SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482904146|ref|YP_007902706.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482904146|ref|YP_007902706.1|
Domain Number 1 Region: 7-401
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.66e-96
Family AAT-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|482904146|ref|YP_007902706.1|
Sequence length 404
Comment aminotransferase AlaT [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVNIAREHNLIIFADEIYDKILYDDAEHHSIAALAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
LPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPRIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPREDDLEMAINRFGRFLSGYHQ
Download sequence
Identical sequences A0A0F6B472 A0A0F7J8J7 A0A0H2WMG4 A0A0H3BT63 A0A0H3NFC0 A0A0J5ECV0 A0A0L3JCL9 A0A0M0PIU2 A0A0N1QSM0 A0A0R9MVH4 A0A0T9XZH2 A0A0U1F4P5 A0A1C2ZTH1 A0A1R2LIB0 A0A1S0ZLX0 A0A1S1AI43 A0A1X2RKB7 A0A1X2UMN2 A0A1X2Y3C4 A0A1Z3PZL4 A0A221YN33 A0A221YXV1 A0A265B862 A0A267SD61 A0A271CGY9 A0A271CTJ3 A0A2C6GCP6 A0A2D1XPP0 A0A2D1Y3K1 A0A2D3TTZ8 A0A2G1NPX9 A0A2H9YGM0 A0A2I6M5Z0 A0A2I6MJC3 A0A2I6MXF0 A0A2I6NBG5 A0A2I6NP60 A0A2I6P209 A0A2K2ZTS5 B5EZL3 C0Q035 E8XEY4 G4C1K6 G5LBX8 G5LRG8 G5NFS3 G5PQJ1 G5Q5B2 G5QLN4 G5R2U7 G5RI80 G5RY69 G5SEJ2 M7RDH2 Q57M24 Q7CQ47 Q8XGH1 S4IDL6 V1HXT9 V1WTS3 V7UHT9
ABAK02000001|CDS_1843329-1844543 ABAM02000001|CDS_2901118-2902332 ABAN01000002|CDS_310268-309054 ABAO01000045|CDS_17575-18789 ABEH02000005|CDS_348094-349308 ABEI01000001|CDS_362810-364024 ABEJ01000010|CDS_70865-72079 ABEL01000004|CDS_344839-346053 ABEW01000006|CDS_89826-88612 ABFF01000001|CDS_191984-190770 ABFG01000004|CDS_293298-292084 ABFH02000001|CDS_2691131-2689917 AE006468|CDS_2441995-2443209 AE014613|CDS_607694-606480 AE017220|CDS_2456392-2457606 AL513382|CDS_2397018-2398232 AM933172|CDS_2436047-2437261 CP000026|CDS_605927-604713 CP000857|CDS_1438232-1437018 CP000886|CDS_603736-602522 CP001113|CDS_2440953-2442167 CP001120|CDS_2486753-2487967 CP001127|CDS_2445094-2446308 CP001138|CDS_2403676-2404890 CP001363|CDS_2493547-2494761 FM200053|CDS_605961-604747 FN424405|CDS_2465661-2466875 NZ_ACBF01000012|CDS_102491-101277 gi|194450325|ref|YP_002046385.1| gi|194445955|ref|YP_002041592.1| gi|550901765|ref|YP_008670857.1| gi|378445758|ref|YP_005233390.1| gi|62180902|ref|YP_217319.1| gi|383497032|ref|YP_005397721.1| NP_456873.1.84458 NP_461273.1.58477 WP_000074540.1.100002 WP_000074540.1.100007 WP_000074540.1.100008 WP_000074540.1.100010 WP_000074540.1.100017 WP_000074540.1.100031 WP_000074540.1.100036 WP_000074540.1.100077 WP_000074540.1.100079 WP_000074540.1.100115 WP_000074540.1.100129 WP_000074540.1.10013 WP_000074540.1.100137 WP_000074540.1.100149 WP_000074540.1.100165 WP_000074540.1.100191 WP_000074540.1.100196 WP_000074540.1.1002 WP_000074540.1.100234 WP_000074540.1.100258 WP_000074540.1.100266 WP_000074540.1.100284 WP_000074540.1.100288 WP_000074540.1.100313 WP_000074540.1.100314 WP_000074540.1.100321 WP_000074540.1.100354 WP_000074540.1.100376 WP_000074540.1.100392 WP_000074540.1.100412 WP_000074540.1.100413 WP_000074540.1.100421 WP_000074540.1.100424 WP_000074540.1.100432 WP_000074540.1.100436 WP_000074540.1.100438 WP_000074540.1.100446 WP_000074540.1.100450 WP_000074540.1.100457 WP_000074540.1.100472 WP_000074540.1.100484 WP_000074540.1.100488 WP_000074540.1.100502 WP_000074540.1.100519 WP_000074540.1.100521 WP_000074540.1.100557 WP_000074540.1.100584 WP_000074540.1.100589 WP_000074540.1.100592 WP_000074540.1.100597 WP_000074540.1.100605 WP_000074540.1.100610 WP_000074540.1.100642 WP_000074540.1.10065 WP_000074540.1.100650 WP_000074540.1.100707 WP_000074540.1.100711 WP_000074540.1.100714 WP_000074540.1.100721 WP_000074540.1.100730 WP_000074540.1.100732 WP_000074540.1.100733 WP_000074540.1.100739 WP_000074540.1.10074 WP_000074540.1.100750 WP_000074540.1.10076 WP_000074540.1.100764 WP_000074540.1.100773 WP_000074540.1.100776 WP_000074540.1.100781 WP_000074540.1.100790 WP_000074540.1.100793 WP_000074540.1.100799 WP_000074540.1.10081 WP_000074540.1.100814 WP_000074540.1.100857 WP_000074540.1.100865 WP_000074540.1.100869 WP_000074540.1.100870 WP_000074540.1.100871 WP_000074540.1.100882 WP_000074540.1.100886 WP_000074540.1.100895 WP_000074540.1.100932 WP_000074540.1.100941 WP_000074540.1.100944 WP_000074540.1.100948 WP_000074540.1.100953 WP_000074540.1.101007 WP_000074540.1.101011 WP_000074540.1.101020 WP_000074540.1.101042 WP_000074540.1.101074 WP_000074540.1.101078 WP_000074540.1.10108 WP_000074540.1.101091 WP_000074540.1.101094 WP_000074540.1.101111 WP_000074540.1.101112 WP_000074540.1.101123 WP_000074540.1.101126 WP_000074540.1.101147 WP_000074540.1.101180 WP_000074540.1.101199 WP_000074540.1.101226 WP_000074540.1.101239 WP_000074540.1.10124 WP_000074540.1.101259 WP_000074540.1.101271 WP_000074540.1.101284 WP_000074540.1.101291 WP_000074540.1.1013 WP_000074540.1.101312 WP_000074540.1.101320 WP_000074540.1.101322 WP_000074540.1.101353 WP_000074540.1.101374 WP_000074540.1.101386 WP_000074540.1.101404 WP_000074540.1.101420 WP_000074540.1.101425 WP_000074540.1.101454 WP_000074540.1.101473 WP_000074540.1.101519 WP_000074540.1.101520 WP_000074540.1.101541 WP_000074540.1.101589 WP_000074540.1.101609 WP_000074540.1.101612 WP_000074540.1.101616 WP_000074540.1.101634 WP_000074540.1.101636 WP_000074540.1.101639 WP_000074540.1.10164 WP_000074540.1.101666 WP_000074540.1.101674 WP_000074540.1.101707 WP_000074540.1.101724 WP_000074540.1.101734 WP_000074540.1.101740 WP_000074540.1.101741 WP_000074540.1.101744 WP_000074540.1.101759 WP_000074540.1.10177 WP_000074540.1.101776 WP_000074540.1.101815 WP_000074540.1.101832 WP_000074540.1.101839 WP_000074540.1.101841 WP_000074540.1.101868 WP_000074540.1.101878 WP_000074540.1.101890 WP_000074540.1.101904 WP_000074540.1.10191 WP_000074540.1.101917 WP_000074540.1.101927 WP_000074540.1.101941 WP_000074540.1.101949 WP_000074540.1.101953 WP_000074540.1.101975 WP_000074540.1.102009 WP_000074540.1.102050 WP_000074540.1.102087 WP_000074540.1.102103 WP_000074540.1.102111 WP_000074540.1.10220 WP_000074540.1.10231 WP_000074540.1.10237 WP_000074540.1.10266 WP_000074540.1.10276 WP_000074540.1.10293 WP_000074540.1.10300 WP_000074540.1.10310 WP_000074540.1.10338 WP_000074540.1.1038 WP_000074540.1.10394 WP_000074540.1.104 WP_000074540.1.10401 WP_000074540.1.10428 WP_000074540.1.10429 WP_000074540.1.10439 WP_000074540.1.10459 WP_000074540.1.10463 WP_000074540.1.10465 WP_000074540.1.10475 WP_000074540.1.10498 WP_000074540.1.10511 WP_000074540.1.10514 WP_000074540.1.10521 WP_000074540.1.10530 WP_000074540.1.10532 WP_000074540.1.10547 WP_000074540.1.10562 WP_000074540.1.10566 WP_000074540.1.10568 WP_000074540.1.10595 WP_000074540.1.106 WP_000074540.1.10631 WP_000074540.1.10642 WP_000074540.1.10654 WP_000074540.1.10675 WP_000074540.1.10677 WP_000074540.1.10678 WP_000074540.1.10711 WP_000074540.1.10720 WP_000074540.1.10753 WP_000074540.1.10755 WP_000074540.1.10797 WP_000074540.1.10857 WP_000074540.1.10868 WP_000074540.1.10873 WP_000074540.1.10898 WP_000074540.1.10926 WP_000074540.1.10936 WP_000074540.1.10992 WP_000074540.1.11000 WP_000074540.1.11012 WP_000074540.1.11024 WP_000074540.1.11031 WP_000074540.1.11041 WP_000074540.1.11055 WP_000074540.1.11098 WP_000074540.1.1110 WP_000074540.1.11119 WP_000074540.1.11126 WP_000074540.1.11142 WP_000074540.1.11156 WP_000074540.1.11168 WP_000074540.1.11213 WP_000074540.1.11216 WP_000074540.1.11239 WP_000074540.1.11253 WP_000074540.1.11254 WP_000074540.1.11295 WP_000074540.1.113 WP_000074540.1.11304 WP_000074540.1.11314 WP_000074540.1.1135 WP_000074540.1.11362 WP_000074540.1.11369 WP_000074540.1.1137 WP_000074540.1.11385 WP_000074540.1.11405 WP_000074540.1.1142 WP_000074540.1.11426 WP_000074540.1.11429 WP_000074540.1.11444 WP_000074540.1.11455 WP_000074540.1.11458 WP_000074540.1.11479 WP_000074540.1.1150 WP_000074540.1.11511 WP_000074540.1.11518 WP_000074540.1.11526 WP_000074540.1.11528 WP_000074540.1.11532 WP_000074540.1.11543 WP_000074540.1.11544 WP_000074540.1.11557 WP_000074540.1.1156 WP_000074540.1.11567 WP_000074540.1.11588 WP_000074540.1.11603 WP_000074540.1.11638 WP_000074540.1.11677 WP_000074540.1.11681 WP_000074540.1.11687 WP_000074540.1.1169 WP_000074540.1.11735 WP_000074540.1.1174 WP_000074540.1.11763 WP_000074540.1.11772 WP_000074540.1.11810 WP_000074540.1.11824 WP_000074540.1.11834 WP_000074540.1.11841 WP_000074540.1.11865 WP_000074540.1.11868 WP_000074540.1.11875 WP_000074540.1.11883 WP_000074540.1.11897 WP_000074540.1.11900 WP_000074540.1.11908 WP_000074540.1.11914 WP_000074540.1.11936 WP_000074540.1.11938 WP_000074540.1.11964 WP_000074540.1.11978 WP_000074540.1.12007 WP_000074540.1.12017 WP_000074540.1.12025 WP_000074540.1.12027 WP_000074540.1.12040 WP_000074540.1.12047 WP_000074540.1.12059 WP_000074540.1.12061 WP_000074540.1.12063 WP_000074540.1.1207 WP_000074540.1.12106 WP_000074540.1.12114 WP_000074540.1.12141 WP_000074540.1.12144 WP_000074540.1.1215 WP_000074540.1.12159 WP_000074540.1.12160 WP_000074540.1.12168 WP_000074540.1.12172 WP_000074540.1.12192 WP_000074540.1.12210 WP_000074540.1.1224 WP_000074540.1.12244 WP_000074540.1.12280 WP_000074540.1.12282 WP_000074540.1.12308 WP_000074540.1.12340 WP_000074540.1.12351 WP_000074540.1.12364 WP_000074540.1.12370 WP_000074540.1.12374 WP_000074540.1.1239 WP_000074540.1.12396 WP_000074540.1.12397 WP_000074540.1.12398 WP_000074540.1.12441 WP_000074540.1.12456 WP_000074540.1.1246 WP_000074540.1.12472 WP_000074540.1.12484 WP_000074540.1.12485 WP_000074540.1.1250 WP_000074540.1.12546 WP_000074540.1.12568 WP_000074540.1.12569 WP_000074540.1.12581 WP_000074540.1.12584 WP_000074540.1.12585 WP_000074540.1.1264 WP_000074540.1.12648 WP_000074540.1.12650 WP_000074540.1.12683 WP_000074540.1.12696 WP_000074540.1.12701 WP_000074540.1.12718 WP_000074540.1.12726 WP_000074540.1.12727 WP_000074540.1.12728 WP_000074540.1.12741 WP_000074540.1.12834 WP_000074540.1.12864 WP_000074540.1.12865 WP_000074540.1.12877 WP_000074540.1.12879 WP_000074540.1.12936 WP_000074540.1.1299 WP_000074540.1.12995 WP_000074540.1.1300 WP_000074540.1.13027 WP_000074540.1.13076 WP_000074540.1.13101 WP_000074540.1.13102 WP_000074540.1.13106 WP_000074540.1.13108 WP_000074540.1.13130 WP_000074540.1.13161 WP_000074540.1.13207 WP_000074540.1.1321 WP_000074540.1.13247 WP_000074540.1.1326 WP_000074540.1.13262 WP_000074540.1.13268 WP_000074540.1.13274 WP_000074540.1.13291 WP_000074540.1.133 WP_000074540.1.13311 WP_000074540.1.13314 WP_000074540.1.13334 WP_000074540.1.13338 WP_000074540.1.13342 WP_000074540.1.13352 WP_000074540.1.13367 WP_000074540.1.13391 WP_000074540.1.13406 WP_000074540.1.13414 WP_000074540.1.13429 WP_000074540.1.13440 WP_000074540.1.13443 WP_000074540.1.13446 WP_000074540.1.1346 WP_000074540.1.13476 WP_000074540.1.13488 WP_000074540.1.13509 WP_000074540.1.13528 WP_000074540.1.13543 WP_000074540.1.13573 WP_000074540.1.13599 WP_000074540.1.13602 WP_000074540.1.13625 WP_000074540.1.13661 WP_000074540.1.13669 WP_000074540.1.13677 WP_000074540.1.13686 WP_000074540.1.13691 WP_000074540.1.1372 WP_000074540.1.13732 WP_000074540.1.13741 WP_000074540.1.13750 WP_000074540.1.13764 WP_000074540.1.13799 WP_000074540.1.13819 WP_000074540.1.1382 WP_000074540.1.13827 WP_000074540.1.13829 WP_000074540.1.13848 WP_000074540.1.13857 WP_000074540.1.1387 WP_000074540.1.13908 WP_000074540.1.13932 WP_000074540.1.13967 WP_000074540.1.13968 WP_000074540.1.1397 WP_000074540.1.13972 WP_000074540.1.140 WP_000074540.1.14001 WP_000074540.1.1401 WP_000074540.1.14011 WP_000074540.1.14041 WP_000074540.1.14050 WP_000074540.1.14056 WP_000074540.1.1408 WP_000074540.1.14089 WP_000074540.1.14099 WP_000074540.1.14111 WP_000074540.1.1412 WP_000074540.1.14120 WP_000074540.1.14123 WP_000074540.1.14150 WP_000074540.1.14151 WP_000074540.1.14191 WP_000074540.1.14197 WP_000074540.1.14239 WP_000074540.1.14280 WP_000074540.1.14286 WP_000074540.1.14296 WP_000074540.1.14320 WP_000074540.1.14333 WP_000074540.1.14369 WP_000074540.1.14379 WP_000074540.1.14399 WP_000074540.1.1440 WP_000074540.1.14406 WP_000074540.1.14410 WP_000074540.1.14436 WP_000074540.1.14444 WP_000074540.1.14446 WP_000074540.1.14458 WP_000074540.1.14466 WP_000074540.1.14467 WP_000074540.1.14474 WP_000074540.1.14495 WP_000074540.1.14500 WP_000074540.1.14505 WP_000074540.1.14516 WP_000074540.1.14519 WP_000074540.1.14524 WP_000074540.1.14526 WP_000074540.1.14528 WP_000074540.1.14550 WP_000074540.1.14554 WP_000074540.1.14575 WP_000074540.1.146 WP_000074540.1.14618 WP_000074540.1.14688 WP_000074540.1.14701 WP_000074540.1.14703 WP_000074540.1.14706 WP_000074540.1.14708 WP_000074540.1.14719 WP_000074540.1.14725 WP_000074540.1.1473 WP_000074540.1.14737 WP_000074540.1.14765 WP_000074540.1.14789 WP_000074540.1.14793 WP_000074540.1.14808 WP_000074540.1.14810 WP_000074540.1.14819 WP_000074540.1.14852 WP_000074540.1.14876 WP_000074540.1.14877 WP_000074540.1.14884 WP_000074540.1.1489 WP_000074540.1.14894 WP_000074540.1.14913 WP_000074540.1.14917 WP_000074540.1.14927 WP_000074540.1.14930 WP_000074540.1.14932 WP_000074540.1.14936 WP_000074540.1.14947 WP_000074540.1.14948 WP_000074540.1.14964 WP_000074540.1.15011 WP_000074540.1.15046 WP_000074540.1.15054 WP_000074540.1.15055 WP_000074540.1.15059 WP_000074540.1.15067 WP_000074540.1.15079 WP_000074540.1.15100 WP_000074540.1.15102 WP_000074540.1.15124 WP_000074540.1.15184 WP_000074540.1.15214 WP_000074540.1.15223 WP_000074540.1.15226 WP_000074540.1.15244 WP_000074540.1.15265 WP_000074540.1.15276 WP_000074540.1.15316 WP_000074540.1.15318 WP_000074540.1.15362 WP_000074540.1.15369 WP_000074540.1.1540 WP_000074540.1.15415 WP_000074540.1.15423 WP_000074540.1.15433 WP_000074540.1.15439 WP_000074540.1.15468 WP_000074540.1.15479 WP_000074540.1.15483 WP_000074540.1.15487 WP_000074540.1.15508 WP_000074540.1.1551 WP_000074540.1.15535 WP_000074540.1.15581 WP_000074540.1.15585 WP_000074540.1.15586 WP_000074540.1.15597 WP_000074540.1.15612 WP_000074540.1.15616 WP_000074540.1.15625 WP_000074540.1.15627 WP_000074540.1.15637 WP_000074540.1.15644 WP_000074540.1.1568 WP_000074540.1.15708 WP_000074540.1.15710 WP_000074540.1.15717 WP_000074540.1.15775 WP_000074540.1.15777 WP_000074540.1.15795 WP_000074540.1.158 WP_000074540.1.15830 WP_000074540.1.15835 WP_000074540.1.15862 WP_000074540.1.15881 WP_000074540.1.15905 WP_000074540.1.15909 WP_000074540.1.15910 WP_000074540.1.15912 WP_000074540.1.1592 WP_000074540.1.15922 WP_000074540.1.15938 WP_000074540.1.15970 WP_000074540.1.15978 WP_000074540.1.15986 WP_000074540.1.15995 WP_000074540.1.16000 WP_000074540.1.16004 WP_000074540.1.16006 WP_000074540.1.1601 WP_000074540.1.16032 WP_000074540.1.16046 WP_000074540.1.16047 WP_000074540.1.16051 WP_000074540.1.16058 WP_000074540.1.16062 WP_000074540.1.16063 WP_000074540.1.16103 WP_000074540.1.1611 