 WP_000126349.1.88092 WP_000126349.1.88185 WP_000126349.1.88214 WP_000126349.1.88275 WP_000126349.1.88291 WP_000126349.1.88293 WP_000126349.1.88356 WP_000126349.1.8837 WP_000126349.1.88393 WP_000126349.1.88474 WP_000126349.1.88483 WP_000126349.1.88508 WP_000126349.1.88624 WP_000126349.1.88683 WP_000126349.1.88703 WP_000126349.1.88731 WP_000126349.1.88792 WP_000126349.1.88854 WP_000126349.1.88902 WP_000126349.1.8891 WP_000126349.1.88957 WP_000126349.1.88966 WP_000126349.1.88968 WP_000126349.1.88970 WP_000126349.1.88980 WP_000126349.1.88981 WP_000126349.1.88982 WP_000126349.1.88998 WP_000126349.1.89008 WP_000126349.1.89116 WP_000126349.1.89119 WP_000126349.1.89120 WP_000126349.1.89138 WP_000126349.1.89177 WP_000126349.1.89221 WP_000126349.1.89304 WP_000126349.1.89362 WP_000126349.1.89408 WP_000126349.1.89425 WP_000126349.1.89462 WP_000126349.1.89512 WP_000126349.1.89527 WP_000126349.1.89570 WP_000126349.1.89604 WP_000126349.1.89606 WP_000126349.1.8961 WP_000126349.1.89622 WP_000126349.1.89634 WP_000126349.1.89657 WP_000126349.1.89659 WP_000126349.1.89680 WP_000126349.1.89815 WP_000126349.1.89817 WP_000126349.1.89832 WP_000126349.1.89902 WP_000126349.1.8996 WP_000126349.1.9003 WP_000126349.1.90097 WP_000126349.1.90252 WP_000126349.1.90311 WP_000126349.1.90348 WP_000126349.1.90409 WP_000126349.1.90417 WP_000126349.1.90421 WP_000126349.1.90453 WP_000126349.1.90458 WP_000126349.1.90522 WP_000126349.1.90540 WP_000126349.1.90557 WP_000126349.1.90563 WP_000126349.1.90585 WP_000126349.1.90625 WP_000126349.1.90641 WP_000126349.1.90701 WP_000126349.1.90734 WP_000126349.1.90748 WP_000126349.1.90759 WP_000126349.1.90859 WP_000126349.1.90959 WP_000126349.1.90973 WP_000126349.1.90983 WP_000126349.1.90991 WP_000126349.1.91003 WP_000126349.1.91056 WP_000126349.1.91069 WP_000126349.1.91179 WP_000126349.1.91215 WP_000126349.1.91278 WP_000126349.1.9131 WP_000126349.1.9137 WP_000126349.1.91372 WP_000126349.1.91424 WP_000126349.1.91474 WP_000126349.1.91505 WP_000126349.1.91512 WP_000126349.1.91524 WP_000126349.1.91564 WP_000126349.1.91621 WP_000126349.1.91628 WP_000126349.1.91655 WP_000126349.1.91724 WP_000126349.1.91732 WP_000126349.1.91742 WP_000126349.1.91772 WP_000126349.1.91776 WP_000126349.1.91788 WP_000126349.1.91795 WP_000126349.1.91864 WP_000126349.1.91898 WP_000126349.1.91904 WP_000126349.1.91974 WP_000126349.1.92013 WP_000126349.1.92039 WP_000126349.1.92060 WP_000126349.1.92082 WP_000126349.1.92093 WP_000126349.1.92099 WP_000126349.1.92108 WP_000126349.1.92129 WP_000126349.1.92165 WP_000126349.1.92171 WP_000126349.1.92183 WP_000126349.1.92208 WP_000126349.1.9222 WP_000126349.1.92268 WP_000126349.1.92310 WP_000126349.1.92318 WP_000126349.1.92394 WP_000126349.1.92443 WP_000126349.1.92452 WP_000126349.1.92482 WP_000126349.1.92531 WP_000126349.1.92557 WP_000126349.1.92628 WP_000126349.1.92669 WP_000126349.1.92671 WP_000126349.1.92738 WP_000126349.1.92754 WP_000126349.1.92806 WP_000126349.1.92827 WP_000126349.1.92836 WP_000126349.1.92843 WP_000126349.1.92883 WP_000126349.1.92890 WP_000126349.1.92893 WP_000126349.1.92929 WP_000126349.1.92939 WP_000126349.1.93059 WP_000126349.1.93076 WP_000126349.1.93086 WP_000126349.1.93101 WP_000126349.1.93136 WP_000126349.1.93155 WP_000126349.1.93215 WP_000126349.1.93275 WP_000126349.1.93339 WP_000126349.1.93350 WP_000126349.1.93365 WP_000126349.1.93376 WP_000126349.1.93410 WP_000126349.1.93524 WP_000126349.1.93543 WP_000126349.1.93577 WP_000126349.1.93648 WP_000126349.1.93650 WP_000126349.1.93656 WP_000126349.1.93662 WP_000126349.1.937 WP_000126349.1.93705 WP_000126349.1.9380 WP_000126349.1.93803 WP_000126349.1.93804 WP_000126349.1.93809 WP_000126349.1.9389 WP_000126349.1.93937 WP_000126349.1.93994 WP_000126349.1.94072 WP_000126349.1.94162 WP_000126349.1.94168 WP_000126349.1.94198 WP_000126349.1.9432 WP_000126349.1.94352 WP_000126349.1.94354 WP_000126349.1.94380 WP_000126349.1.9440 WP_000126349.1.94458 WP_000126349.1.94473 WP_000126349.1.94565 WP_000126349.1.94584 WP_000126349.1.94598 