SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482904111|ref|YP_007902671.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482904111|ref|YP_007902671.1|
Domain Number 1 Region: 4-376
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.61e-115
Family GABA-aminotransferase-like 0.00000000000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|482904111|ref|YP_007902671.1|
Sequence length 379
Comment UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MSDFLPFSRPAMGAEELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAG
MHIALMALGIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVDRDTLMVTPEHIEAAITP
QTKAIIPVHYAGAPADLDAIYALGERYGIPVIEDAAHATGTSYKGRHIGARGTAIFSFHA
IKNITCAEGGIVVTDNPQFADKLRSLKFHGLGVDAWDRQSGGRAPQAEVLAPGYKYNLPD
LNAAIALAQLQKLDALNARRAAIAAQYHQAMADLPFQPLSLPSWEHIHAWHLFIIRVDEA
RCGITRDALMASLKTKGIGTGLHFRAAHTQKYYRERFPTLTLPDTEWNSERICSLPLFPD
MTESDFDRVITALHQIAGQ
Download sequence
Identical sequences A0A0D6FBT5 A0A0F6B434 A0A0F7DJ16 A0A0M0PW63 A0A0R9N669 A0A0U1GTY7 A0A2D3AE40 B4SYW9 B4TBG4 C0Q071 V1VVF1
gi|386592107|ref|YP_006088507.1| gi|525829661|ref|YP_008252812.1| gi|525818187|ref|YP_008248205.1| gi|549479941|ref|YP_008614067.1| gi|378984859|ref|YP_005248014.1| gi|525837603|ref|YP_008254452.1| ABEL01000004|CDS_309619-310758 ABFH02000001|CDS_2726588-2725449 CP001363|CDS_2455524-2456663 WP_001279284.1.100007 WP_001279284.1.12047 WP_001279284.1.20023 WP_001279284.1.31086 WP_001279284.1.63903 WP_001279284.1.68147 WP_001279284.1.685 WP_001279284.1.78715 WP_001279284.1.81743 WP_001279284.1.98438 gi|378451012|ref|YP_005238371.1| gi|482904111|ref|YP_007902671.1| 99287.STM2297 gi|161353593|ref|NP_461239.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]