WP_000074540.1.16125 WP_000074540.1.16150 WP_000074540.1.16155 WP_000074540.1.16158 WP_000074540.1.16166 WP_000074540.1.16172 WP_000074540.1.16201 WP_000074540.1.16226 WP_000074540.1.16233 WP_000074540.1.1626 WP_000074540.1.16264 WP_000074540.1.16273 WP_000074540.1.16284 WP_000074540.1.16328 WP_000074540.1.16331 WP_000074540.1.16344 WP_000074540.1.1635 WP_000074540.1.16361 WP_000074540.1.16363 WP_000074540.1.16365 WP_000074540.1.16366 WP_000074540.1.16394 WP_000074540.1.16452 WP_000074540.1.16453 WP_000074540.1.16461 WP_000074540.1.16462 WP_000074540.1.16465 WP_000074540.1.16468 WP_000074540.1.16474 WP_000074540.1.16508 WP_000074540.1.16522 WP_000074540.1.16551 WP_000074540.1.16581 WP_000074540.1.16588 WP_000074540.1.16614 WP_000074540.1.16650 WP_000074540.1.16656 WP_000074540.1.16658 WP_000074540.1.16666 WP_000074540.1.16673 WP_000074540.1.1668 WP_000074540.1.16686 WP_000074540.1.16691 WP_000074540.1.167 WP_000074540.1.16710 WP_000074540.1.16729 WP_000074540.1.16732 WP_000074540.1.16735 WP_000074540.1.16736 WP_000074540.1.1674 WP_000074540.1.16767 WP_000074540.1.16781 WP_000074540.1.16786 WP_000074540.1.16804 WP_000074540.1.16817 WP_000074540.1.16819 WP_000074540.1.16826 WP_000074540.1.16846 WP_000074540.1.16855 WP_000074540.1.16858 WP_000074540.1.16873 WP_000074540.1.16879 WP_000074540.1.1689 WP_000074540.1.16893 WP_000074540.1.16896 WP_000074540.1.16903 WP_000074540.1.16905 WP_000074540.1.16910 WP_000074540.1.16941 WP_000074540.1.16942 WP_000074540.1.16944 WP_000074540.1.16948 WP_000074540.1.16949 WP_000074540.1.16965 WP_000074540.1.16972 WP_000074540.1.16998 WP_000074540.1.1700 WP_000074540.1.17031 WP_000074540.1.17049 WP_000074540.1.17058 WP_000074540.1.17060 WP_000074540.1.17078 WP_000074540.1.17093 WP_000074540.1.17096 WP_000074540.1.17098 WP_000074540.1.17105 WP_000074540.1.17188 WP_000074540.1.17202 WP_000074540.1.17219 WP_000074540.1.1722 WP_000074540.1.17270 WP_000074540.1.17285 WP_000074540.1.17302 WP_000074540.1.17307 WP_000074540.1.17308 WP_000074540.1.1733 WP_000074540.1.17368 WP_000074540.1.1737 WP_000074540.1.17390 WP_000074540.1.174 WP_000074540.1.17405 WP_000074540.1.17406 WP_000074540.1.17439 WP_000074540.1.17447 WP_000074540.1.17480 WP_000074540.1.17482 WP_000074540.1.1749 WP_000074540.1.17504 WP_000074540.1.17513 WP_000074540.1.17525 WP_000074540.1.17543 WP_000074540.1.17546 WP_000074540.1.17560 WP_000074540.1.17563 WP_000074540.1.1757 WP_000074540.1.17578 WP_000074540.1.17583 WP_000074540.1.17622 WP_000074540.1.17659 WP_000074540.1.17667 WP_000074540.1.17686 WP_000074540.1.17693 WP_000074540.1.17702 WP_000074540.1.17703 WP_000074540.1.17705 WP_000074540.1.17732 WP_000074540.1.17741 WP_000074540.1.17743 WP_000074540.1.17747 WP_000074540.1.17755 WP_000074540.1.17758 WP_000074540.1.17840 WP_000074540.1.17865 WP_000074540.1.17886 WP_000074540.1.17891 WP_000074540.1.17901 WP_000074540.1.17914 WP_000074540.1.17919 WP_000074540.1.17936 WP_000074540.1.17956 WP_000074540.1.1798 WP_000074540.1.17991 WP_000074540.1.18005 WP_000074540.1.1801 WP_000074540.1.18019 WP_000074540.1.18021 WP_000074540.1.18056 WP_000074540.1.18061 WP_000074540.1.1807 WP_000074540.1.18089 WP_000074540.1.18092 WP_000074540.1.18099 WP_000074540.1.18103 WP_000074540.1.18109 WP_000074540.1.18111 WP_000074540.1.18122 WP_000074540.1.18124 WP_000074540.1.1814 WP_000074540.1.18144 WP_000074540.1.18149 WP_000074540.1.18163 WP_000074540.1.18173 WP_000074540.1.18177 WP_000074540.1.1818 WP_000074540.1.18192 WP_000074540.1.18249 WP_000074540.1.1825 WP_000074540.1.18254 WP_000074540.1.18265 WP_000074540.1.18267 WP_000074540.1.18270 WP_000074540.1.18277 WP_000074540.1.18280 WP_000074540.1.18281 WP_000074540.1.18282 WP_000074540.1.18328 WP_000074540.1.18355 WP_000074540.1.18358 WP_000074540.1.18365 WP_000074540.1.18370 WP_000074540.1.18384 WP_000074540.1.18406 WP_000074540.1.18426 WP_000074540.1.18441 WP_000074540.1.18445 WP_000074540.1.18468 WP_000074540.1.18474 WP_000074540.1.18485 WP_000074540.1.18489 WP_000074540.1.18513 WP_000074540.1.18607 WP_000074540.1.18610 WP_000074540.1.18641 WP_000074540.1.18678 WP_000074540.1.18686 WP_000074540.1.18692 WP_000074540.1.18705 WP_000074540.1.18715 WP_000074540.1.18722 WP_000074540.1.18737 WP_000074540.1.18766 WP_000074540.1.18776 WP_000074540.1.1880 WP_000074540.1.18822 WP_000074540.1.18847 WP_000074540.1.1885 WP_000074540.1.18860 WP_000074540.1.18881 WP_000074540.1.18886 WP_000074540.1.18895 WP_000074540.1.18922 WP_000074540.1.18940 WP_000074540.1.18949 WP_000074540.1.1895 WP_000074540.1.18959 WP_000074540.1.1897 WP_000074540.1.18972 WP_000074540.1.19001 WP_000074540.1.19006 WP_000074540.1.19030 WP_000074540.1.19038 WP_000074540.1.19044 WP_000074540.1.19053 WP_000074540.1.19055 WP_000074540.1.19064 WP_000074540.1.19084 WP_000074540.1.19093 WP_000074540.1.19163 WP_000074540.1.19174 WP_000074540.1.19187 WP_000074540.1.19228 WP_000074540.1.19240 WP_000074540.1.19273 WP_000074540.1.19288 WP_000074540.1.19291 WP_000074540.1.19300 WP_000074540.1.19320 WP_000074540.1.1935 WP_000074540.1.19357 WP_000074540.1.19373 WP_000074540.1.1939 WP_000074540.1.19405 WP_000074540.1.19422 WP_000074540.1.19433 WP_000074540.1.19454 WP_000074540.1.19456 WP_000074540.1.19458 WP_000074540.1.19460 WP_000074540.1.19461 WP_000074540.1.19469 WP_000074540.1.19496 WP_000074540.1.19535 WP_000074540.1.19538 WP_000074540.1.1954 WP_000074540.1.1955 WP_000074540.1.19588 WP_000074540.1.19589 WP_000074540.1.19614 WP_000074540.1.19616 WP_000074540.1.19642 WP_000074540.1.19656 WP_000074540.1.19660 WP_000074540.1.19663 WP_000074540.1.1968 WP_000074540.1.19683 WP_000074540.1.19686 WP_000074540.1.19702 WP_000074540.1.19706 WP_000074540.1.19723 WP_000074540.1.19724 WP_000074540.1.19731 WP_000074540.1.19740 WP_000074540.1.19749 WP_000074540.1.19784 WP_000074540.1.19793 WP_000074540.1.19794 WP_000074540.1.19802 WP_000074540.1.19809 WP_000074540.1.19823 WP_000074540.1.19834 WP_000074540.1.19851 WP_000074540.1.19863 WP_000074540.1.19867 WP_000074540.1.19882 WP_000074540.1.19884 WP_000074540.1.1990 WP_000074540.1.1992 WP_000074540.1.19967 WP_000074540.1.19970 WP_000074540.1.19975 WP_000074540.1.1998 WP_000074540.1.19987 WP_000074540.1.19999 WP_000074540.1.20 WP_000074540.1.20023 WP_000074540.1.20034 WP_000074540.1.20081 WP_000074540.1.20086 WP_000074540.1.20091 WP_000074540.1.2010 WP_000074540.1.20119 WP_000074540.1.20212 WP_000074540.1.20218 WP_000074540.1.20254 WP_000074540.1.20255 WP_000074540.1.2026 WP_000074540.1.20261 WP_000074540.1.20266 WP_000074540.1.20271 WP_000074540.1.20296 WP_000074540.1.20330 WP_000074540.1.20339 WP_000074540.1.20349 WP_000074540.1.2036 WP_000074540.1.20362 WP_000074540.1.20364 WP_000074540.1.20376 WP_000074540.1.20391 WP_000074540.1.2041 WP_000074540.1.20415 WP_000074540.1.20418 WP_000074540.1.20419 WP_000074540.1.20425 WP_000074540.1.20437 WP_000074540.1.20443 WP_000074540.1.20446 WP_000074540.1.20465 WP_000074540.1.20488 WP_000074540.1.20492 WP_000074540.1.20503 WP_000074540.1.20525 WP_000074540.1.2053 WP_000074540.1.2054 WP_000074540.1.20553 WP_000074540.1.20564 WP_000074540.1.20573 WP_000074540.1.20614 WP_000074540.1.20626 WP_000074540.1.20631 WP_000074540.1.20635 WP_000074540.1.20646 WP_000074540.1.20695 WP_000074540.1.20700 WP_000074540.1.20718 WP_000074540.1.20721 WP_000074540.1.2073 WP_000074540.1.20740 WP_000074540.1.20760 WP_000074540.1.20767 WP_000074540.1.20787 WP_000074540.1.20810 WP_000074540.1.20828 WP_000074540.1.20839 WP_000074540.1.20862 WP_000074540.1.2087 WP_000074540.1.20883 WP_000074540.1.20886 WP_000074540.1.20894 WP_000074540.1.20900 WP_000074540.1.20908 WP_000074540.1.2091 WP_000074540.1.20947 WP_000074540.1.20953 WP_000074540.1.2101 WP_000074540.1.21010 WP_000074540.1.21049 WP_000074540.1.2106 WP_000074540.1.21062 WP_000074540.1.2107 WP_000074540.1.21075 WP_000074540.1.21079 WP_000074540.1.21086 WP_000074540.1.21089 WP_000074540.1.21103 WP_000074540.1.21136 WP_000074540.1.21144 WP_000074540.1.21146 WP_000074540.1.2116 WP_000074540.1.21162 WP_000074540.1.21165 WP_000074540.1.21181 WP_000074540.1.21184 WP_000074540.1.21185 WP_000074540.1.21194 WP_000074540.1.21202 WP_000074540.1.21241 WP_000074540.1.21245 WP_000074540.1.21246 WP_000074540.1.21260 WP_000074540.1.21269 WP_000074540.1.21286 WP_000074540.1.2130 WP_000074540.1.21309 WP_000074540.1.21326 WP_000074540.1.21332 WP_000074540.1.21351 WP_000074540.1.21362 WP_000074540.1.21366 WP_000074540.1.2139 WP_000074540.1.21399 WP_000074540.1.21400 WP_000074540.1.21404 WP_000074540.1.21423 WP_000074540.1.21443 WP_000074540.1.21453 WP_000074540.1.2146 WP_000074540.1.21473 WP_000074540.1.21492 WP_000074540.1.21497 WP_000074540.1.21499 WP_000074540.1.21534 WP_000074540.1.21548 WP_000074540.1.21603 WP_000074540.1.21616 WP_000074540.1.2166 WP_000074540.1.21674 WP_000074540.1.21681 WP_000074540.1.21692 WP_000074540.1.21715 WP_000074540.1.21728 WP_000074540.1.21730 WP_000074540.1.21750 WP_000074540.1.21751 WP_000074540.1.21757 WP_000074540.1.21792 WP_000074540.1.21825 WP_000074540.1.21886 WP_000074540.1.21909 WP_000074540.1.21910 WP_000074540.1.21940 WP_000074540.1.21946 WP_000074540.1.21950 WP_000074540.1.21966 WP_000074540.1.21981 WP_000074540.1.21991 WP_000074540.1.22019 WP_000074540.1.22024 WP_000074540.1.22030 WP_000074540.1.2205 WP_000074540.1.22051 WP_000074540.1.22062 WP_000074540.1.22064 WP_000074540.1.22067 WP_000074540.1.22069 WP_000074540.1.22096 WP_000074540.1.22117 WP_000074540.1.22118 WP_000074540.1.22126 WP_000074540.1.22136 WP_000074540.1.22158 WP_000074540.1.2216 WP_000074540.1.22162 WP_000074540.1.22169 WP_000074540.1.22205 WP_000074540.1.22208 WP_000074540.1.2221 WP_000074540.1.22235 WP_000074540.1.2224 WP_000074540.1.22240 WP_000074540.1.2227 WP_000074540.1.22270 WP_000074540.1.22296 WP_000074540.1.22315 WP_000074540.1.22323 WP_000074540.1.22337 WP_000074540.1.22346 WP_000074540.1.2235 WP_000074540.1.22373 WP_000074540.1.22379 WP_000074540.1.22388 WP_000074540.1.22427 WP_000074540.1.22449 WP_000074540.1.22451 WP_000074540.1.22453 WP_000074540.1.22454 WP_000074540.1.2246 WP_000074540.1.22460 WP_000074540.1.22476 WP_000074540.1.22485 WP_000074540.1.22514 WP_000074540.1.22537 WP_000074540.1.22565 WP_000074540.1.22566 WP_000074540.1.22575 WP_000074540.1.22582 WP_000074540.1.22590 WP_000074540.1.22595 WP_000074540.1.22604 WP_000074540.1.22605 WP_000074540.1.22614 WP_000074540.1.22620 WP_000074540.1.22623 WP_000074540.1.22652 WP_000074540.1.22676 WP_000074540.1.22683 WP_000074540.1.22692 WP_000074540.1.22758 WP_000074540.1.22760 WP_000074540.1.2283 WP_000074540.1.2284 WP_000074540.1.22845 WP_000074540.1.22855 WP_000074540.1.22857 WP_000074540.1.22864 WP_000074540.1.22870 WP_000074540.1.22880 WP_000074540.1.22895 WP_000074540.1.22902 WP_000074540.1.22926 WP_000074540.1.22943 WP_000074540.1.22947 WP_000074540.1.22967 WP_000074540.1.22979 WP_000074540.1.23010 WP_000074540.1.23040 WP_000074540.1.23053 WP_000074540.1.23058 WP_000074540.1.23080 WP_000074540.1.23102 WP_000074540.1.23114 WP_000074540.1.2314 WP_000074540.1.23148 WP_000074540.1.23155 WP_000074540.1.23169 WP_000074540.1.23172 WP_000074540.1.23175 WP_000074540.1.23192 WP_000074540.1.23201 WP_000074540.1.23218 WP_000074540.1.2324 WP_000074540.1.23246 WP_000074540.1.23258 WP_000074540.1.23259 WP_000074540.1.23274 WP_000074540.1.23279 WP_000074540.1.23309 WP_000074540.1.2331 WP_000074540.1.23311 WP_000074540.1.2332 WP_000074540.1.23329 WP_000074540.1.23340 WP_000074540.1.23343 WP_000074540.1.2336 WP_000074540.1.23365 WP_000074540.1.23379 WP_000074540.1.23409 WP_000074540.1.23412 WP_000074540.1.2342 WP_000074540.1.23426 WP_000074540.1.23442 WP_000074540.1.23444 WP_000074540.1.23460 WP_000074540.1.23466 WP_000074540.1.23472 WP_000074540.1.23482 WP_000074540.1.23485 WP_000074540.1.23492 WP_000074540.1.235 WP_000074540.1.23500 WP_000074540.1.23509 WP_000074540.1.23513 WP_000074540.1.23515 WP_000074540.1.23529 WP_000074540.1.23548 WP_000074540.1.23571 WP_000074540.1.2358 WP_000074540.1.23587 WP_000074540.1.23604 WP_000074540.1.23621 WP_000074540.1.23629 WP_000074540.1.23631 WP_000074540.1.23634 WP_000074540.1.23639 WP_000074540.1.2364 WP_000074540.1.23643 WP_000074540.1.23646 WP_000074540.1.23670 WP_000074540.1.23675 WP_000074540.1.23679 WP_000074540.1.23685 WP_000074540.1.237 WP_000074540.1.23707 WP_000074540.1.23720 WP_000074540.1.23728 WP_000074540.1.23736 WP_000074540.1.23746 WP_000074540.1.2375 WP_000074540.1.23755 WP_000074540.1.2376 WP_000074540.1.23783 WP_000074540.1.23786 WP_000074540.1.23787 WP_000074540.1.2380 WP_000074540.1.23801 WP_000074540.1.23819 WP_000074540.1.23932 WP_000074540.1.23959 WP_000074540.1.24017 WP_000074540.1.24028 WP_000074540.1.24061 WP_000074540.1.24082 WP_000074540.1.24083 WP_000074540.1.24117 WP_000074540.1.24125 WP_000074540.1.24138 WP_000074540.1.24145 WP_000074540.1.2415 WP_000074540.1.24153 WP_000074540.1.24158 WP_000074540.1.24163 WP_000074540.1.24206 WP_000074540.1.24214 WP_000074540.1.24250 WP_000074540.1.24259 WP_000074540.1.24291 WP_000074540.1.24297 WP_000074540.1.24303 WP_000074540.1.24308 WP_000074540.1.24322 WP_000074540.1.24325 WP_000074540.1.24355 WP_000074540.1.24361 WP_000074540.1.24375 WP_000074540.1.24376 WP_000074540.1.24392 WP_000074540.1.24394 WP_000074540.1.24400 WP_000074540.1.24408 WP_000074540.1.24409 WP_000074540.1.24412 WP_000074540.1.24419 WP_000074540.1.24420 WP_000074540.1.24433 WP_000074540.1.24450 WP_000074540.1.24476 WP_000074540.1.24494 WP_000074540.1.24521 WP_000074540.1.24555 WP_000074540.1.24567 WP_000074540.1.24578 WP_000074540.1.24619 WP_000074540.1.24643 WP_000074540.1.2467 WP_000074540.1.24673 WP_000074540.1.24686 WP_000074540.1.24688 WP_000074540.1.24689 WP_000074540.1.24696 WP_000074540.1.24716 WP_000074540.1.24723 WP_000074540.1.24727 WP_000074540.1.24737 WP_000074540.1.24779 WP_000074540.1.24803 WP_000074540.1.2481 WP_000074540.1.24832 WP_000074540.1.24837 WP_000074540.1.24839 WP_000074540.1.24873 WP_000074540.1.24901 WP_000074540.1.24944 WP_000074540.1.24964 WP_000074540.1.24995 WP_000074540.1.25008 WP_000074540.1.25015 WP_000074540.1.25017 WP_000074540.1.25032 WP_000074540.1.25036 WP_000074540.1.25041 WP_000074540.1.25053 WP_000074540.1.25064 WP_000074540.1.25072 WP_000074540.1.25119 WP_000074540.1.25130 WP_000074540.1.25140 WP_000074540.1.25159 WP_000074540.1.25175 WP_000074540.1.25185 WP_000074540.1.25196 WP_000074540.1.25205 WP_000074540.1.25206 WP_000074540.1.25210 WP_000074540.1.25217 WP_000074540.1.25219 WP_000074540.1.25229 WP_000074540.1.2525 WP_000074540.1.25297 WP_000074540.1.25304 WP_000074540.1.25354 WP_000074540.1.25374 WP_000074540.1.25397 WP_000074540.1.25405 WP_000074540.1.25421 WP_000074540.1.25426 WP_000074540.1.25454 WP_000074540.1.25475 WP_000074540.1.25490 WP_000074540.1.25498 WP_000074540.1.25508 WP_000074540.1.25512 WP_000074540.1.25514 