WP_000126349.1.94649 WP_000126349.1.94655 WP_000126349.1.94670 WP_000126349.1.94674 WP_000126349.1.94717 WP_000126349.1.94796 WP_000126349.1.94817 WP_000126349.1.94835 WP_000126349.1.94959 WP_000126349.1.94983 WP_000126349.1.95051 WP_000126349.1.95085 WP_000126349.1.95121 WP_000126349.1.95136 WP_000126349.1.95248 WP_000126349.1.9527 WP_000126349.1.95277 WP_000126349.1.95282 WP_000126349.1.95289 WP_000126349.1.95298 WP_000126349.1.95388 WP_000126349.1.95434 WP_000126349.1.95447 WP_000126349.1.95456 WP_000126349.1.95546 WP_000126349.1.95558 WP_000126349.1.95607 WP_000126349.1.95623 WP_000126349.1.95630 WP_000126349.1.95656 WP_000126349.1.95670 WP_000126349.1.95691 WP_000126349.1.95729 WP_000126349.1.95757 WP_000126349.1.95840 WP_000126349.1.9586 WP_000126349.1.95866 WP_000126349.1.95911 WP_000126349.1.95939 WP_000126349.1.95963 WP_000126349.1.96004 WP_000126349.1.96042 WP_000126349.1.9609 WP_000126349.1.96107 WP_000126349.1.96139 WP_000126349.1.96162 WP_000126349.1.96203 WP_000126349.1.9624 WP_000126349.1.9627 WP_000126349.1.96317 WP_000126349.1.96340 WP_000126349.1.96343 WP_000126349.1.96348 WP_000126349.1.96349 WP_000126349.1.96380 WP_000126349.1.96404 WP_000126349.1.9644 WP_000126349.1.96469 WP_000126349.1.96490 WP_000126349.1.96497 WP_000126349.1.96500 WP_000126349.1.96521 WP_000126349.1.96537 WP_000126349.1.96555 WP_000126349.1.96563 WP_000126349.1.96584 WP_000126349.1.96588 WP_000126349.1.96642 WP_000126349.1.96732 WP_000126349.1.96735 WP_000126349.1.9674 WP_000126349.1.96771 WP_000126349.1.96876 WP_000126349.1.96993 WP_000126349.1.97015 WP_000126349.1.97047 WP_000126349.1.97103 WP_000126349.1.97143 WP_000126349.1.97145 WP_000126349.1.97185 WP_000126349.1.97297 WP_000126349.1.97318 WP_000126349.1.97322 WP_000126349.1.97328 WP_000126349.1.97369 WP_000126349.1.97477 WP_000126349.1.97487 WP_000126349.1.97547 WP_000126349.1.97594 WP_000126349.1.97597 WP_000126349.1.97613 WP_000126349.1.97620 WP_000126349.1.97631 WP_000126349.1.97648 WP_000126349.1.97656 WP_000126349.1.97704 WP_000126349.1.97727 WP_000126349.1.97732 WP_000126349.1.97736 WP_000126349.1.9774 WP_000126349.1.9775 WP_000126349.1.97800 WP_000126349.1.97846 WP_000126349.1.97907 WP_000126349.1.9793 WP_000126349.1.97981 WP_000126349.1.9799 WP_000126349.1.97991 WP_000126349.1.98006 WP_000126349.1.98019 WP_000126349.1.98022 WP_000126349.1.98110 WP_000126349.1.98119 WP_000126349.1.98146 WP_000126349.1.98219 WP_000126349.1.9826 WP_000126349.1.98338 WP_000126349.1.9841 WP_000126349.1.98440 WP_000126349.1.98472 WP_000126349.1.98495 WP_000126349.1.98531 WP_000126349.1.98570 WP_000126349.1.98577 WP_000126349.1.9863 WP_000126349.1.98676 WP_000126349.1.98677 WP_000126349.1.98726 WP_000126349.1.98760 WP_000126349.1.98843 WP_000126349.1.9898 WP_000126349.1.9899 WP_000126349.1.99057 WP_000126349.1.99072 WP_000126349.1.99097 WP_000126349.1.99098 WP_000126349.1.99164 WP_000126349.1.99184 WP_000126349.1.99215 WP_000126349.1.99267 WP_000126349.1.99276 WP_000126349.1.99278 WP_000126349.1.99456 WP_000126349.1.99469 WP_000126349.1.99490 WP_000126349.1.99493 WP_000126349.1.99577 WP_000126349.1.99613 WP_000126349.1.99626 WP_000126349.1.99630 WP_000126349.1.99646 WP_000126349.1.99657 WP_000126349.1.99660 WP_000126349.1.99712 WP_000126349.1.99783 WP_000126349.1.99813 WP_000126349.1.99858 WP_000126349.1.99889 WP_000126349.1.99924 WP_000126349.1.99958 WP_000126349.1.99961 gi|386591906|ref|YP_006088306.1| gi|525817981|ref|YP_008247999.1| gi|525829832|ref|YP_008253012.1| gi|482903906|ref|YP_007902466.1| gi|452119714|ref|YP_007469962.1| gi|526220678|ref|YP_008266341.1| gi|525837775|ref|YP_008254654.1| gi|550901529|ref|YP_008670621.1| gi|378445526|ref|YP_005233158.1| gi|379701314|ref|YP_005243042.1| gi|198242191|ref|YP_002216178.1| gi|549724756|ref|YP_008644946.1| gi|161613230|ref|YP_001587195.1| gi|194734744|ref|YP_002115179.1| gi|378989478|ref|YP_005252642.1| gi|383496800|ref|YP_005397489.1| gi|197249825|ref|YP_002147048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]