WP_000074540.1.2554 WP_000074540.1.25546 WP_000074540.1.25564 WP_000074540.1.25596 WP_000074540.1.25603 WP_000074540.1.25618 WP_000074540.1.2562 WP_000074540.1.25666 WP_000074540.1.25668 WP_000074540.1.2568 WP_000074540.1.25690 WP_000074540.1.2570 WP_000074540.1.25700 WP_000074540.1.25703 WP_000074540.1.25708 WP_000074540.1.25709 WP_000074540.1.25722 WP_000074540.1.25740 WP_000074540.1.25780 WP_000074540.1.25793 WP_000074540.1.25807 WP_000074540.1.25809 WP_000074540.1.2581 WP_000074540.1.25814 WP_000074540.1.25821 WP_000074540.1.25825 WP_000074540.1.25833 WP_000074540.1.25835 WP_000074540.1.25846 WP_000074540.1.25882 WP_000074540.1.25911 WP_000074540.1.25928 WP_000074540.1.25932 WP_000074540.1.25944 WP_000074540.1.25951 WP_000074540.1.25962 WP_000074540.1.25963 WP_000074540.1.25988 WP_000074540.1.26001 WP_000074540.1.26027 WP_000074540.1.26030 WP_000074540.1.26034 WP_000074540.1.26075 WP_000074540.1.26083 WP_000074540.1.26093 WP_000074540.1.26107 WP_000074540.1.26122 WP_000074540.1.26123 WP_000074540.1.26129 WP_000074540.1.2615 WP_000074540.1.26194 WP_000074540.1.26199 WP_000074540.1.26213 WP_000074540.1.26217 WP_000074540.1.26224 WP_000074540.1.26230 WP_000074540.1.26232 WP_000074540.1.26269 WP_000074540.1.26272 WP_000074540.1.26282 WP_000074540.1.26286 WP_000074540.1.26288 WP_000074540.1.26311 WP_000074540.1.26319 WP_000074540.1.2634 WP_000074540.1.26363 WP_000074540.1.26384 WP_000074540.1.26394 WP_000074540.1.26426 WP_000074540.1.26429 WP_000074540.1.26440 WP_000074540.1.26441 WP_000074540.1.26491 WP_000074540.1.26493 WP_000074540.1.26512 WP_000074540.1.26532 WP_000074540.1.2654 WP_000074540.1.26551 WP_000074540.1.26554 WP_000074540.1.26563 WP_000074540.1.26567 WP_000074540.1.26576 WP_000074540.1.26582 WP_000074540.1.26587 WP_000074540.1.2660 WP_000074540.1.26636 WP_000074540.1.26646 WP_000074540.1.2667 WP_000074540.1.26687 WP_000074540.1.26689 WP_000074540.1.26709 WP_000074540.1.2672 WP_000074540.1.26741 WP_000074540.1.26750 WP_000074540.1.26758 WP_000074540.1.26787 WP_000074540.1.2679 WP_000074540.1.26794 WP_000074540.1.26833 WP_000074540.1.26856 WP_000074540.1.26882 WP_000074540.1.26883 WP_000074540.1.26892 WP_000074540.1.26908 WP_000074540.1.26919 WP_000074540.1.2692 WP_000074540.1.26924 WP_000074540.1.26928 WP_000074540.1.26936 WP_000074540.1.26980 WP_000074540.1.270 WP_000074540.1.27008 WP_000074540.1.27010 WP_000074540.1.27027 WP_000074540.1.27051 WP_000074540.1.27055 WP_000074540.1.27070 WP_000074540.1.27072 WP_000074540.1.27077 WP_000074540.1.27084 WP_000074540.1.27086 WP_000074540.1.27087 WP_000074540.1.27111 WP_000074540.1.27115 WP_000074540.1.27122 WP_000074540.1.2713 WP_000074540.1.27169 WP_000074540.1.2717 WP_000074540.1.27173 WP_000074540.1.272 WP_000074540.1.27206 WP_000074540.1.27223 WP_000074540.1.27228 WP_000074540.1.2723 WP_000074540.1.27255 WP_000074540.1.27272 WP_000074540.1.27279 WP_000074540.1.27282 WP_000074540.1.27285 WP_000074540.1.27309 WP_000074540.1.27314 WP_000074540.1.27329 WP_000074540.1.27342 WP_000074540.1.27361 WP_000074540.1.27383 WP_000074540.1.27419 WP_000074540.1.27423 WP_000074540.1.27452 WP_000074540.1.27513 WP_000074540.1.27522 WP_000074540.1.27523 WP_000074540.1.27535 WP_000074540.1.27544 WP_000074540.1.27547 WP_000074540.1.27561 WP_000074540.1.27565 WP_000074540.1.27595 WP_000074540.1.27598 WP_000074540.1.27616 WP_000074540.1.2763 WP_000074540.1.27632 WP_000074540.1.27638 WP_000074540.1.27655 WP_000074540.1.27658 WP_000074540.1.27665 WP_000074540.1.27679 WP_000074540.1.27706 WP_000074540.1.27707 WP_000074540.1.27713 WP_000074540.1.27755 WP_000074540.1.27761 WP_000074540.1.2777 WP_000074540.1.27775 WP_000074540.1.27776 WP_000074540.1.27785 WP_000074540.1.27798 WP_000074540.1.27800 WP_000074540.1.27815 WP_000074540.1.27833 WP_000074540.1.27857 WP_000074540.1.27883 WP_000074540.1.27892 WP_000074540.1.27900 WP_000074540.1.27928 WP_000074540.1.27945 WP_000074540.1.27969 WP_000074540.1.27977 WP_000074540.1.27995 WP_000074540.1.27997 WP_000074540.1.28002 WP_000074540.1.28004 WP_000074540.1.28032 WP_000074540.1.28037 WP_000074540.1.28056 WP_000074540.1.2806 WP_000074540.1.28073 WP_000074540.1.2809 WP_000074540.1.28094 WP_000074540.1.28116 WP_000074540.1.28126 WP_000074540.1.28139 WP_000074540.1.28155 WP_000074540.1.28170 WP_000074540.1.28174 WP_000074540.1.28198 WP_000074540.1.28200 WP_000074540.1.2822 WP_000074540.1.28229 WP_000074540.1.28232 WP_000074540.1.28233 WP_000074540.1.28235 WP_000074540.1.2825 WP_000074540.1.28267 WP_000074540.1.2829 WP_000074540.1.28301 WP_000074540.1.28302 WP_000074540.1.28303 WP_000074540.1.2835 WP_000074540.1.28370 WP_000074540.1.28384 WP_000074540.1.28386 WP_000074540.1.28393 WP_000074540.1.28395 WP_000074540.1.284 WP_000074540.1.2845 WP_000074540.1.28462 WP_000074540.1.28479 WP_000074540.1.28504 WP_000074540.1.28514 WP_000074540.1.2853 WP_000074540.1.28570 WP_000074540.1.28575 WP_000074540.1.28612 WP_000074540.1.28620 WP_000074540.1.28625 WP_000074540.1.28627 WP_000074540.1.28655 WP_000074540.1.28673 WP_000074540.1.28692 WP_000074540.1.28694 WP_000074540.1.287 WP_000074540.1.2873 WP_000074540.1.28773 WP_000074540.1.28775 WP_000074540.1.28776 WP_000074540.1.2879 WP_000074540.1.28830 WP_000074540.1.2890 WP_000074540.1.28902 WP_000074540.1.28917 WP_000074540.1.28921 WP_000074540.1.28938 WP_000074540.1.28946 WP_000074540.1.28948 WP_000074540.1.28962 WP_000074540.1.28963 WP_000074540.1.29010 WP_000074540.1.29023 WP_000074540.1.29042 WP_000074540.1.2905 WP_000074540.1.2907 WP_000074540.1.29081 WP_000074540.1.29089 WP_000074540.1.29099 WP_000074540.1.2910 WP_000074540.1.29113 WP_000074540.1.29130 WP_000074540.1.29153 WP_000074540.1.29168 WP_000074540.1.29174 WP_000074540.1.29190 WP_000074540.1.29203 WP_000074540.1.29218 WP_000074540.1.29237 WP_000074540.1.2924 WP_000074540.1.29248 WP_000074540.1.29255 WP_000074540.1.29265 WP_000074540.1.29274 WP_000074540.1.29288 WP_000074540.1.2932 WP_000074540.1.29349 WP_000074540.1.29379 WP_000074540.1.29389 WP_000074540.1.29422 WP_000074540.1.29436 WP_000074540.1.29439 WP_000074540.1.29454 WP_000074540.1.2946 WP_000074540.1.29462 WP_000074540.1.29509 WP_000074540.1.29530 WP_000074540.1.29563 WP_000074540.1.29576 WP_000074540.1.29588 WP_000074540.1.29593 WP_000074540.1.29601 WP_000074540.1.29606 WP_000074540.1.29615 WP_000074540.1.29619 WP_000074540.1.29682 WP_000074540.1.29704 WP_000074540.1.29727 WP_000074540.1.29743 WP_000074540.1.29782 WP_000074540.1.29827 WP_000074540.1.29833 WP_000074540.1.2984 WP_000074540.1.29845 WP_000074540.1.29851 WP_000074540.1.29865 WP_000074540.1.29886 WP_000074540.1.29898 WP_000074540.1.29919 WP_000074540.1.29923 WP_000074540.1.29924 WP_000074540.1.2994 WP_000074540.1.29964 WP_000074540.1.29969 WP_000074540.1.29983 WP_000074540.1.29990 WP_000074540.1.30006 WP_000074540.1.30009 WP_000074540.1.30013 WP_000074540.1.30018 WP_000074540.1.3002 WP_000074540.1.30022 WP_000074540.1.30027 WP_000074540.1.30034 WP_000074540.1.30049 WP_000074540.1.3005 WP_000074540.1.30058 WP_000074540.1.30059 WP_000074540.1.30086 WP_000074540.1.30093 WP_000074540.1.30165 WP_000074540.1.3017 WP_000074540.1.30170 WP_000074540.1.30172 WP_000074540.1.30179 WP_000074540.1.30180 WP_000074540.1.30185 WP_000074540.1.30195 WP_000074540.1.30202 WP_000074540.1.30210 WP_000074540.1.30213 WP_000074540.1.30225 WP_000074540.1.30238 WP_000074540.1.30246 WP_000074540.1.30278 WP_000074540.1.30354 WP_000074540.1.30356 WP_000074540.1.30357 WP_000074540.1.30362 WP_000074540.1.30386 WP_000074540.1.30389 WP_000074540.1.3042 WP_000074540.1.30421 WP_000074540.1.30425 WP_000074540.1.30437 WP_000074540.1.30440 WP_000074540.1.30448 WP_000074540.1.30469 WP_000074540.1.30489 WP_000074540.1.30492 WP_000074540.1.30505 WP_000074540.1.30507 WP_000074540.1.30517 WP_000074540.1.30535 WP_000074540.1.30542 WP_000074540.1.30544 WP_000074540.1.30547 WP_000074540.1.30548 WP_000074540.1.30555 WP_000074540.1.30556 WP_000074540.1.30572 WP_000074540.1.30573 WP_000074540.1.30585 WP_000074540.1.30589 WP_000074540.1.30602 WP_000074540.1.30618 WP_000074540.1.30619 WP_000074540.1.30627 WP_000074540.1.30635 WP_000074540.1.3066 WP_000074540.1.30664 WP_000074540.1.3067 WP_000074540.1.3068 WP_000074540.1.30688 WP_000074540.1.30696 WP_000074540.1.30752 WP_000074540.1.3076 WP_000074540.1.30794 WP_000074540.1.3080 WP_000074540.1.30802 WP_000074540.1.30806 WP_000074540.1.30819 WP_000074540.1.30823 WP_000074540.1.30833 WP_000074540.1.30835 WP_000074540.1.3089 WP_000074540.1.30909 WP_000074540.1.30934 WP_000074540.1.3095 WP_000074540.1.30951 WP_000074540.1.30967 WP_000074540.1.30968 WP_000074540.1.30972 WP_000074540.1.31 WP_000074540.1.31001 WP_000074540.1.31011 WP_000074540.1.31042 WP_000074540.1.31046 WP_000074540.1.31066 WP_000074540.1.31069 WP_000074540.1.31078 WP_000074540.1.31086 WP_000074540.1.31092 WP_000074540.1.31107 WP_000074540.1.31111 WP_000074540.1.31122 WP_000074540.1.3113 WP_000074540.1.31139 WP_000074540.1.3114 WP_000074540.1.31145 WP_000074540.1.31156 WP_000074540.1.31167 WP_000074540.1.31171 WP_000074540.1.31182 WP_000074540.1.31185 WP_000074540.1.3119 WP_000074540.1.31190 WP_000074540.1.31195 WP_000074540.1.31196 WP_000074540.1.31198 WP_000074540.1.31205 WP_000074540.1.3121 WP_000074540.1.31210 WP_000074540.1.31214 WP_000074540.1.31219 WP_000074540.1.31222 WP_000074540.1.31223 WP_000074540.1.3124 WP_000074540.1.31251 WP_000074540.1.31262 WP_000074540.1.3127 WP_000074540.1.31272 WP_000074540.1.31281 WP_000074540.1.31303 WP_000074540.1.3131 WP_000074540.1.31335 WP_000074540.1.31352 WP_000074540.1.31362 WP_000074540.1.31389 WP_000074540.1.31413 WP_000074540.1.31435 WP_000074540.1.31446 WP_000074540.1.31451 WP_000074540.1.31476 WP_000074540.1.31504 WP_000074540.1.31515 WP_000074540.1.31533 WP_000074540.1.31546 WP_000074540.1.31578 WP_000074540.1.31585 WP_000074540.1.31658 WP_000074540.1.31665 WP_000074540.1.3167 WP_000074540.1.3170 WP_000074540.1.31720 WP_000074540.1.31725 WP_000074540.1.31762 WP_000074540.1.31782 WP_000074540.1.31799 WP_000074540.1.31836 WP_000074540.1.31845 WP_000074540.1.3185 WP_000074540.1.31854 WP_000074540.1.31895 WP_000074540.1.31901 WP_000074540.1.31927 WP_000074540.1.31940 WP_000074540.1.31951 WP_000074540.1.31952 WP_000074540.1.31967 WP_000074540.1.31972 WP_000074540.1.31983 WP_000074540.1.32006 WP_000074540.1.32038 WP_000074540.1.32041 WP_000074540.1.32042 WP_000074540.1.32054 WP_000074540.1.32056 WP_000074540.1.3207 WP_000074540.1.32109 WP_000074540.1.32170 WP_000074540.1.32189 WP_000074540.1.32192 WP_000074540.1.32202 WP_000074540.1.32204 WP_000074540.1.32206 WP_000074540.1.32252 WP_000074540.1.32260 WP_000074540.1.32263 WP_000074540.1.32274 WP_000074540.1.32275 WP_000074540.1.32277 WP_000074540.1.32293 WP_000074540.1.32299 WP_000074540.1.32309 WP_000074540.1.32357 WP_000074540.1.32368 WP_000074540.1.32408 WP_000074540.1.32422 WP_000074540.1.32424 WP_000074540.1.32425 WP_000074540.1.32434 WP_000074540.1.32438 WP_000074540.1.32458 WP_000074540.1.32459 WP_000074540.1.32460 WP_000074540.1.32491 WP_000074540.1.32493 WP_000074540.1.32515 WP_000074540.1.32519 WP_000074540.1.32527 WP_000074540.1.32529 WP_000074540.1.32545 WP_000074540.1.32563 WP_000074540.1.32578 WP_000074540.1.32617 WP_000074540.1.32624 WP_000074540.1.32629 WP_000074540.1.32643 WP_000074540.1.32660 WP_000074540.1.32668 WP_000074540.1.3270 WP_000074540.1.32702 WP_000074540.1.32714 WP_000074540.1.32725 WP_000074540.1.32740 WP_000074540.1.32747 WP_000074540.1.32750 WP_000074540.1.3278 WP_000074540.1.32786 WP_000074540.1.32804 WP_000074540.1.32832 WP_000074540.1.32838 WP_000074540.1.32848 WP_000074540.1.32860 WP_000074540.1.32868 WP_000074540.1.32881 WP_000074540.1.32899 WP_000074540.1.329 WP_000074540.1.3290 WP_000074540.1.32900 WP_000074540.1.32902 WP_000074540.1.32907 WP_000074540.1.32930 WP_000074540.1.32940 WP_000074540.1.32941 WP_000074540.1.3296 WP_000074540.1.32961 WP_000074540.1.32966 WP_000074540.1.32977 WP_000074540.1.32985 WP_000074540.1.33010 WP_000074540.1.33030 WP_000074540.1.33037 WP_000074540.1.3304 WP_000074540.1.3305 WP_000074540.1.33051 WP_000074540.1.33065 WP_000074540.1.33078 WP_000074540.1.3310 WP_000074540.1.33106 WP_000074540.1.33114 WP_000074540.1.33122 WP_000074540.1.33127 WP_000074540.1.33143 WP_000074540.1.33144 WP_000074540.1.3315 WP_000074540.1.33160 WP_000074540.1.33208 WP_000074540.1.33214 WP_000074540.1.33247 WP_000074540.1.33248 WP_000074540.1.33253 WP_000074540.1.33261 WP_000074540.1.33270 WP_000074540.1.33280 WP_000074540.1.33283 WP_000074540.1.333 WP_000074540.1.33313 WP_000074540.1.33339 WP_000074540.1.33382 WP_000074540.1.33392 WP_000074540.1.33409 WP_000074540.1.33420 WP_000074540.1.33486 WP_000074540.1.33490 WP_000074540.1.33492 WP_000074540.1.33499 WP_000074540.1.335 WP_000074540.1.33501 WP_000074540.1.33504 WP_000074540.1.33529 WP_000074540.1.33553 WP_000074540.1.3356 WP_000074540.1.33580 WP_000074540.1.33586 WP_000074540.1.33592 WP_000074540.1.33609 WP_000074540.1.3364 WP_000074540.1.33659 WP_000074540.1.33689 WP_000074540.1.33693 WP_000074540.1.3370 WP_000074540.1.33730 WP_000074540.1.33741 WP_000074540.1.33817 WP_000074540.1.33840 WP_000074540.1.33865 WP_000074540.1.33870 WP_000074540.1.33894 WP_000074540.1.3392 WP_000074540.1.33926 WP_000074540.1.3394 WP_000074540.1.3395 WP_000074540.1.33957 WP_000074540.1.3396 WP_000074540.1.33969 WP_000074540.1.33986 WP_000074540.1.34 WP_000074540.1.34001 WP_000074540.1.34022 WP_000074540.1.34043 WP_000074540.1.34059 WP_000074540.1.34075 WP_000074540.1.34081 WP_000074540.1.34084 WP_000074540.1.34091 WP_000074540.1.34107 WP_000074540.1.34118 WP_000074540.1.34179 WP_000074540.1.34184 WP_000074540.1.34185 WP_000074540.1.34211 WP_000074540.1.34214 WP_000074540.1.34234 WP_000074540.1.34257 WP_000074540.1.34259 WP_000074540.1.34279 WP_000074540.1.34284 WP_000074540.1.34292 WP_000074540.1.34304 WP_000074540.1.34319 WP_000074540.1.34330 WP_000074540.1.34376 WP_000074540.1.3438 WP_000074540.1.34382 WP_000074540.1.34417 WP_000074540.1.34424 WP_000074540.1.34431 WP_000074540.1.3445 WP_000074540.1.34453 WP_000074540.1.34454 WP_000074540.1.34458 WP_000074540.1.34484 WP_000074540.1.34496 WP_000074540.1.34517 WP_000074540.1.34530 WP_000074540.1.34610 WP_000074540.1.34614 WP_000074540.1.34647 WP_000074540.1.34659 WP_000074540.1.34665 WP_000074540.1.34667 WP_000074540.1.34684 WP_000074540.1.34694 WP_000074540.1.34703 WP_000074540.1.34704 WP_000074540.1.34707 WP_000074540.1.34711 WP_000074540.1.34745 WP_000074540.1.34751 WP_000074540.1.3476 WP_000074540.1.34801 WP_000074540.1.34808 WP_000074540.1.34817 WP_000074540.1.34820 WP_000074540.1.34824 WP_000074540.1.34834 WP_000074540.1.34854 WP_000074540.1.34856 WP_000074540.1.3489 WP_000074540.1.34932 WP_000074540.1.34962 WP_000074540.1.34972 WP_000074540.1.34975 WP_000074540.1.34977 WP_000074540.1.35001 WP_000074540.1.35035 WP_000074540.1.35040 WP_000074540.1.35045 WP_000074540.1.35074 WP_000074540.1.35075 WP_000074540.1.35125 WP_000074540.1.35129 WP_000074540.1.35175 WP_000074540.1.35184 WP_000074540.1.35193 WP_000074540.1.35240 WP_000074540.1.35274 WP_000074540.1.35294 WP_000074540.1.35298 WP_000074540.1.35321 WP_000074540.1.35331 WP_000074540.1.35332 WP_000074540.1.35404 WP_000074540.1.35408 WP_000074540.1.3541 WP_000074540.1.35425 WP_000074540.1.35429 WP_000074540.1.35446 WP_000074540.1.35460 WP_000074540.1.35463 WP_000074540.1.35494 WP_000074540.1.35503 WP_000074540.1.35507 WP_000074540.1.35509 WP_000074540.1.35532 WP_000074540.1.3556 WP_000074540.1.35560 WP_000074540.1.35563 WP_000074540.1.3557 WP_000074540.1.35570 WP_000074540.1.35590 WP_000074540.1.35594 WP_000074540.1.35619 WP_000074540.1.35624 WP_000074540.1.35628 WP_000074540.1.35648 WP_000074540.1.3566 WP_000074540.1.3570 WP_000074540.1.35712 WP_000074540.1.35713 WP_000074540.1.3572 WP_000074540.1.35736 WP_000074540.1.35777 WP_000074540.1.35791 WP_000074540.1.35795 WP_000074540.1.35809 WP_000074540.1.35835 WP_000074540.1.35868 WP_000074540.1.35870 WP_000074540.1.35887 WP_000074540.1.35892 WP_000074540.1.35916 WP_000074540.1.35936 WP_000074540.1.35938 WP_000074540.1.35940 WP_000074540.1.35961 WP_000074540.1.35966 WP_000074540.1.36000 WP_000074540.1.36003 WP_000074540.1.3601 WP_000074540.1.36011 WP_000074540.1.36017 WP_000074540.1.36034 WP_000074540.1.36036 WP_000074540.1.36037 WP_000074540.1.36057 WP_000074540.1.36063 WP_000074540.1.36069 WP_000074540.1.3610 WP_000074540.1.36157 WP_000074540.1.36172 WP_000074540.1.36229 WP_000074540.1.36232 WP_000074540.1.36236 WP_000074540.1.36286 WP_000074540.1.36291 WP_000074540.1.36298 WP_000074540.1.36308 WP_000074540.1.36323 WP_000074540.1.36343 WP_000074540.1.36409 WP_000074540.1.36425 WP_000074540.1.36445 WP_000074540.1.36460 WP_000074540.1.3649 WP_000074540.1.36495 WP_000074540.1.36512 WP_000074540.1.36526 WP_000074540.1.36542 WP_000074540.1.36547 WP_000074540.1.36564 WP_000074540.1.36567 WP_000074540.1.36579 WP_000074540.1.36584 WP_000074540.1.36586 WP_000074540.1.36592 WP_000074540.1.36609 WP_000074540.1.36617 WP_000074540.1.36618 WP_000074540.1.36643 WP_000074540.1.36652 WP_000074540.1.36663 WP_000074540.1.36685 WP_000074540.1.36690 WP_000074540.1.3670 WP_000074540.1.36701 WP_000074540.1.36705 WP_000074540.1.36721 WP_000074540.1.36725 WP_000074540.1.36751 WP_000074540.1.36764 WP_000074540.1.36765 WP_000074540.1.36779 WP_000074540.1.36792 WP_000074540.1.36798 WP_000074540.1.36802 WP_000074540.1.36821 WP_000074540.1.36839 WP_000074540.1.36853 WP_000074540.1.36875 WP_000074540.1.3688 WP_000074540.1.36889 WP_000074540.1.36918 WP_000074540.1.36931 WP_000074540.1.36948 WP_000074540.1.36950 WP_000074540.1.36978 WP_000074540.1.37013 WP_000074540.1.37014 WP_000074540.1.37021 WP_000074540.1.37028 WP_000074540.1.37029 WP_000074540.1.37073 WP_000074540.1.37100 WP_000074540.1.37111 WP_000074540.1.37112 WP_000074540.1.37114 WP_000074540.1.37133 WP_000074540.1.37147 WP_000074540.1.37158 WP_000074540.1.37176 WP_000074540.1.37190 WP_000074540.1.37191 WP_000074540.1.37199 WP_000074540.1.37200 WP_000074540.1.37256 WP_000074540.1.37258 WP_000074540.1.3726 WP_000074540.1.37267 WP_000074540.1.3728 WP_000074540.1.37293 WP_000074540.1.37297 WP_000074540.1.37303 WP_000074540.1.37320 WP_000074540.1.3734 WP_000074540.1.37351 WP_000074540.1.37363 WP_000074540.1.37370 WP_000074540.1.37376 WP_000074540.1.37405 WP_000074540.1.3744 WP_000074540.1.37478 WP_000074540.1.3748 WP_000074540.1.37498 WP_000074540.1.37504 WP_000074540.1.3751 WP_000074540.1.37513 WP_000074540.1.37521 WP_000074540.1.37558 WP_000074540.1.3756 WP_000074540.1.37584 WP_000074540.1.37590 WP_000074540.1.37593 WP_000074540.1.37600 WP_000074540.1.37610 WP_000074540.1.37613 WP_000074540.1.37618 WP_000074540.1.37659 WP_000074540.1.37662 WP_000074540.1.37666 WP_000074540.1.37675 WP_000074540.1.37687 WP_000074540.1.37691 WP_000074540.1.3771 WP_000074540.1.37719 WP_000074540.1.37761 WP_000074540.1.37775 WP_000074540.1.37777 WP_000074540.1.3778 WP_000074540.1.378 WP_000074540.1.37848 WP_000074540.1.37864 WP_000074540.1.379 WP_000074540.1.3790 WP_000074540.1.37911 WP_000074540.1.37941 WP_000074540.1.37965 WP_000074540.1.37968 WP_000074540.1.37978 WP_000074540.1.37985 WP_000074540.1.38001 WP_000074540.1.38026 WP_000074540.1.38037 WP_000074540.1.38047 WP_000074540.1.38055 WP_000074540.1.38061 WP_000074540.1.38064 WP_000074540.1.38108 WP_000074540.1.38113 WP_000074540.1.38125 WP_000074540.1.38145 WP_000074540.1.3816 WP_000074540.1.38199 WP_000074540.1.38207 WP_000074540.1.38261 WP_000074540.1.38266 WP_000074540.1.38273 WP_000074540.1.3828 WP_000074540.1.38310 WP_000074540.1.38322 WP_000074540.1.3834 WP_000074540.1.38341 WP_000074540.1.38344 WP_000074540.1.38349 WP_000074540.1.38351 WP_000074540.1.3838 WP_000074540.1.38381 WP_000074540.1.38393 WP_000074540.1.38408 WP_000074540.1.38440 WP_000074540.1.38452 WP_000074540.1.3848 WP_000074540.1.38486 WP_000074540.1.38512 WP_000074540.1.38515 WP_000074540.1.38569 WP_000074540.1.38595 WP_000074540.1.3860 WP_000074540.1.38613 WP_000074540.1.38620 WP_000074540.1.38622 WP_000074540.1.38642 WP_000074540.1.38673 WP_000074540.1.3869 WP_000074540.1.38693 WP_000074540.1.38734 WP_000074540.1.38740 WP_000074540.1.38773 WP_000074540.1.38781 WP_000074540.1.38797 WP_000074540.1.38830 WP_000074540.1.38857 WP_000074540.1.38877 WP_000074540.1.38881 WP_000074540.1.38882 WP_000074540.1.38895 WP_000074540.1.3891 WP_000074540.1.38913 WP_000074540.1.38942 WP_000074540.1.38983 WP_000074540.1.38995 WP_000074540.1.38996 WP_000074540.1.39003 WP_000074540.1.39038 WP_000074540.1.39048 WP_000074540.1.39055 WP_000074540.1.39056 WP_000074540.1.39059 WP_000074540.1.39065 WP_000074540.1.3907 WP_000074540.1.39075 WP_000074540.1.39105 WP_000074540.1.39112 WP_000074540.1.39113 WP_000074540.1.39128 WP_000074540.1.39136 WP_000074540.1.3914 WP_000074540.1.39140 WP_000074540.1.39146 WP_000074540.1.39147 WP_000074540.1.39161 WP_000074540.1.39183 WP_000074540.1.39197 WP_000074540.1.39210 WP_000074540.1.39229 WP_000074540.1.39235 WP_000074540.1.39265 WP_000074540.1.39275 WP_000074540.1.3931 WP_000074540.1.39312 WP_000074540.1.39385 WP_000074540.1.39395 WP_000074540.1.39405 WP_000074540.1.39414 WP_000074540.1.39420 WP_000074540.1.39435 WP_000074540.1.39449 WP_000074540.1.39466 WP_000074540.1.39471 WP_000074540.1.39497 WP_000074540.1.39502 WP_000074540.1.39503 WP_000074540.1.39512 WP_000074540.1.39530 WP_000074540.1.39553 WP_000074540.1.39556 WP_000074540.1.39576 WP_000074540.1.39584 WP_000074540.1.39609 WP_000074540.1.39614 WP_000074540.1.39619 WP_000074540.1.39620 WP_000074540.1.39624 WP_000074540.1.39629 WP_000074540.1.39632 WP_000074540.1.39659 WP_000074540.1.39667 WP_000074540.1.39722 WP_000074540.1.39723 WP_000074540.1.39724 WP_000074540.1.39763 WP_000074540.1.39775 WP_000074540.1.39808 WP_000074540.1.39862 WP_000074540.1.39879 WP_000074540.1.39890 WP_000074540.1.39921 WP_000074540.1.39923 WP_000074540.1.39941 WP_000074540.1.39945 WP_000074540.1.39947 WP_000074540.1.39953 WP_000074540.1.40008 WP_000074540.1.40017 WP_000074540.1.40025 WP_000074540.1.40031 WP_000074540.1.40072 WP_000074540.1.40073 WP_000074540.1.40081 WP_000074540.1.40095 WP_000074540.1.40097 WP_000074540.1.401 WP_000074540.1.4011 WP_000074540.1.40111 WP_000074540.1.40155 WP_000074540.1.40158 WP_000074540.1.40160 WP_000074540.1.40167 WP_000074540.1.40170 WP_000074540.1.40171 WP_000074540.1.40205 WP_000074540.1.40208 WP_000074540.1.40224 WP_000074540.1.40229 WP_000074540.1.40240 WP_000074540.1.40254 WP_000074540.1.40257 WP_000074540.1.40258 WP_000074540.1.40259 WP_000074540.1.40279 WP_000074540.1.40284 WP_000074540.1.40292 WP_000074540.1.40305 WP_000074540.1.40307 WP_000074540.1.40311 WP_000074540.1.40341 WP_000074540.1.40361 WP_000074540.1.40374 WP_000074540.1.40380 WP_000074540.1.40395 WP_000074540.1.40414 WP_000074540.1.4042 WP_000074540.1.40465 WP_000074540.1.40467 WP_000074540.1.40492 WP_000074540.1.40493 WP_000074540.1.40496 WP_000074540.1.40508 WP_000074540.1.40517 WP_000074540.1.40528 WP_000074540.1.40533 WP_000074540.1.40577 WP_000074540.1.40583 WP_000074540.1.40605 WP_000074540.1.40622 WP_000074540.1.40648 WP_000074540.1.40688 WP_000074540.1.40693 WP_000074540.1.40695 WP_000074540.1.40698 WP_000074540.1.40710 WP_000074540.1.40722 WP_000074540.1.40745 WP_000074540.1.4075 WP_000074540.1.40750 WP_000074540.1.40763 WP_000074540.1.40771 WP_000074540.1.40788 WP_000074540.1.40849 WP_000074540.1.40854 WP_000074540.1.4087 WP_000074540.1.40877 WP_000074540.1.4088 WP_000074540.1.4089 WP_000074540.1.40910 WP_000074540.1.40924 WP_000074540.1.40930 WP_000074540.1.40932 WP_000074540.1.40935 WP_000074540.1.40946 WP_000074540.1.40973 WP_000074540.1.40979 WP_000074540.1.40996 WP_000074540.1.41004 WP_000074540.1.41017 WP_000074540.1.41018 WP_000074540.1.41048 WP_000074540.1.41050 WP_000074540.1.4106 WP_000074540.1.41070 WP_000074540.1.41074 WP_000074540.1.41075 WP_000074540.1.41086 WP_000074540.1.4109 WP_000074540.1.41091 WP_000074540.1.41097 WP_000074540.1.41116 WP_000074540.1.41128 WP_000074540.1.41132 WP_000074540.1.41176 WP_000074540.1.41192 WP_000074540.1.41225 WP_000074540.1.41226 WP_000074540.1.41251 WP_000074540.1.41258 WP_000074540.1.41265 WP_000074540.1.41277 WP_000074540.1.41279 WP_000074540.1.41299 WP_000074540.1.41305 WP_000074540.1.41308 WP_000074540.1.41310 WP_000074540.1.41321 WP_000074540.1.41333 WP_000074540.1.41335 WP_000074540.1.4136 WP_000074540.1.41375 WP_000074540.1.41415 WP_000074540.1.41427 WP_000074540.1.41434 WP_000074540.1.41440 WP_000074540.1.41459 WP_000074540.1.41468 WP_000074540.1.41498 WP_000074540.1.41516 WP_000074540.1.41519 WP_000074540.1.41528 WP_000074540.1.41554 WP_000074540.1.41572 WP_000074540.1.41591 WP_000074540.1.41593 WP_000074540.1.41610 WP_000074540.1.41628 WP_000074540.1.41631 WP_000074540.1.41658 WP_000074540.1.41659 WP_000074540.1.41662 WP_000074540.1.41690 WP_000074540.1.41708 WP_000074540.1.41716 WP_000074540.1.41724 WP_000074540.1.41735 WP_000074540.1.41746 WP_000074540.1.41761 WP_000074540.1.4178 WP_000074540.1.41789 WP_000074540.1.41799 WP_000074540.1.41824 WP_000074540.1.41825 WP_000074540.1.41836 WP_000074540.1.4184 WP_000074540.1.41859 WP_000074540.1.41862 WP_000074540.1.41877 WP_000074540.1.41882 WP_000074540.1.41894 WP_000074540.1.41897 WP_000074540.1.41904 WP_000074540.1.41911 WP_000074540.1.41919 WP_000074540.1.41929 WP_000074540.1.41931 WP_000074540.1.41938 WP_000074540.1.4194 WP_000074540.1.41949 WP_000074540.1.41978 WP_000074540.1.41979 WP_000074540.1.41985 WP_000074540.1.41994 WP_000074540.1.41998 WP_000074540.1.42009 WP_000074540.1.42069 WP_000074540.1.42081 WP_000074540.1.42090 WP_000074540.1.42098 WP_000074540.1.42104 WP_000074540.1.42109 WP_000074540.1.42111 WP_000074540.1.42136 WP_000074540.1.42156 WP_000074540.1.42187 WP_000074540.1.422 WP_000074540.1.42200 WP_000074540.1.42219 WP_000074540.1.4222 WP_000074540.1.42238 WP_000074540.1.42243 WP_000074540.1.42244 WP_000074540.1.42248 WP_000074540.1.42257 WP_000074540.1.42261 WP_000074540.1.42262 WP_000074540.1.42263 WP_000074540.1.42276 WP_000074540.1.4229 WP_000074540.1.42320 WP_000074540.1.42322 WP_000074540.1.42328 WP_000074540.1.42342 WP_000074540.1.42349 WP_000074540.1.42356 WP_000074540.1.42364 WP_000074540.1.42371 WP_000074540.1.42372 WP_000074540.1.42379 WP_000074540.1.4239 WP_000074540.1.42391 WP_000074540.1.42392 WP_000074540.1.42399 WP_000074540.1.42404 WP_000074540.1.42422 WP_000074540.1.42433 WP_000074540.1.42444 WP_000074540.1.42453 WP_000074540.1.42489 WP_000074540.1.42491 WP_000074540.1.42539 WP_000074540.1.4257 WP_000074540.1.42603 WP_000074540.1.42605 WP_000074540.1.42650 WP_000074540.1.42655 WP_000074540.1.42666 WP_000074540.1.4267 WP_000074540.1.42675 WP_000074540.1.42676 WP_000074540.1.42683 WP_000074540.1.42685 WP_000074540.1.42701 WP_000074540.1.42707 WP_000074540.1.42734 WP_000074540.1.4276 WP_000074540.1.42767 WP_000074540.1.42797 WP_000074540.1.42805 WP_000074540.1.42815 WP_000074540.1.42829 WP_000074540.1.42859 WP_000074540.1.42864 WP_000074540.1.4288 WP_000074540.1.42887 WP_000074540.1.4289 WP_000074540.1.42892 WP_000074540.1.42923 WP_000074540.1.42932 WP_000074540.1.42957 WP_000074540.1.42978 WP_000074540.1.4298 WP_000074540.1.42981 WP_000074540.1.43008 WP_000074540.1.43016 WP_000074540.1.43018 WP_000074540.1.43019 WP_000074540.1.43041 WP_000074540.1.43065 WP_000074540.1.43068 WP_000074540.1.43069 WP_000074540.1.43070 WP_000074540.1.43077 WP_000074540.1.43086 WP_000074540.1.43089 WP_000074540.1.43126 WP_000074540.1.43128 WP_000074540.1.43141 WP_000074540.1.43149 WP_000074540.1.43157 WP_000074540.1.43160 WP_000074540.1.43161 WP_000074540.1.43190 WP_000074540.1.43198 WP_000074540.1.43201 WP_000074540.1.43244 WP_000074540.1.43258 WP_000074540.1.4326 WP_000074540.1.43272 WP_000074540.1.43276 WP_000074540.1.43290 WP_000074540.1.43292 WP_000074540.1.43299 WP_000074540.1.43307 WP_000074540.1.43312 WP_000074540.1.4332 WP_000074540.1.43334 WP_000074540.1.43339 WP_000074540.1.43351 WP_000074540.1.43371 WP_000074540.1.43437 WP_000074540.1.43438 WP_000074540.1.4344 WP_000074540.1.43441 WP_000074540.1.43476 WP_000074540.1.43508 WP_000074540.1.43513 WP_000074540.1.43520 WP_000074540.1.43522 WP_000074540.1.43528 WP_000074540.1.43535 WP_000074540.1.43606 WP_000074540.1.43613 WP_000074540.1.43633 WP_000074540.1.43637 WP_000074540.1.43651 WP_000074540.1.43654 WP_000074540.1.43668 WP_000074540.1.43676 WP_000074540.1.43685 WP_000074540.1.43710 WP_000074540.1.43711 WP_000074540.1.43722 WP_000074540.1.4373 WP_000074540.1.43763 WP_000074540.1.43778 WP_000074540.1.43782 WP_000074540.1.43785 WP_000074540.1.43801 WP_000074540.1.43812 WP_000074540.1.43828 WP_000074540.1.43839 WP_000074540.1.43864 WP_000074540.1.43873 WP_000074540.1.43875 WP_000074540.1.43878 WP_000074540.1.43886 WP_000074540.1.43888 WP_000074540.1.43919 WP_000074540.1.43954 WP_000074540.1.43974 WP_000074540.1.44010 WP_000074540.1.4404 WP_000074540.1.44043 WP_000074540.1.44049 WP_000074540.1.4405 WP_000074540.1.44063 WP_000074540.1.44099 WP_000074540.1.44101 WP_000074540.1.44113 WP_000074540.1.44121 WP_000074540.1.44132 WP_000074540.1.44144 WP_000074540.1.44160 WP_000074540.1.44180 WP_000074540.1.44191 WP_000074540.1.44196 WP_000074540.1.4422 WP_000074540.1.4423 WP_000074540.1.44248 WP_000074540.1.44250 WP_000074540.1.44262 WP_000074540.1.44268 WP_000074540.1.4427 WP_000074540.1.44291 WP_000074540.1.44296 WP_000074540.1.44300 WP_000074540.1.44310 WP_000074540.1.44337 WP_000074540.1.44339 WP_000074540.1.44343 WP_000074540.1.44351 WP_000074540.1.44359 WP_000074540.1.44360 WP_000074540.1.44380 WP_000074540.1.44397 WP_000074540.1.4440 WP_000074540.1.44416 WP_000074540.1.44431 WP_000074540.1.44433 WP_000074540.1.44437 WP_000074540.1.44438 WP_000074540.1.44440 WP_000074540.1.44443 WP_000074540.1.44474 WP_000074540.1.44479 WP_000074540.1.44546 WP_000074540.1.44549 WP_000074540.1.44578 WP_000074540.1.44593 WP_000074540.1.44606 WP_000074540.1.44607 WP_000074540.1.44633 WP_000074540.1.44636 WP_000074540.1.44640 WP_000074540.1.4467 WP_000074540.1.44678 WP_000074540.1.4468 WP_000074540.1.44687 WP_000074540.1.44702 WP_000074540.1.44705 WP_000074540.1.44747 WP_000074540.1.44762 WP_000074540.1.44781 WP_000074540.1.44791 WP_000074540.1.44795 WP_000074540.1.44815 WP_000074540.1.44828 WP_000074540.1.44831 WP_000074540.1.44833 WP_000074540.1.4485 WP_000074540.1.44877 WP_000074540.1.44879 WP_000074540.1.44887 WP_000074540.1.449 WP_000074540.1.44917 WP_000074540.1.44927 WP_000074540.1.44933 WP_000074540.1.44943 WP_000074540.1.44950 WP_000074540.1.44966 WP_000074540.1.44971 WP_000074540.1.44978 WP_000074540.1.44985 WP_000074540.1.44996 WP_000074540.1.44997 WP_000074540.1.44998 WP_000074540.1.4500 WP_000074540.1.4501 WP_000074540.1.45027 WP_000074540.1.45045 WP_000074540.1.4505 WP_000074540.1.45067 WP_000074540.1.45072 WP_000074540.1.45074 WP_000074540.1.45079 WP_000074540.1.45093 WP_000074540.1.45098 WP_000074540.1.45123 WP_000074540.1.45136 WP_000074540.1.45138 WP_000074540.1.45145 WP_000074540.1.45154 WP_000074540.1.45173 WP_000074540.1.45177 WP_000074540.1.45184 WP_000074540.1.45229 WP_000074540.1.45241 WP_000074540.1.45259 WP_000074540.1.45268 WP_000074540.1.45302 WP_000074540.1.4531 WP_000074540.1.45322 WP_000074540.1.45344 WP_000074540.1.45349 WP_000074540.1.45351 WP_000074540.1.45365 WP_000074540.1.4540 WP_000074540.1.45402 WP_000074540.1.45432 WP_000074540.1.45434 WP_000074540.1.45435 WP_000074540.1.45462 WP_000074540.1.45468 WP_000074540.1.45522 WP_000074540.1.45523 WP_000074540.1.45535 WP_000074540.1.45544 WP_000074540.1.45549 WP_000074540.1.45550 WP_000074540.1.45566 WP_000074540.1.45569 WP_000074540.1.45571 WP_000074540.1.45582 WP_000074540.1.45583 WP_000074540.1.45585 WP_000074540.1.45596 WP_000074540.1.45622 WP_000074540.1.45648 WP_000074540.1.45660 WP_000074540.1.45690 WP_000074540.1.45781 WP_000074540.1.45797 WP_000074540.1.458 WP_000074540.1.45829 WP_000074540.1.45844 WP_000074540.1.45848 WP_000074540.1.45871 WP_000074540.1.45906 WP_000074540.1.45918 WP_000074540.1.4592 WP_000074540.1.45973 WP_000074540.1.45984 WP_000074540.1.46011 WP_000074540.1.46028 WP_000074540.1.46030 WP_000074540.1.46069 WP_000074540.1.46077 WP_000074540.1.46091 WP_000074540.1.46112 WP_000074540.1.46124 WP_000074540.1.46169 WP_000074540.1.46173 WP_000074540.1.46174 WP_000074540.1.46187 WP_000074540.1.46203 WP_000074540.1.46205 WP_000074540.1.46215 WP_000074540.1.46225 WP_000074540.1.46232 WP_000074540.1.46241 WP_000074540.1.46243 WP_000074540.1.46250 WP_000074540.1.46278 WP_000074540.1.46286 WP_000074540.1.46299 WP_000074540.1.46303 WP_000074540.1.46307 WP_000074540.1.46322 WP_000074540.1.46323 WP_000074540.1.46345 WP_000074540.1.46355 WP_000074540.1.46358 WP_000074540.1.464 WP_000074540.1.46406 WP_000074540.1.46434 WP_000074540.1.46444 WP_000074540.1.46454 WP_000074540.1.46461 WP_000074540.1.46504 WP_000074540.1.46505 WP_000074540.1.46551 WP_000074540.1.46559 WP_000074540.1.46572 WP_000074540.1.46574 WP_000074540.1.46578 WP_000074540.1.46595 WP_000074540.1.46620 WP_000074540.1.46666 WP_000074540.1.46675 WP_000074540.1.46689 WP_000074540.1.46693 WP_000074540.1.46701 WP_000074540.1.4671 WP_000074540.1.46726 WP_000074540.1.46730 WP_000074540.1.46732 WP_000074540.1.4674 WP_000074540.1.46749 WP_000074540.1.46781 WP_000074540.1.46803 WP_000074540.1.46804 WP_000074540.1.46816 WP_000074540.1.46842 WP_000074540.1.4686 WP_000074540.1.4690 WP_000074540.1.46920 WP_000074540.1.46930 WP_000074540.1.46945 WP_000074540.1.46961 WP_000074540.1.46967 WP_000074540.1.46976 WP_000074540.1.47008 WP_000074540.1.47014 WP_000074540.1.47023 WP_000074540.1.47036 WP_000074540.1.47037 WP_000074540.1.47042 WP_000074540.1.47057 WP_000074540.1.47058 WP_000074540.1.47059 WP_000074540.1.47061 WP_000074540.1.47067 WP_000074540.1.47085 WP_000074540.1.47110 WP_000074540.1.47123 WP_000074540.1.47214 WP_000074540.1.47215 WP_000074540.1.47243 WP_000074540.1.47245 WP_000074540.1.47257 WP_000074540.1.47389 WP_000074540.1.47429 WP_000074540.1.47442 WP_000074540.1.47448 WP_000074540.1.47460 WP_000074540.1.4747 WP_000074540.1.47472 WP_000074540.1.47478 WP_000074540.1.47482 WP_000074540.1.47492 WP_000074540.1.47506 WP_000074540.1.47507 WP_000074540.1.47523 WP_000074540.1.47531 WP_000074540.1.47532 WP_000074540.1.47542 WP_000074540.1.47567 WP_000074540.1.47576 WP_000074540.1.47579 WP_000074540.1.4758 WP_000074540.1.47587 WP_000074540.1.47605 WP_000074540.1.47621 WP_000074540.1.47630 WP_000074540.1.47660 WP_000074540.1.4769 WP_000074540.1.4770 WP_000074540.1.4774 WP_000074540.1.4775 WP_000074540.1.47756 WP_000074540.1.47767 WP_000074540.1.47799 WP_000074540.1.4781 WP_000074540.1.47814 WP_000074540.1.47817 WP_000074540.1.47829 WP_000074540.1.47849 WP_000074540.1.47850 WP_000074540.1.47875 WP_000074540.1.47886 WP_000074540.1.47898 WP_000074540.1.47911 WP_000074540.1.47928 WP_000074540.1.4795 WP_000074540.1.47988 WP_000074540.1.47992 WP_000074540.1.48019 WP_000074540.1.48100 WP_000074540.1.48114 WP_000074540.1.48124 WP_000074540.1.48132 WP_000074540.1.48134 WP_000074540.1.48139 WP_000074540.1.48190 WP_000074540.1.48209 WP_000074540.1.48215 WP_000074540.1.48218 WP_000074540.1.48242 WP_000074540.1.48244 WP_000074540.1.48247 WP_000074540.1.48253 WP_000074540.1.48262 WP_000074540.1.48268 WP_000074540.1.48292 WP_000074540.1.483 WP_000074540.1.48324 WP_000074540.1.48367 WP_000074540.1.48377 WP_000074540.1.4839 WP_000074540.1.48399 WP_000074540.1.48426 WP_000074540.1.48430 WP_000074540.1.48436 WP_000074540.1.48455 WP_000074540.1.48493 WP_000074540.1.48510 WP_000074540.1.4853 WP_000074540.1.48570 WP_000074540.1.48586 WP_000074540.1.4859 WP_000074540.1.48591 WP_000074540.1.48610 WP_000074540.1.48631 WP_000074540.1.48647 WP_000074540.1.48651 WP_000074540.1.48663 WP_000074540.1.48690 WP_000074540.1.48734 WP_000074540.1.48751 WP_000074540.1.48755 WP_000074540.1.48756 WP_000074540.1.48768 WP_000074540.1.48774 WP_000074540.1.48778 WP_000074540.1.48788 WP_000074540.1.48797 WP_000074540.1.48841 WP_000074540.1.48849 WP_000074540.1.4885 WP_000074540.1.48855 WP_000074540.1.48876 WP_000074540.1.48886 WP_000074540.1.48894 WP_000074540.1.48896 WP_000074540.1.48908 WP_000074540.1.48918 WP_000074540.1.48919 WP_000074540.1.48931 WP_000074540.1.48955 WP_000074540.1.48963 WP_000074540.1.48973 WP_000074540.1.48985 WP_000074540.1.49004 WP_000074540.1.49005 WP_000074540.1.49012 WP_000074540.1.49084 WP_000074540.1.49090 WP_000074540.1.49102 WP_000074540.1.49106 WP_000074540.1.49113 WP_000074540.1.49117 WP_000074540.1.49121 WP_000074540.1.4914 WP_000074540.1.49140 WP_000074540.1.49153 WP_000074540.1.49155 WP_000074540.1.49162 WP_000074540.1.49166 WP_000074540.1.49175 WP_000074540.1.49204 WP_000074540.1.49214 WP_000074540.1.49226 WP_000074540.1.49233 WP_000074540.1.49239 WP_000074540.1.49256 WP_000074540.1.49262 WP_000074540.1.49276 WP_000074540.1.49290 WP_000074540.1.49304 WP_000074540.1.49309 WP_000074540.1.49311 WP_000074540.1.49334 WP_000074540.1.49340 WP_000074540.1.49355 WP_000074540.1.49358 WP_000074540.1.49366 WP_000074540.1.49375 WP_000074540.1.49429 WP_000074540.1.49430 WP_000074540.1.49434 WP_000074540.1.49443 WP_000074540.1.49450 WP_000074540.1.49472 WP_000074540.1.49490 WP_000074540.1.49494 WP_000074540.1.495 WP_000074540.1.49515 WP_000074540.1.49545 WP_000074540.1.49550 WP_000074540.1.49572 WP_000074540.1.49574 WP_000074540.1.49590 WP_000074540.1.49595 WP_000074540.1.49602 WP_000074540.1.49626 WP_000074540.1.49630 WP_000074540.1.49647 WP_000074540.1.49650 WP_000074540.1.49686 WP_000074540.1.49703 WP_000074540.1.49769 WP_000074540.1.49770 WP_000074540.1.49778 WP_000074540.1.49780 WP_000074540.1.4979 WP_000074540.1.49790 WP_000074540.1.49803 WP_000074540.1.49805 WP_000074540.1.49827 WP_000074540.1.49846 WP_000074540.1.49848 WP_000074540.1.4991 WP_000074540.1.49929 WP_000074540.1.49931 WP_000074540.1.49947 WP_000074540.1.49959 WP_000074540.1.49997 WP_000074540.1.50 WP_000074540.1.50003 WP_000074540.1.50007 WP_000074540.1.50014 WP_000074540.1.50030 WP_000074540.1.50043 WP_000074540.1.50080 WP_000074540.1.5009 WP_000074540.1.50103 WP_000074540.1.50128 WP_000074540.1.50153 WP_000074540.1.50158 WP_000074540.1.50161 WP_000074540.1.50198 WP_000074540.1.50238 WP_000074540.1.50239 WP_000074540.1.50247 WP_000074540.1.50251 WP_000074540.1.50285 WP_000074540.1.50308 WP_000074540.1.50309 WP_000074540.1.50332 WP_000074540.1.50349 WP_000074540.1.50374 WP_000074540.1.50376 WP_000074540.1.50386 WP_000074540.1.50387 WP_000074540.1.50389 WP_000074540.1.50404 WP_000074540.1.50406 WP_000074540.1.50449 WP_000074540.1.50468 WP_000074540.1.50469 WP_000074540.1.50478 WP_000074540.1.50480 WP_000074540.1.50497 WP_000074540.1.5051 WP_000074540.1.50517 WP_000074540.1.50529 WP_000074540.1.50563 WP_000074540.1.50565 WP_000074540.1.50566 WP_000074540.1.50570 WP_000074540.1.50576 WP_000074540.1.50593 WP_000074540.1.50626 WP_000074540.1.50652 WP_000074540.1.50676 WP_000074540.1.50684 WP_000074540.1.50726 WP_000074540.1.50750 WP_000074540.1.50769 WP_000074540.1.50771 WP_000074540.1.50774 WP_000074540.1.50777 WP_000074540.1.50782 WP_000074540.1.50800 WP_000074540.1.50804 WP_000074540.1.50808 WP_000074540.1.50811 WP_000074540.1.50875 WP_000074540.1.5088 WP_000074540.1.50882 WP_000074540.1.50885 WP_000074540.1.50893 WP_000074540.1.509 WP_000074540.1.50905 WP_000074540.1.50908 WP_000074540.1.50918 WP_000074540.1.50929 WP_000074540.1.50941 WP_000074540.1.50954 WP_000074540.1.50960 WP_000074540.1.50970 WP_000074540.1.50999 WP_000074540.1.51014 WP_000074540.1.51022 WP_000074540.1.51025 WP_000074540.1.51036 WP_000074540.1.51040 WP_000074540.1.51048 WP_000074540.1.51066 WP_000074540.1.51100 WP_000074540.1.51117 WP_000074540.1.51134 WP_000074540.1.51139 WP_000074540.1.5114 WP_000074540.1.51162 WP_000074540.1.51182 WP_000074540.1.51186 WP_000074540.1.51224 WP_000074540.1.51227 WP_000074540.1.5125 WP_000074540.1.5127 WP_000074540.1.51285 WP_000074540.1.51305 WP_000074540.1.51308 WP_000074540.1.51315 WP_000074540.1.51331 WP_000074540.1.51338 WP_000074540.1.51356 WP_000074540.1.5136 WP_000074540.1.5138 WP_000074540.1.51394 WP_000074540.1.51412 WP_000074540.1.51414 WP_000074540.1.51419 WP_000074540.1.51451 WP_000074540.1.51464 WP_000074540.1.51474 WP_000074540.1.51487 WP_000074540.1.51488 WP_000074540.1.51502 WP_000074540.1.51506 WP_000074540.1.51514 WP_000074540.1.51519 WP_000074540.1.51555 WP_000074540.1.51594 WP_000074540.1.51598 WP_000074540.1.51611 WP_000074540.1.51613 WP_000074540.1.51615 WP_000074540.1.51634 WP_000074540.1.51642 WP_000074540.1.51644 WP_000074540.1.51649 WP_000074540.1.51686 WP_000074540.1.51700 WP_000074540.1.51704 WP_000074540.1.51724 WP_000074540.1.51734 WP_000074540.1.51756 WP_000074540.1.51764 WP_000074540.1.51810 WP_000074540.1.51831 WP_000074540.1.51838 WP_000074540.1.51841 WP_000074540.1.5185 WP_000074540.1.51863 WP_000074540.1.51868 WP_000074540.1.51888 WP_000074540.1.51900 WP_000074540.1.51910 WP_000074540.1.51911 WP_000074540.1.51914 WP_000074540.1.51930 WP_000074540.1.51932 WP_000074540.1.51935 WP_000074540.1.51989 WP_000074540.1.51994 WP_000074540.1.520 WP_000074540.1.52047 WP_000074540.1.52057 WP_000074540.1.52101 WP_000074540.1.5211 WP_000074540.1.52114 WP_000074540.1.52121 WP_000074540.1.52123 WP_000074540.1.52129 WP_000074540.1.52148 WP_000074540.1.52156 WP_000074540.1.5216 WP_000074540.1.52161 WP_000074540.1.52170 WP_000074540.1.52191 WP_000074540.1.52202 WP_000074540.1.52209 WP_000074540.1.52255 WP_000074540.1.52321 WP_000074540.1.52336 WP_000074540.1.52339 WP_000074540.1.52346 WP_000074540.1.52353 WP_000074540.1.52356 WP_000074540.1.52361 WP_000074540.1.52438 WP_000074540.1.52446 WP_000074540.1.52456 WP_000074540.1.52469 WP_000074540.1.52528 WP_000074540.1.52571 WP_000074540.1.52582 WP_000074540.1.52586 WP_000074540.1.526 WP_000074540.1.52608 WP_000074540.1.52637 WP_000074540.1.52647 WP_000074540.1.52653 WP_000074540.1.52656 WP_000074540.1.52675 WP_000074540.1.52692 WP_000074540.1.5273 WP_000074540.1.52738 WP_000074540.1.52742 WP_000074540.1.52743 WP_000074540.1.52744 WP_000074540.1.52748 WP_000074540.1.52773 WP_000074540.1.52795 WP_000074540.1.52807 WP_000074540.1.52824 WP_000074540.1.52833 WP_000074540.1.52851 WP_000074540.1.52857 WP_000074540.1.52858 WP_000074540.1.52866 WP_000074540.1.52887 WP_000074540.1.52898 WP_000074540.1.52915 WP_000074540.1.52924 WP_000074540.1.52949 WP_000074540.1.52985 WP_000074540.1.5301 WP_000074540.1.53016 WP_000074540.1.53092 WP_000074540.1.53100 WP_000074540.1.53107 WP_000074540.1.53119 WP_000074540.1.5313 WP_000074540.1.53141 WP_000074540.1.53151 WP_000074540.1.53154 WP_000074540.1.53158 WP_000074540.1.53159 WP_000074540.1.5316 WP_000074540.1.53179 WP_000074540.1.53198 WP_000074540.1.53203 WP_000074540.1.53206 WP_000074540.1.53210 WP_000074540.1.53233 WP_000074540.1.53234 WP_000074540.1.53272 WP_000074540.1.53274 WP_000074540.1.53286 WP_000074540.1.53307 WP_000074540.1.53315 WP_000074540.1.53316 WP_000074540.1.53321 WP_000074540.1.53328 WP_000074540.1.5333 WP_000074540.1.53362 WP_000074540.1.53368 WP_000074540.1.53375 WP_000074540.1.53385 WP_000074540.1.53406 WP_000074540.1.53436 WP_000074540.1.53450 WP_000074540.1.53454 WP_000074540.1.53466 WP_000074540.1.5349 WP_000074540.1.53529 WP_000074540.1.53534 WP_000074540.1.53540 WP_000074540.1.53543 WP_000074540.1.53555 WP_000074540.1.53559 WP_000074540.1.5356 WP_000074540.1.53567 WP_000074540.1.53571 WP_000074540.1.5358 WP_000074540.1.53664 WP_000074540.1.53675 WP_000074540.1.53688 WP_000074540.1.53692 WP_000074540.1.53694 WP_000074540.1.53723 WP_000074540.1.5374 WP_000074540.1.53750 WP_000074540.1.53757 WP_000074540.1.53778 WP_000074540.1.53781 WP_000074540.1.53790 WP_000074540.1.53800 WP_000074540.1.53812 WP_000074540.1.53814 WP_000074540.1.53815 WP_000074540.1.53839 WP_000074540.1.53892 WP_000074540.1.53896 WP_000074540.1.53898 WP_000074540.1.53902 WP_000074540.1.53905 WP_000074540.1.53935 WP_000074540.1.53958 WP_000074540.1.53961 WP_000074540.1.53981 WP_000074540.1.53984 WP_000074540.1.54033 WP_000074540.1.54061 WP_000074540.1.54075 WP_000074540.1.54082 WP_000074540.1.54085 WP_000074540.1.54132 WP_000074540.1.54136 WP_000074540.1.54159 WP_000074540.1.54170 WP_000074540.1.54175 WP_000074540.1.54196 WP_000074540.1.542 WP_000074540.1.54203 WP_000074540.1.54209 WP_000074540.1.54259 WP_000074540.1.54271 WP_000074540.1.54273 WP_000074540.1.54274 WP_000074540.1.54283 WP_000074540.1.5430 WP_000074540.1.54319 WP_000074540.1.54324 WP_000074540.1.54333 WP_000074540.1.54340 WP_000074540.1.54364 WP_000074540.1.54366 WP_000074540.1.54371 WP_000074540.1.54400 WP_000074540.1.54431 WP_000074540.1.54442 WP_000074540.1.54469 WP_000074540.1.54482 WP_000074540.1.54500 WP_000074540.1.54522 WP_000074540.1.54526 WP_000074540.1.54558 WP_000074540.1.5456 WP_000074540.1.54569 WP_000074540.1.54589 WP_000074540.1.5459 WP_000074540.1.54607 WP_000074540.1.54615 WP_000074540.1.5462 WP_000074540.1.54644 WP_000074540.1.54662 WP_000074540.1.54667 WP_000074540.1.54678 WP_000074540.1.54681 WP_000074540.1.54694 WP_000074540.1.54722 WP_000074540.1.54748 WP_000074540.1.54749 WP_000074540.1.54764 WP_000074540.1.54774 WP_000074540.1.5481 WP_000074540.1.54814 WP_000074540.1.54822 WP_000074540.1.54827 WP_000074540.1.54833 WP_000074540.1.54845 WP_000074540.1.5485 WP_000074540.1.54865 WP_000074540.1.54877 WP_000074540.1.5493 WP_000074540.1.54935 WP_000074540.1.54936 WP_000074540.1.54979 WP_000074540.1.54984 WP_000074540.1.54992 WP_000074540.1.55008 WP_000074540.1.55010 WP_000074540.1.55034 WP_000074540.1.55073 WP_000074540.1.55152 WP_000074540.1.55156 WP_000074540.1.55163 WP_000074540.1.55165 WP_000074540.1.55166 WP_000074540.1.5517 WP_000074540.1.55200 WP_000074540.1.55215 WP_000074540.1.55223 WP_000074540.1.55224 WP_000074540.1.5523 WP_000074540.1.5525 WP_000074540.1.5527 WP_000074540.1.55285 WP_000074540.1.55290 WP_000074540.1.55310 WP_000074540.1.55317 WP_000074540.1.55325 WP_000074540.1.55361 WP_000074540.1.55379 WP_000074540.1.5539 WP_000074540.1.55418 WP_000074540.1.55430 WP_000074540.1.55461 WP_000074540.1.55468 WP_000074540.1.55475 WP_000074540.1.55477 WP_000074540.1.55496 WP_000074540.1.55500 WP_000074540.1.55506 WP_000074540.1.5552 WP_000074540.1.55528 WP_000074540.1.55545 WP_000074540.1.5555 WP_000074540.1.55554 WP_000074540.1.55557 WP_000074540.1.55559 WP_000074540.1.5560 WP_000074540.1.55604 WP_000074540.1.55623 WP_000074540.1.55639 WP_000074540.1.55640 WP_000074540.1.55647 WP_000074540.1.55672 WP_000074540.1.55680 WP_000074540.1.55699 WP_000074540.1.55706 WP_000074540.1.55718 WP_000074540.1.5572 WP_000074540.1.55725 WP_000074540.1.55743 WP_000074540.1.55768 WP_000074540.1.5577 WP_000074540.1.55780 WP_000074540.1.55782 WP_000074540.1.55796 WP_000074540.1.55803 WP_000074540.1.55853 WP_000074540.1.55923 WP_000074540.1.55948 WP_000074540.1.55967 WP_000074540.1.55973 WP_000074540.1.55993 WP_000074540.1.55995 WP_000074540.1.56002 WP_000074540.1.56004 WP_000074540.1.56012 WP_000074540.1.56026 WP_000074540.1.56059 WP_000074540.1.56069 WP_000074540.1.56070 WP_000074540.1.56082 WP_000074540.1.56097 WP_000074540.1.56100 WP_000074540.1.56105 WP_000074540.1.56130 WP_000074540.1.56144 WP_000074540.1.56152 WP_000074540.1.56172 WP_000074540.1.5621 WP_000074540.1.56222 WP_000074540.1.56226 WP_000074540.1.56235 WP_000074540.1.56238 WP_000074540.1.56244 WP_000074540.1.56247 WP_000074540.1.56261 WP_000074540.1.56263 WP_000074540.1.56286 WP_000074540.1.56303 WP_000074540.1.56304 WP_000074540.1.56305 WP_000074540.1.56311 WP_000074540.1.5633 WP_000074540.1.56354 WP_000074540.1.56368 WP_000074540.1.56370 WP_000074540.1.56374 WP_000074540.1.56385 WP_000074540.1.56393 WP_000074540.1.56396 WP_000074540.1.56413 WP_000074540.1.56414 WP_000074540.1.56419 WP_000074540.1.56420 WP_000074540.1.56423 WP_000074540.1.56438 WP_000074540.1.56468 WP_000074540.1.56512 WP_000074540.1.56514 WP_000074540.1.56535 WP_000074540.1.56559 WP_000074540.1.56560 WP_000074540.1.56585 WP_000074540.1.56597 WP_000074540.1.56601 WP_000074540.1.56614 WP_000074540.1.56640 WP_000074540.1.56642 WP_000074540.1.56647 WP_000074540.1.56651 WP_000074540.1.56660 WP_000074540.1.56671 WP_000074540.1.5668 WP_000074540.1.56682 WP_000074540.1.56724 WP_000074540.1.56791 WP_000074540.1.56824 WP_000074540.1.56825 WP_000074540.1.56851 WP_000074540.1.56853 WP_000074540.1.56861 WP_000074540.1.56875 WP_000074540.1.56877 WP_000074540.1.56887 WP_000074540.1.56889 WP_000074540.1.56898 WP_000074540.1.56905 WP_000074540.1.56942 WP_000074540.1.56950 WP_000074540.1.56981 WP_000074540.1.57000 WP_000074540.1.57026 WP_000074540.1.57039 WP_000074540.1.57056 WP_000074540.1.57076 WP_000074540.1.57084 WP_000074540.1.57101 WP_000074540.1.5711 WP_000074540.1.57125 WP_000074540.1.57137 WP_000074540.1.57143 WP_000074540.1.57147 WP_000074540.1.57149 WP_000074540.1.57168 WP_000074540.1.57179 WP_000074540.1.57186 WP_000074540.1.57187 WP_000074540.1.57232 WP_000074540.1.57233 WP_000074540.1.57244 WP_000074540.1.57246 WP_000074540.1.57296 WP_000074540.1.57307 WP_000074540.1.57342 WP_000074540.1.57344 WP_000074540.1.57356 WP_000074540.1.57357 WP_000074540.1.57362 WP_000074540.1.57377 WP_000074540.1.57399 WP_000074540.1.57418 WP_000074540.1.57433 WP_000074540.1.57494 WP_000074540.1.57495 WP_000074540.1.57510 WP_000074540.1.57515 WP_000074540.1.57521 WP_000074540.1.57529 WP_000074540.1.5753 WP_000074540.1.57534 WP_000074540.1.57555 WP_000074540.1.57559 WP_000074540.1.57576 WP_000074540.1.57601 WP_000074540.1.57607 WP_000074540.1.5761 WP_000074540.1.57631 WP_000074540.1.57641 WP_000074540.1.57684 WP_000074540.1.57699 WP_000074540.1.57709 WP_000074540.1.57735 WP_000074540.1.5774 WP_000074540.1.57763 WP_000074540.1.57778 WP_000074540.1.57781 WP_000074540.1.57785 WP_000074540.1.57797 WP_000074540.1.57800 WP_000074540.1.5781 WP_000074540.1.57835 WP_000074540.1.57857 WP_000074540.1.57862 WP_000074540.1.57873 WP_000074540.1.57890 WP_000074540.1.57891 WP_000074540.1.57893 WP_000074540.1.57902 WP_000074540.1.57965 WP_000074540.1.57972 WP_000074540.1.57978 WP_000074540.1.58008 WP_000074540.1.5801 WP_000074540.1.58040 WP_000074540.1.58041 WP_000074540.1.58044 WP_000074540.1.58081 WP_000074540.1.5809 WP_000074540.1.58090 WP_000074540.1.58131 WP_000074540.1.58132 WP_000074540.1.58144 WP_000074540.1.58153 WP_000074540.1.58157 WP_000074540.1.58173 WP_000074540.1.58191 WP_000074540.1.58194 WP_000074540.1.58239 WP_000074540.1.58249 WP_000074540.1.58251 WP_000074540.1.58252 WP_000074540.1.58261 WP_000074540.1.58274 WP_000074540.1.5828 WP_000074540.1.58282 WP_000074540.1.58290 WP_000074540.1.58301 WP_000074540.1.58324 WP_000074540.1.58326 WP_000074540.1.58334 WP_000074540.1.58357 WP_000074540.1.58358 WP_000074540.1.5836 WP_000074540.1.58372 WP_000074540.1.58407 WP_000074540.1.58416 WP_000074540.1.58418 WP_000074540.1.58442 WP_000074540.1.58443 WP_000074540.1.58451 WP_000074540.1.5846 WP_000074540.1.58467 WP_000074540.1.58485 WP_000074540.1.58486 WP_000074540.1.58489 WP_000074540.1.58537 WP_000074540.1.5854 WP_000074540.1.58548 WP_000074540.1.58564 WP_000074540.1.58568 WP_000074540.1.5858 WP_000074540.1.58583 WP_000074540.1.58633 WP_000074540.1.58648 WP_000074540.1.58652 WP_000074540.1.58662 WP_000074540.1.58663 WP_000074540.1.58669 WP_000074540.1.58675 WP_000074540.1.58698 WP_000074540.1.587 WP_000074540.1.58724 WP_000074540.1.58729 WP_000074540.1.58744 WP_000074540.1.58749 WP_000074540.1.5875 WP_000074540.1.5878 WP_000074540.1.58796 WP_000074540.1.58803 WP_000074540.1.58807 WP_000074540.1.58831 WP_000074540.1.58834 WP_000074540.1.58836 WP_000074540.1.58847 WP_000074540.1.5886 WP_000074540.1.58861 WP_000074540.1.58883 WP_000074540.1.58884 WP_000074540.1.58898 WP_000074540.1.58926 WP_000074540.1.58932 WP_000074540.1.58949 WP_000074540.1.58963 WP_000074540.1.58970 WP_000074540.1.58974 WP_000074540.1.59006 WP_000074540.1.59012 WP_000074540.1.59020 WP_000074540.1.59043 WP_000074540.1.59056 WP_000074540.1.59061 WP_000074540.1.59064 WP_000074540.1.59068 WP_000074540.1.59084 WP_000074540.1.59094 WP_000074540.1.59097 WP_000074540.1.59125 WP_000074540.1.59136 WP_000074540.1.59142 WP_000074540.1.59148 WP_000074540.1.59163 WP_000074540.1.59224 WP_000074540.1.59236 WP_000074540.1.59276 WP_000074540.1.59282 WP_000074540.1.5929 WP_000074540.1.59294 WP_000074540.1.59295 WP_000074540.1.59299 WP_000074540.1.59313 WP_000074540.1.59321 WP_000074540.1.59335 WP_000074540.1.59375 WP_000074540.1.59381 WP_000074540.1.59412 WP_000074540.1.59420 WP_000074540.1.59427 WP_000074540.1.59439 WP_000074540.1.59458 WP_000074540.1.59486 WP_000074540.1.5949 WP_000074540.1.59490 WP_000074540.1.59501 WP_000074540.1.59508 WP_000074540.1.59510 WP_000074540.1.59512 WP_000074540.1.5953 WP_000074540.1.59538 WP_000074540.1.59548 WP_000074540.1.59562 WP_000074540.1.59587 WP_000074540.1.59604 WP_000074540.1.59636 WP_000074540.1.59641 WP_000074540.1.59646 WP_000074540.1.59648 WP_000074540.1.59684 WP_000074540.1.5969 WP_000074540.1.59694 WP_000074540.1.59709 WP_000074540.1.59751 WP_000074540.1.59755 WP_000074540.1.59771 WP_000074540.1.5979 WP_000074540.1.59827 WP_000074540.1.59829 WP_000074540.1.59830 WP_000074540.1.59847 WP_000074540.1.59848 WP_000074540.1.59863 WP_000074540.1.59928 WP_000074540.1.5993 WP_000074540.1.59953 WP_000074540.1.59969 WP_000074540.1.59979 WP_000074540.1.59994 WP_000074540.1.60004 WP_000074540.1.60008 WP_000074540.1.60015 WP_000074540.1.60021 WP_000074540.1.60045 WP_000074540.1.60052 WP_000074540.1.60069 WP_000074540.1.60076 WP_000074540.1.60106 WP_000074540.1.60114 WP_000074540.1.60126 WP_000074540.1.60137 WP_000074540.1.60140 WP_000074540.1.60154 WP_000074540.1.60155 WP_000074540.1.60168 WP_000074540.1.60192 WP_000074540.1.60199 WP_000074540.1.60209 WP_000074540.1.60212 WP_000074540.1.60213 WP_000074540.1.60226 WP_000074540.1.60231 WP_000074540.1.60253 WP_000074540.1.60320 WP_000074540.1.60322 WP_000074540.1.60324 WP_000074540.1.6033 WP_000074540.1.60330 WP_000074540.1.60356 WP_000074540.1.60370 WP_000074540.1.60379 WP_000074540.1.6038 WP_000074540.1.60380 WP_000074540.1.6041 WP_000074540.1.60424 WP_000074540.1.60425 WP_000074540.1.60464 WP_000074540.1.60469 WP_000074540.1.60481 WP_000074540.1.60486 WP_000074540.1.605 WP_000074540.1.60503 WP_000074540.1.60507 WP_000074540.1.6052 WP_000074540.1.60545 WP_000074540.1.60560 WP_000074540.1.60561 WP_000074540.1.6058 WP_000074540.1.60584 WP_000074540.1.60597 WP_000074540.1.6060 WP_000074540.1.60608 WP_000074540.1.60643 WP_000074540.1.60661 WP_000074540.1.60676 WP_000074540.1.60708 WP_000074540.1.60713 WP_000074540.1.60725 WP_000074540.1.60746 WP_000074540.1.60760 WP_000074540.1.60772 WP_000074540.1.60783 WP_000074540.1.60792 WP_000074540.1.60794 WP_000074540.1.608 WP_000074540.1.60807 WP_000074540.1.60809 WP_000074540.1.60838 WP_000074540.1.60851 WP_000074540.1.60855 WP_000074540.1.60857 WP_000074540.1.6086 WP_000074540.1.60863 WP_000074540.1.60866 WP_000074540.1.60882 WP_000074540.1.60889 WP_000074540.1.60897 WP_000074540.1.6090 WP_000074540.1.60919 WP_000074540.1.60926 WP_000074540.1.60941 WP_000074540.1.60950 WP_000074540.1.60976 WP_000074540.1.60988 WP_000074540.1.60990 WP_000074540.1.6104 WP_000074540.1.61044 WP_000074540.1.61076 WP_000074540.1.61078 WP_000074540.1.6108 WP_000074540.1.61087 WP_000074540.1.61114 WP_000074540.1.61123 WP_000074540.1.61146 WP_000074540.1.61147 WP_000074540.1.61168 WP_000074540.1.61184 WP_000074540.1.61200 WP_000074540.1.61210 WP_000074540.1.61218 WP_000074540.1.61232 WP_000074540.1.61233 WP_000074540.1.6129 WP_000074540.1.61296 WP_000074540.1.61309 WP_000074540.1.61345 WP_000074540.1.61356 WP_000074540.1.61357 WP_000074540.1.61381 WP_000074540.1.61417 WP_000074540.1.6143 WP_000074540.1.61434 WP_000074540.1.61497 WP_000074540.1.61501 WP_000074540.1.61509 WP_000074540.1.61511 WP_000074540.1.61519 WP_000074540.1.61539 WP_000074540.1.61542 WP_000074540.1.61553 WP_000074540.1.61574 WP_000074540.1.61582 WP_000074540.1.61594 WP_000074540.1.61595 WP_000074540.1.61609 WP_000074540.1.6164 WP_000074540.1.61649 WP_000074540.1.61652 WP_000074540.1.61662 WP_000074540.1.61667 WP_000074540.1.61671 WP_000074540.1.61694 WP_000074540.1.61697 WP_000074540.1.61712 WP_000074540.1.61714 WP_000074540.1.61730 WP_000074540.1.61732 WP_000074540.1.61737 WP_000074540.1.61743 WP_000074540.1.61783 WP_000074540.1.61809 WP_000074540.1.61857 WP_000074540.1.61877 WP_000074540.1.6190 WP_000074540.1.61908 WP_000074540.1.61918 WP_000074540.1.61920 WP_000074540.1.61922 WP_000074540.1.61924 WP_000074540.1.61952 WP_000074540.1.61968 WP_000074540.1.62007 WP_000074540.1.62020 WP_000074540.1.62025 WP_000074540.1.62063 WP_000074540.1.62076 WP_000074540.1.6209 WP_000074540.1.6210 WP_000074540.1.62108 WP_000074540.1.62120 WP_000074540.1.62122 WP_000074540.1.62124 WP_000074540.1.62142 WP_000074540.1.62144 WP_000074540.1.62158 WP_000074540.1.62184 WP_000074540.1.62195 WP_000074540.1.62199 WP_000074540.1.62201 WP_000074540.1.62204 WP_000074540.1.62210 WP_000074540.1.62219 WP_000074540.1.62222 WP_000074540.1.62223 WP_000074540.1.62241 WP_000074540.1.62245 WP_000074540.1.62257 WP_000074540.1.62271 WP_000074540.1.62302 WP_000074540.1.62304 WP_000074540.1.62310 WP_000074540.1.62314 WP_000074540.1.62323 WP_000074540.1.62338 WP_000074540.1.62339 WP_000074540.1.62344 WP_000074540.1.62361 WP_000074540.1.62364 WP_000074540.1.62374 WP_000074540.1.62380 WP_000074540.1.62403 WP_000074540.1.62404 WP_000074540.1.62411 WP_000074540.1.62412 WP_000074540.1.62436 WP_000074540.1.62475 WP_000074540.1.62486 WP_000074540.1.62488 WP_000074540.1.62504 WP_000074540.1.62522 WP_000074540.1.6253 WP_000074540.1.62536 WP_000074540.1.62564 WP_000074540.1.62570 WP_000074540.1.62619 WP_000074540.1.62640 WP_000074540.1.62648 WP_000074540.1.62677 WP_000074540.1.62686 WP_000074540.1.62693 WP_000074540.1.627 WP_000074540.1.62725 WP_000074540.1.62745 WP_000074540.1.62751 WP_000074540.1.62757 WP_000074540.1.62798 WP_000074540.1.62825 WP_000074540.1.62828 WP_000074540.1.62853 WP_000074540.1.62903 WP_000074540.1.62910 WP_000074540.1.62913 WP_000074540.1.6292 WP_000074540.1.62932 WP_000074540.1.62955 WP_000074540.1.62960 WP_000074540.1.62976 WP_000074540.1.62983 WP_000074540.1.62988 WP_000074540.1.63025 WP_000074540.1.63043 WP_000074540.1.63045 WP_000074540.1.63063 WP_000074540.1.63069 WP_000074540.1.63087 WP_000074540.1.63102 WP_000074540.1.63118 WP_000074540.1.63129 WP_000074540.1.63135 WP_000074540.1.63150 WP_000074540.1.63155 WP_000074540.1.63169 WP_000074540.1.63181 WP_000074540.1.63186 WP_000074540.1.63203 WP_000074540.1.63229 WP_000074540.1.63234 WP_000074540.1.63243 WP_000074540.1.63250 WP_000074540.1.63256 WP_000074540.1.63290 WP_000074540.1.63297 WP_000074540.1.63358 WP_000074540.1.63382 WP_000074540.1.63422 WP_000074540.1.63432 WP_000074540.1.63448 WP_000074540.1.63461 WP_000074540.1.63479 WP_000074540.1.63497 WP_000074540.1.63499 WP_000074540.1.63509 WP_000074540.1.63513 WP_000074540.1.63514 WP_000074540.1.63525 WP_000074540.1.63529 WP_000074540.1.63532 WP_000074540.1.63568 WP_000074540.1.6357 WP_000074540.1.63577 WP_000074540.1.63583 WP_000074540.1.63585 WP_000074540.1.63592 WP_000074540.1.63603 WP_000074540.1.63633 WP_000074540.1.63663 WP_000074540.1.63664 WP_000074540.1.6367 WP_000074540.1.63677 WP_000074540.1.63690 WP_000074540.1.6370 WP_000074540.1.63718 WP_000074540.1.63731 WP_000074540.1.63736 WP_000074540.1.63748 WP_000074540.1.6375 WP_000074540.1.63757 WP_000074540.1.63766 WP_000074540.1.63781 WP_000074540.1.63782 WP_000074540.1.63797 WP_000074540.1.63816 WP_000074540.1.63824 WP_000074540.1.63831 WP_000074540.1.63834 WP_000074540.1.63851 WP_000074540.1.63860 WP_000074540.1.63863 WP_000074540.1.63864 WP_000074540.1.63866 WP_000074540.1.63876 WP_000074540.1.6389 WP_000074540.1.63901 WP_000074540.1.63903 WP_000074540.1.63912 WP_000074540.1.63934 WP_000074540.1.63955 WP_000074540.1.63963 WP_000074540.1.63977 WP_000074540.1.6399 WP_000074540.1.63992 WP_000074540.1.64007 WP_000074540.1.64010 WP_000074540.1.64018 WP_000074540.1.64032 WP_000074540.1.64034 WP_000074540.1.64046 WP_000074540.1.64072 WP_000074540.1.64085 WP_000074540.1.64087 WP_000074540.1.64109 WP_000074540.1.64121 WP_000074540.1.6415 WP_000074540.1.64157 WP_000074540.1.64208 WP_000074540.1.64217 WP_000074540.1.64229 WP_000074540.1.6423 WP_000074540.1.64242 WP_000074540.1.64244 WP_000074540.1.64266 WP_000074540.1.64293 WP_000074540.1.64294 WP_000074540.1.64332 WP_000074540.1.64350 WP_000074540.1.6437 WP_000074540.1.64374 WP_000074540.1.64376 WP_000074540.1.64385 WP_000074540.1.64389 WP_000074540.1.644 WP_000074540.1.64403 WP_000074540.1.64412 WP_000074540.1.64462 WP_000074540.1.64471 WP_000074540.1.64500 WP_000074540.1.64501 WP_000074540.1.64538 WP_000074540.1.64569 WP_000074540.1.64597 WP_000074540.1.64632 WP_000074540.1.64645 WP_000074540.1.64648 WP_000074540.1.64649 WP_000074540.1.64654 WP_000074540.1.64662 WP_000074540.1.64663 WP_000074540.1.64667 WP_000074540.1.64674 WP_000074540.1.64690 WP_000074540.1.64702 WP_000074540.1.64709 WP_000074540.1.64710 WP_000074540.1.64711 WP_000074540.1.64744 WP_000074540.1.64757 WP_000074540.1.64758 WP_000074540.1.64763 WP_000074540.1.64771 WP_000074540.1.64781 WP_000074540.1.64798 WP_000074540.1.64817 WP_000074540.1.64831 WP_000074540.1.64847 WP_000074540.1.6487 WP_000074540.1.6489 WP_000074540.1.64891 WP_000074540.1.64894 WP_000074540.1.64919 WP_000074540.1.64944 WP_000074540.1.64972 WP_000074540.1.64974 WP_000074540.1.64977 WP_000074540.1.65011 WP_000074540.1.65018 WP_000074540.1.65022 WP_000074540.1.65027 WP_000074540.1.65028 WP_000074540.1.65052 WP_000074540.1.65054 WP_000074540.1.65075 WP_000074540.1.6514 WP_000074540.1.65163 WP_000074540.1.65168 WP_000074540.1.65171 WP_000074540.1.65172 WP_000074540.1.65185 WP_000074540.1.65191 WP_000074540.1.65200 WP_000074540.1.65211 WP_000074540.1.65218 WP_000074540.1.65226 WP_000074540.1.65238 WP_000074540.1.65248 WP_000074540.1.65249 WP_000074540.1.6525 WP_000074540.1.65266 WP_000074540.1.65269 WP_000074540.1.65295 WP_000074540.1.65348 WP_000074540.1.6535 WP_000074540.1.65357 WP_000074540.1.65363 WP_000074540.1.65394 WP_000074540.1.65395 WP_000074540.1.65437 WP_000074540.1.65459 WP_000074540.1.65463 WP_000074540.1.65474 WP_000074540.1.65475 WP_000074540.1.65487 WP_000074540.1.6549 WP_000074540.1.65499 WP_000074540.1.6550 WP_000074540.1.65508 WP_000074540.1.65538 WP_000074540.1.6554 WP_000074540.1.65558 WP_000074540.1.65572 WP_000074540.1.6560 WP_000074540.1.65601 WP_000074540.1.6561 WP_000074540.1.65633 WP_000074540.1.6565 WP_000074540.1.65650 WP_000074540.1.65687 WP_000074540.1.65696 WP_000074540.1.65697 WP_000074540.1.65698 WP_000074540.1.65699 WP_000074540.1.6572 WP_000074540.1.65737 WP_000074540.1.6575 WP_000074540.1.65755 WP_000074540.1.65771 WP_000074540.1.65782 WP_000074540.1.65790 WP_000074540.1.65795 WP_000074540.1.65812 WP_000074540.1.65818 WP_000074540.1.65838 WP_000074540.1.65846 WP_000074540.1.65849 WP_000074540.1.65863 WP_000074540.1.65876 WP_000074540.1.65881 WP_000074540.1.65883 WP_000074540.1.65901 WP_000074540.1.6594 WP_000074540.1.65940 WP_000074540.1.65945 WP_000074540.1.6595 WP_000074540.1.65956 WP_000074540.1.65968 WP_000074540.1.65985 WP_000074540.1.66021 WP_000074540.1.66031 WP_000074540.1.66049 WP_000074540.1.66052 WP_000074540.1.66064 WP_000074540.1.66074 WP_000074540.1.66082 WP_000074540.1.66085 WP_000074540.1.66109 WP_000074540.1.66122 WP_000074540.1.66129 WP_000074540.1.66145 WP_000074540.1.66167 WP_000074540.1.66171 WP_000074540.1.66183 WP_000074540.1.6620 WP_000074540.1.66216 WP_000074540.1.66234 WP_000074540.1.66235 WP_000074540.1.66250 WP_000074540.1.66270 WP_000074540.1.66272 WP_000074540.1.66273 WP_000074540.1.66289 WP_000074540.1.6630 WP_000074540.1.66314 WP_000074540.1.66315 WP_000074540.1.66324 WP_000074540.1.66330 WP_000074540.1.6634 WP_000074540.1.66358 WP_000074540.1.66361 WP_000074540.1.66362 WP_000074540.1.66365 WP_000074540.1.66368 WP_000074540.1.6638 WP_000074540.1.66385 WP_000074540.1.6640 WP_000074540.1.66400 WP_000074540.1.66428 WP_000074540.1.66446 WP_000074540.1.66462 WP_000074540.1.6647 WP_000074540.1.66480 WP_000074540.1.66492 WP_000074540.1.66506 WP_000074540.1.66534 WP_000074540.1.66539 WP_000074540.1.66600 WP_000074540.1.66630 WP_000074540.1.66665 WP_000074540.1.66678 WP_000074540.1.66681 WP_000074540.1.66684 WP_000074540.1.66698 WP_000074540.1.66702 WP_000074540.1.66733 WP_000074540.1.66755 WP_000074540.1.66759 WP_000074540.1.6680 WP_000074540.1.66800 WP_000074540.1.66801 WP_000074540.1.66820 WP_000074540.1.66824 WP_000074540.1.66834 WP_000074540.1.66860 WP_000074540.1.66901 WP_000074540.1.6692 WP_000074540.1.66937 WP_000074540.1.66953 WP_000074540.1.66955 WP_000074540.1.66959 WP_000074540.1.66962 WP_000074540.1.66981 WP_000074540.1.67 WP_000074540.1.67024 WP_000074540.1.67037 WP_000074540.1.67042 WP_000074540.1.67045 WP_000074540.1.67075 WP_000074540.1.6710 WP_000074540.1.67101 WP_000074540.1.67143 WP_000074540.1.67173 WP_000074540.1.67175 WP_000074540.1.67181 WP_000074540.1.67184 WP_000074540.1.67201 WP_000074540.1.67211 WP_000074540.1.67228 WP_000074540.1.67235 WP_000074540.1.67237 WP_000074540.1.67268 WP_000074540.1.67279 WP_000074540.1.67288 WP_000074540.1.67336 WP_000074540.1.67339 WP_000074540.1.67347 WP_000074540.1.67374 WP_000074540.1.67387 WP_000074540.1.6739 WP_000074540.1.67394 WP_000074540.1.67397 WP_000074540.1.67403 WP_000074540.1.67405 WP_000074540.1.67424 WP_000074540.1.67430 WP_000074540.1.67442 WP_000074540.1.67465 WP_000074540.1.67539 WP_000074540.1.67552 WP_000074540.1.67556 WP_000074540.1.67576 WP_000074540.1.6760 WP_000074540.1.67604 WP_000074540.1.67617 WP_000074540.1.67619 WP_000074540.1.67625 WP_000074540.1.67627 WP_000074540.1.67633 WP_000074540.1.67637 WP_000074540.1.67641 WP_000074540.1.67657 WP_000074540.1.67673 WP_000074540.1.67682 WP_000074540.1.67700 WP_000074540.1.67705 WP_000074540.1.67707 WP_000074540.1.67718 WP_000074540.1.67729 WP_000074540.1.67731 WP_000074540.1.67772 WP_000074540.1.67774 WP_000074540.1.67776 WP_000074540.1.67803 WP_000074540.1.67814 WP_000074540.1.6782 WP_000074540.1.67820 WP_000074540.1.67825 WP_000074540.1.67827 WP_000074540.1.67829 WP_000074540.1.6785 WP_000074540.1.67887 WP_000074540.1.67905 WP_000074540.1.67910 WP_000074540.1.67924 WP_000074540.1.67932 WP_000074540.1.67954 WP_000074540.1.67969 WP_000074540.1.67970 WP_000074540.1.67988 WP_000074540.1.68 WP_000074540.1.68036 WP_000074540.1.68043 WP_000074540.1.68073 WP_000074540.1.68075 WP_000074540.1.6809 WP_000074540.1.68105 WP_000074540.1.68113 WP_000074540.1.68115 WP_000074540.1.68131 WP_000074540.1.68140 WP_000074540.1.68147 WP_000074540.1.68159 WP_000074540.1.68167 WP_000074540.1.68182 WP_000074540.1.6819 WP_000074540.1.68201 WP_000074540.1.68206 WP_000074540.1.6827 WP_000074540.1.68275 WP_000074540.1.68285 WP_000074540.1.6833 WP_000074540.1.68359 WP_000074540.1.68401 WP_000074540.1.68420 WP_000074540.1.68477 WP_000074540.1.68478 WP_000074540.1.6849 WP_000074540.1.685 WP_000074540.1.68514 WP_000074540.1.68532 WP_000074540.1.68547 WP_000074540.1.68564 WP_000074540.1.6857 WP_000074540.1.6858 WP_000074540.1.68589 WP_000074540.1.68591 WP_000074540.1.68629 WP_000074540.1.68652 WP_000074540.1.68655 WP_000074540.1.68656 WP_000074540.1.68658 WP_000074540.1.68677 WP_000074540.1.68688 WP_000074540.1.6869 WP_000074540.1.68690 WP_000074540.1.68742 WP_000074540.1.6875 WP_000074540.1.68770 WP_000074540.1.68778 WP_000074540.1.68787 WP_000074540.1.6879 WP_000074540.1.68809 WP_000074540.1.68816 WP_000074540.1.68818 WP_000074540.1.6882 WP_000074540.1.6883 WP_000074540.1.68893 WP_000074540.1.68894 WP_000074540.1.68895 WP_000074540.1.68914 WP_000074540.1.68928 WP_000074540.1.68958 WP_000074540.1.68966 WP_000074540.1.68975 WP_000074540.1.68999 WP_000074540.1.69001 WP_000074540.1.69006 WP_000074540.1.69011 WP_000074540.1.69029 WP_000074540.1.6904 WP_000074540.1.6905 WP_000074540.1.69053 WP_000074540.1.69058 WP_000074540.1.6907 WP_000074540.1.69080 WP_000074540.1.69086 WP_000074540.1.6913 WP_000074540.1.69131 WP_000074540.1.69139 WP_000074540.1.69146 WP_000074540.1.69151 WP_000074540.1.69170 WP_000074540.1.69210 WP_000074540.1.69236 WP_000074540.1.69255 WP_000074540.1.69270 WP_000074540.1.69273 WP_000074540.1.69282 WP_000074540.1.69288 WP_000074540.1.69296 WP_000074540.1.69320 WP_000074540.1.69346 WP_000074540.1.69357 WP_000074540.1.69359 WP_000074540.1.69371 WP_000074540.1.69376 WP_000074540.1.69385 WP_000074540.1.69396 WP_000074540.1.69397 WP_000074540.1.69433 WP_000074540.1.69465 WP_000074540.1.69466 WP_000074540.1.69485 WP_000074540.1.69515 WP_000074540.1.6954 WP_000074540.1.69554 WP_000074540.1.69564 WP_000074540.1.69575 WP_000074540.1.69588 WP_000074540.1.69592 WP_000074540.1.69597 WP_000074540.1.69611 WP_000074540.1.69616 WP_000074540.1.69636 WP_000074540.1.69642 WP_000074540.1.69644 WP_000074540.1.69656 WP_000074540.1.69657 WP_000074540.1.69690 WP_000074540.1.69696 WP_000074540.1.69704 WP_000074540.1.69710 WP_000074540.1.69754 WP_000074540.1.69758 WP_000074540.1.69760 WP_000074540.1.69767 WP_000074540.1.69785 WP_000074540.1.69787 WP_000074540.1.69790 WP_000074540.1.69807 WP_000074540.1.69808 WP_000074540.1.69817 WP_000074540.1.69839 WP_000074540.1.69848 WP_000074540.1.69890 WP_000074540.1.69923 WP_000074540.1.69948 WP_000074540.1.69953 WP_000074540.1.69965 WP_000074540.1.69975 WP_000074540.1.69977 WP_000074540.1.69982 WP_000074540.1.70003 WP_000074540.1.70010 WP_000074540.1.70028 WP_000074540.1.70047 WP_000074540.1.70049 WP_000074540.1.70058 WP_000074540.1.70061 WP_000074540.1.70087 WP_000074540.1.70088 WP_000074540.1.7010 WP_000074540.1.7014 WP_000074540.1.7016 WP_000074540.1.70169 WP_000074540.1.70183 WP_000074540.1.70205 WP_000074540.1.7021 WP_000074540.1.70240 WP_000074540.1.70241 WP_000074540.1.70248 WP_000074540.1.70249 WP_000074540.1.70261 WP_000074540.1.70269 WP_000074540.1.70272 WP_000074540.1.70281 WP_000074540.1.70289 WP_000074540.1.70290 WP_000074540.1.70303 WP_000074540.1.70314 WP_000074540.1.70321 WP_000074540.1.70326 WP_000074540.1.70327 WP_000074540.1.7033 WP_000074540.1.70355 WP_000074540.1.70427 WP_000074540.1.70433 WP_000074540.1.7044 WP_000074540.1.70440 WP_000074540.1.70447 WP_000074540.1.70485 WP_000074540.1.70488 WP_000074540.1.70491 WP_000074540.1.70523 WP_000074540.1.70531 WP_000074540.1.70545 WP_000074540.1.70547 WP_000074540.1.7055 WP_000074540.1.70580 WP_000074540.1.70596 WP_000074540.1.7060 WP_000074540.1.70623 WP_000074540.1.70643 WP_000074540.1.70644 WP_000074540.1.70662 WP_000074540.1.70671 WP_000074540.1.70678 WP_000074540.1.70679 WP_000074540.1.70683 WP_000074540.1.70685 WP_000074540.1.70708 WP_000074540.1.70712 WP_000074540.1.70717 WP_000074540.1.70731 WP_000074540.1.70732 WP_000074540.1.70733 WP_000074540.1.70761 WP_000074540.1.70772 WP_000074540.1.70785 WP_000074540.1.70792 WP_000074540.1.70797 WP_000074540.1.70837 WP_000074540.1.70845 WP_000074540.1.70846 WP_000074540.1.70869 WP_000074540.1.70883 WP_000074540.1.70899 WP_000074540.1.70914 WP_000074540.1.70922 WP_000074540.1.70929 WP_000074540.1.7093 WP_000074540.1.70948 WP_000074540.1.70959 WP_000074540.1.70969 WP_000074540.1.70971 WP_000074540.1.70977 WP_000074540.1.70981 WP_000074540.1.70985 WP_000074540.1.70986 WP_000074540.1.70995 WP_000074540.1.71007 WP_000074540.1.71010 WP_000074540.1.71023 WP_000074540.1.71039 WP_000074540.1.71057 WP_000074540.1.71069 WP_000074540.1.71081 WP_000074540.1.71088 WP_000074540.1.7110 WP_000074540.1.71116 WP_000074540.1.71117 WP_000074540.1.71120 WP_000074540.1.71146 WP_000074540.1.71150 WP_000074540.1.71165 WP_000074540.1.71171 WP_000074540.1.71172 WP_000074540.1.71184 WP_000074540.1.71186 WP_000074540.1.71188 WP_000074540.1.71201 WP_000074540.1.71202 WP_000074540.1.71243 WP_000074540.1.71248 WP_000074540.1.71268 WP_000074540.1.71299 WP_000074540.1.71305 WP_000074540.1.71306 WP_000074540.1.71337 WP_000074540.1.71363 WP_000074540.1.71368 WP_000074540.1.71378 WP_000074540.1.714 WP_000074540.1.71401 WP_000074540.1.71418 WP_000074540.1.7142 WP_000074540.1.71446 WP_000074540.1.71450 WP_000074540.1.71452 WP_000074540.1.71455 WP_000074540.1.71456 WP_000074540.1.71487 WP_000074540.1.71523 WP_000074540.1.71542 WP_000074540.1.71566 WP_000074540.1.71583 WP_000074540.1.71600 WP_000074540.1.71626 WP_000074540.1.71636 WP_000074540.1.71640 WP_000074540.1.71649 WP_000074540.1.71651 WP_000074540.1.71653 WP_000074540.1.71656 WP_000074540.1.71667 WP_000074540.1.71691 WP_000074540.1.71702 WP_000074540.1.71716 WP_000074540.1.7174 WP_000074540.1.71746 WP_000074540.1.71750 WP_000074540.1.71756 WP_000074540.1.71798 WP_000074540.1.71845 WP_000074540.1.71848 WP_000074540.1.71872 WP_000074540.1.71881 WP_000074540.1.71908 WP_000074540.1.71923 WP_000074540.1.71929 WP_000074540.1.71941 WP_000074540.1.71950 WP_000074540.1.71952 WP_000074540.1.71954 WP_000074540.1.71973 WP_000074540.1.71979 WP_000074540.1.71984 WP_000074540.1.71985 WP_000074540.1.720 WP_000074540.1.72003 WP_000074540.1.72065 WP_000074540.1.72073 WP_000074540.1.72100 WP_000074540.1.72105 WP_000074540.1.72107 WP_000074540.1.72119 WP_000074540.1.72121 WP_000074540.1.72182 WP_000074540.1.72188 WP_000074540.1.72190 WP_000074540.1.72203 WP_000074540.1.72220 WP_000074540.1.72221 WP_000074540.1.72226 WP_000074540.1.72234 WP_000074540.1.72243 WP_000074540.1.72254 WP_000074540.1.72269 WP_000074540.1.72277 WP_000074540.1.72281 WP_000074540.1.72283 WP_000074540.1.72300 WP_000074540.1.72307 WP_000074540.1.72325 WP_000074540.1.72339 WP_000074540.1.72350 WP_000074540.1.72351 WP_000074540.1.72372 WP_000074540.1.72376 WP_000074540.1.72382 WP_000074540.1.72383 WP_000074540.1.72403 WP_000074540.1.72412 WP_000074540.1.7243 WP_000074540.1.72438 WP_000074540.1.72461 WP_000074540.1.72470 WP_000074540.1.72527 WP_000074540.1.72532 WP_000074540.1.7255 WP_000074540.1.72594 WP_000074540.1.72602 WP_000074540.1.72625 WP_000074540.1.72629 WP_000074540.1.72631 WP_000074540.1.72638 WP_000074540.1.72642 WP_000074540.1.72667 WP_000074540.1.72671 WP_000074540.1.72674 WP_000074540.1.72689 WP_000074540.1.72716 WP_000074540.1.72718 WP_000074540.1.72724 WP_000074540.1.72728 WP_000074540.1.72789 WP_000074540.1.72793 WP_000074540.1.72797 WP_000074540.1.72827 WP_000074540.1.72828 WP_000074540.1.72850 WP_000074540.1.72865 WP_000074540.1.72871 WP_000074540.1.72872 WP_000074540.1.72887 WP_000074540.1.72892 WP_000074540.1.72894 WP_000074540.1.72896 WP_000074540.1.72897 WP_000074540.1.72944 WP_000074540.1.72946 WP_000074540.1.7295 WP_000074540.1.72968 WP_000074540.1.72969 WP_000074540.1.72975 WP_000074540.1.72987 WP_000074540.1.7304 WP_000074540.1.73052 WP_000074540.1.73062 WP_000074540.1.73068 WP_000074540.1.73102 WP_000074540.1.7311 WP_000074540.1.73114 WP_000074540.1.73125 WP_000074540.1.73144 WP_000074540.1.7315 WP_000074540.1.7316 WP_000074540.1.73164 WP_000074540.1.73177 WP_000074540.1.73180 WP_000074540.1.73200 WP_000074540.1.73258 WP_000074540.1.73270 WP_000074540.1.73285 WP_000074540.1.7332 WP_000074540.1.73328 WP_000074540.1.7333 WP_000074540.1.73338 WP_000074540.1.7334 WP_000074540.1.73352 WP_000074540.1.73362 WP_000074540.1.73377 WP_000074540.1.73379 WP_000074540.1.73389 WP_000074540.1.7341 WP_000074540.1.73425 WP_000074540.1.73461 WP_000074540.1.73481 WP_000074540.1.73488 WP_000074540.1.73504 WP_000074540.1.73512 WP_000074540.1.7353 WP_000074540.1.73535 WP_000074540.1.73544 WP_000074540.1.7356 WP_000074540.1.73561 WP_000074540.1.73581 WP_000074540.1.73596 WP_000074540.1.73598 WP_000074540.1.7361 WP_000074540.1.73617 WP_000074540.1.73648 WP_000074540.1.73667 WP_000074540.1.73669 WP_000074540.1.73701 WP_000074540.1.73708 WP_000074540.1.7374 WP_000074540.1.73753 WP_000074540.1.73758 WP_000074540.1.73764 WP_000074540.1.73768 WP_000074540.1.73794 WP_000074540.1.73804 WP_000074540.1.73831 WP_000074540.1.73847 WP_000074540.1.73849 WP_000074540.1.7386 WP_000074540.1.73901 WP_000074540.1.73924 WP_000074540.1.73926 WP_000074540.1.7394 WP_000074540.1.73945 WP_000074540.1.73948 WP_000074540.1.73956 WP_000074540.1.73958 WP_000074540.1.73965 WP_000074540.1.73999 WP_000074540.1.74024 WP_000074540.1.74028 WP_000074540.1.74029 WP_000074540.1.74030 WP_000074540.1.74038 WP_000074540.1.74040 WP_000074540.1.74043 WP_000074540.1.74049 WP_000074540.1.74058 WP_000074540.1.74070 WP_000074540.1.74077 WP_000074540.1.74117 WP_000074540.1.74135 WP_000074540.1.74174 WP_000074540.1.74181 WP_000074540.1.74191 WP_000074540.1.74207 WP_000074540.1.74214 WP_000074540.1.74228 WP_000074540.1.74241 WP_000074540.1.74248 WP_000074540.1.74285 WP_000074540.1.743 WP_000074540.1.7430 WP_000074540.1.74300 WP_000074540.1.74317 WP_000074540.1.7433 WP_000074540.1.74379 WP_000074540.1.74402 WP_000074540.1.74410 WP_000074540.1.74414 WP_000074540.1.74415 WP_000074540.1.74418 WP_000074540.1.74422 WP_000074540.1.74428 WP_000074540.1.7444 WP_000074540.1.74454 WP_000074540.1.74466 WP_000074540.1.74469 WP_000074540.1.74481 WP_000074540.1.745 WP_000074540.1.74500 WP_000074540.1.74529 WP_000074540.1.74545 WP_000074540.1.74570 WP_000074540.1.74578 WP_000074540.1.7458 WP_000074540.1.74616 WP_000074540.1.74620 WP_000074540.1.74621 WP_000074540.1.74639 WP_000074540.1.74644 WP_000074540.1.74647 WP_000074540.1.74661 WP_000074540.1.74677 WP_000074540.1.74699 WP_000074540.1.74702 WP_000074540.1.74741 WP_000074540.1.74745 WP_000074540.1.74757 WP_000074540.1.74806 WP_000074540.1.74807 WP_000074540.1.74826 WP_000074540.1.74831 WP_000074540.1.74876 WP_000074540.1.74884 WP_000074540.1.74894 WP_000074540.1.7491 WP_000074540.1.74929 WP_000074540.1.74939 WP_000074540.1.74946 WP_000074540.1.74972 WP_000074540.1.74973 WP_000074540.1.74992 WP_000074540.1.74996 WP_000074540.1.75009 WP_000074540.1.75051 WP_000074540.1.75056 WP_000074540.1.75058 WP_000074540.1.7507 WP_000074540.1.75089 WP_000074540.1.75114 WP_000074540.1.75116 WP_000074540.1.75129 WP_000074540.1.75134 WP_000074540.1.75148 WP_000074540.1.75159 WP_000074540.1.75177 WP_000074540.1.75180 WP_000074540.1.75187 WP_000074540.1.75237 WP_000074540.1.75273 WP_000074540.1.75288 WP_000074540.1.75296 WP_000074540.1.75301 WP_000074540.1.7531 WP_000074540.1.75334 WP_000074540.1.75362 WP_000074540.1.75371 WP_000074540.1.75385 WP_000074540.1.75392 WP_000074540.1.75400 WP_000074540.1.75402 WP_000074540.1.75413 WP_000074540.1.7543 WP_000074540.1.75433 WP_000074540.1.75450 WP_000074540.1.75494 WP_000074540.1.75532 WP_000074540.1.75565 WP_000074540.1.7558 WP_000074540.1.75585 WP_000074540.1.75593 WP_000074540.1.75607 WP_000074540.1.75609 WP_000074540.1.75610 WP_000074540.1.75626 WP_000074540.1.75633 WP_000074540.1.75664 WP_000074540.1.75716 WP_000074540.1.75718 WP_000074540.1.75740 WP_000074540.1.75745 WP_000074540.1.75751 WP_000074540.1.75760 WP_000074540.1.75764 WP_000074540.1.75793 WP_000074540.1.75794 WP_000074540.1.75810 WP_000074540.1.75828 WP_000074540.1.75837 WP_000074540.1.75844 WP_000074540.1.75863 WP_000074540.1.75873 WP_000074540.1.75874 WP_000074540.1.75884 WP_000074540.1.75886 WP_000074540.1.75898 WP_000074540.1.75902 WP_000074540.1.75932 WP_000074540.1.75945 WP_000074540.1.75957 WP_000074540.1.76 WP_000074540.1.76020 WP_000074540.1.76024 WP_000074540.1.76055 WP_000074540.1.76081 WP_000074540.1.76097 WP_000074540.1.76108 WP_000074540.1.76115 WP_000074540.1.76116 WP_000074540.1.76122 WP_000074540.1.76137 WP_000074540.1.76156 WP_000074540.1.76162 WP_000074540.1.76164 WP_000074540.1.76186 WP_000074540.1.76197 WP_000074540.1.76208 WP_000074540.1.76252 WP_000074540.1.76256 WP_000074540.1.7629 WP_000074540.1.76301 WP_000074540.1.76327 WP_000074540.1.7633 WP_000074540.1.76339 WP_000074540.1.7634 WP_000074540.1.76345 WP_000074540.1.76346 WP_000074540.1.76364 WP_000074540.1.76366 WP_000074540.1.76417 WP_000074540.1.76434 WP_000074540.1.76445 WP_000074540.1.76451 WP_000074540.1.7646 WP_000074540.1.76471 WP_000074540.1.76495 WP_000074540.1.76510 WP_000074540.1.76529 WP_000074540.1.76532 WP_000074540.1.76548 WP_000074540.1.7655 WP_000074540.1.76558 WP_000074540.1.7657 WP_000074540.1.76572 WP_000074540.1.76576 WP_000074540.1.7660 WP_000074540.1.76611 WP_000074540.1.76641 WP_000074540.1.76651 WP_000074540.1.76653 WP_000074540.1.76673 WP_000074540.1.7672 WP_000074540.1.76721 WP_000074540.1.76724 WP_000074540.1.76738 WP_000074540.1.76756 WP_000074540.1.76760 WP_000074540.1.76776 WP_000074540.1.76788 WP_000074540.1.76799 WP_000074540.1.76806 WP_000074540.1.7684 WP_000074540.1.76854 WP_000074540.1.76866 WP_000074540.1.76875 WP_000074540.1.76880 WP_000074540.1.76899 WP_000074540.1.76913 WP_000074540.1.76916 WP_000074540.1.76932 WP_000074540.1.76968 WP_000074540.1.76973 WP_000074540.1.76988 WP_000074540.1.77016 WP_000074540.1.77017 WP_000074540.1.77033 WP_000074540.1.77038 WP_000074540.1.77047 WP_000074540.1.77067 WP_000074540.1.77080 WP_000074540.1.77087 WP_000074540.1.77090 WP_000074540.1.77111 WP_000074540.1.7712 WP_000074540.1.77177 WP_000074540.1.77180 WP_000074540.1.77184 WP_000074540.1.77193 WP_000074540.1.77241 WP_000074540.1.77244 WP_000074540.1.77267 WP_000074540.1.77271 WP_000074540.1.77292 WP_000074540.1.77299 WP_000074540.1.77306 WP_000074540.1.77313 WP_000074540.1.77349 WP_000074540.1.77356 WP_000074540.1.77384 WP_000074540.1.77390 WP_000074540.1.77431 WP_000074540.1.77436 WP_000074540.1.77440 WP_000074540.1.77475 WP_000074540.1.77496 WP_000074540.1.77501 WP_000074540.1.77512 WP_000074540.1.77513 WP_000074540.1.77514 WP_000074540.1.77529 WP_000074540.1.77543 WP_000074540.1.77549 WP_000074540.1.77555 WP_000074540.1.77563 WP_000074540.1.77565 WP_000074540.1.77575 WP_000074540.1.77596 WP_000074540.1.77629 WP_000074540.1.77646 WP_000074540.1.77653 WP_000074540.1.77692 WP_000074540.1.77702 WP_000074540.1.77710 WP_000074540.1.77713 WP_000074540.1.7772 WP_000074540.1.77729 WP_000074540.1.77754 WP_000074540.1.77761 WP_000074540.1.7782 WP_000074540.1.77825 WP_000074540.1.77837 WP_000074540.1.7784 WP_000074540.1.77846 WP_000074540.1.77851 WP_000074540.1.77871 WP_000074540.1.77898 WP_000074540.1.77900 WP_000074540.1.77918 WP_000074540.1.7792 WP_000074540.1.77923 WP_000074540.1.7793 WP_000074540.1.77951 WP_000074540.1.77960 WP_000074540.1.77971 WP_000074540.1.77975 WP_000074540.1.77983 WP_000074540.1.77987 WP_000074540.1.77989 WP_000074540.1.78 WP_000074540.1.78016 WP_000074540.1.7802 WP_000074540.1.78026 WP_000074540.1.78033 WP_000074540.1.78035 WP_000074540.1.78048 WP_000074540.1.78051 WP_000074540.1.78053 WP_000074540.1.78076 WP_000074540.1.78096 WP_000074540.1.78100 WP_000074540.1.78107 WP_000074540.1.78110 WP_000074540.1.78120 WP_000074540.1.7814 WP_000074540.1.78166 WP_000074540.1.78168 WP_000074540.1.78170 WP_000074540.1.78180 WP_000074540.1.78192 WP_000074540.1.78195 WP_000074540.1.78245 WP_000074540.1.78259 WP_000074540.1.78291 WP_000074540.1.78301 WP_000074540.1.78309 WP_000074540.1.78320 WP_000074540.1.78352 WP_000074540.1.78366 WP_000074540.1.78372 WP_000074540.1.78382 WP_000074540.1.78383 WP_000074540.1.78388 WP_000074540.1.78407 WP_000074540.1.78410 WP_000074540.1.78495 WP_000074540.1.78496 WP_000074540.1.78501 WP_000074540.1.78502 WP_000074540.1.78602 WP_000074540.1.78603 WP_000074540.1.7861 WP_000074540.1.78618 WP_000074540.1.7862 WP_000074540.1.78626 WP_000074540.1.78632 WP_000074540.1.78658 WP_000074540.1.78661 WP_000074540.1.78673 WP_000074540.1.78674 WP_000074540.1.78676 WP_000074540.1.78697 WP_000074540.1.78734 WP_000074540.1.78735 WP_000074540.1.78738 WP_000074540.1.78761 WP_000074540.1.7877 WP_000074540.1.78771 WP_000074540.1.78789 WP_000074540.1.78802 WP_000074540.1.78815 WP_000074540.1.78830 WP_000074540.1.78835 WP_000074540.1.78838 WP_000074540.1.78862 WP_000074540.1.78871 WP_000074540.1.78874 WP_000074540.1.78877 WP_000074540.1.78881 WP_000074540.1.78896 WP_000074540.1.789 WP_000074540.1.7891 WP_000074540.1.78913 WP_000074540.1.78918 WP_000074540.1.78928 WP_000074540.1.7893 WP_000074540.1.78930 WP_000074540.1.78951 WP_000074540.1.78959 WP_000074540.1.78993 WP_000074540.1.79011 WP_000074540.1.79012 WP_000074540.1.79032 WP_000074540.1.79069 WP_000074540.1.79074 WP_000074540.1.79081 WP_000074540.1.79098 WP_000074540.1.79099 WP_000074540.1.79140 WP_000074540.1.79151 WP_000074540.1.79155 WP_000074540.1.79164 WP_000074540.1.79167 WP_000074540.1.79189 WP_000074540.1.79203 WP_000074540.1.79204 WP_000074540.1.79235 WP_000074540.1.79280 WP_000074540.1.79289 WP_000074540.1.79297 WP_000074540.1.79302 WP_000074540.1.79335 WP_000074540.1.79370 WP_000074540.1.79397 WP_000074540.1.794 WP_000074540.1.79427 WP_000074540.1.79456 WP_000074540.1.79462 WP_000074540.1.79466 WP_000074540.1.79468 WP_000074540.1.79472 WP_000074540.1.79490 WP_000074540.1.79495 WP_000074540.1.79529 WP_000074540.1.79531 WP_000074540.1.79532 WP_000074540.1.79547 WP_000074540.1.7956 WP_000074540.1.79570 WP_000074540.1.79580 WP_000074540.1.79586 WP_000074540.1.7964 WP_000074540.1.79642 WP_000074540.1.79645 WP_000074540.1.79654 WP_000074540.1.79659 WP_000074540.1.79668 WP_000074540.1.7970 WP_000074540.1.79708 WP_000074540.1.7972 WP_000074540.1.79722 WP_000074540.1.79734 WP_000074540.1.79738 WP_000074540.1.79757 WP_000074540.1.79772 WP_000074540.1.79778 WP_000074540.1.7979 WP_000074540.1.7982 WP_000074540.1.79832 WP_000074540.1.79845 WP_000074540.1.79867 WP_000074540.1.79880 WP_000074540.1.79892 WP_000074540.1.7991 WP_000074540.1.79914 WP_000074540.1.79916 WP_000074540.1.79929 WP_000074540.1.79934 WP_000074540.1.7994 WP_000074540.1.79945 WP_000074540.1.79951 WP_000074540.1.79966 WP_000074540.1.79974 WP_000074540.1.79977 WP_000074540.1.79996 WP_000074540.1.80065 WP_000074540.1.80077 WP_000074540.1.80103 WP_000074540.1.80137 WP_000074540.1.80149 WP_000074540.1.80182 WP_000074540.1.80229 WP_000074540.1.80236 WP_000074540.1.8024 WP_000074540.1.80249 WP_000074540.1.80250 WP_000074540.1.80254 WP_000074540.1.80273 WP_000074540.1.80282 WP_000074540.1.80293 WP_000074540.1.80296 WP_000074540.1.80307 WP_000074540.1.80333 WP_000074540.1.80354 WP_000074540.1.80366 WP_000074540.1.80368 WP_000074540.1.80380 WP_000074540.1.80386 WP_000074540.1.80400 WP_000074540.1.80441 WP_000074540.1.80443 WP_000074540.1.80448 WP_000074540.1.80462 WP_000074540.1.80473 WP_000074540.1.80479 WP_000074540.1.80480 WP_000074540.1.8049 WP_000074540.1.80492 WP_000074540.1.80496 WP_000074540.1.80529 WP_000074540.1.80542 WP_000074540.1.80569 WP_000074540.1.80586 WP_000074540.1.80609 WP_000074540.1.80651 WP_000074540.1.80664 WP_000074540.1.80667 WP_000074540.1.80674 WP_000074540.1.80696 WP_000074540.1.80707 WP_000074540.1.80723 WP_000074540.1.80725 WP_000074540.1.80741 WP_000074540.1.80750 WP_000074540.1.80757 WP_000074540.1.80760 WP_000074540.1.80780 WP_000074540.1.80803 WP_000074540.1.80819 WP_000074540.1.80827 WP_000074540.1.80831 WP_000074540.1.80840 WP_000074540.1.80850 WP_000074540.1.80857 WP_000074540.1.80868 WP_000074540.1.80874 WP_000074540.1.80876 WP_000074540.1.80881 WP_000074540.1.80913 WP_000074540.1.80927 WP_000074540.1.80939 WP_000074540.1.80941 WP_000074540.1.80959 WP_000074540.1.8096 WP_000074540.1.80973 WP_000074540.1.80984 WP_000074540.1.81037 WP_000074540.1.81041 WP_000074540.1.8106 WP_000074540.1.81062 WP_000074540.1.81067 WP_000074540.1.81069 WP_000074540.1.81084 WP_000074540.1.81107 WP_000074540.1.81109 WP_000074540.1.81110 WP_000074540.1.81118 WP_000074540.1.81131 WP_000074540.1.81149 WP_000074540.1.81175 WP_000074540.1.81187 WP_000074540.1.8119 WP_000074540.1.81193 WP_000074540.1.81197 WP_000074540.1.81225 WP_000074540.1.81231 WP_000074540.1.81262 WP_000074540.1.81268 WP_000074540.1.81269 WP_000074540.1.81271 WP_000074540.1.81275 WP_000074540.1.8130 WP_000074540.1.81302 WP_000074540.1.81305 WP_000074540.1.8131 WP_000074540.1.81320 WP_000074540.1.81321 WP_000074540.1.81328 WP_000074540.1.81333 WP_000074540.1.8134 WP_000074540.1.81342 WP_000074540.1.81354 WP_000074540.1.81364 WP_000074540.1.81388 WP_000074540.1.81404 WP_000074540.1.81409 WP_000074540.1.81410 WP_000074540.1.81425 WP_000074540.1.81455 WP_000074540.1.81472 WP_000074540.1.81494 WP_000074540.1.81504 WP_000074540.1.81528 WP_000074540.1.81548 WP_000074540.1.81557 WP_000074540.1.81568 WP_000074540.1.81667 WP_000074540.1.81668 WP_000074540.1.81676 WP_000074540.1.8168 WP_000074540.1.81681 WP_000074540.1.8170 WP_000074540.1.81727 WP_000074540.1.81735 WP_000074540.1.81736 WP_000074540.1.81743 WP_000074540.1.81746 WP_000074540.1.81750 WP_000074540.1.81760 WP_000074540.1.81763 WP_000074540.1.81768 WP_000074540.1.81785 WP_000074540.1.81795 WP_000074540.1.81798 WP_000074540.1.81855 WP_000074540.1.81902 WP_000074540.1.81921 WP_000074540.1.81931 WP_000074540.1.81936 WP_000074540.1.81941 WP_000074540.1.81949 WP_000074540.1.8196 WP_000074540.1.81965 WP_000074540.1.81974 WP_000074540.1.81977 WP_000074540.1.81995 WP_000074540.1.82037 WP_000074540.1.82070 WP_000074540.1.82076 WP_000074540.1.82099 WP_000074540.1.82131 WP_000074540.1.82141 WP_000074540.1.82144 WP_000074540.1.82149 WP_000074540.1.82156 WP_000074540.1.8218 WP_000074540.1.82180 WP_000074540.1.82192 WP_000074540.1.82201 WP_000074540.1.82214 WP_000074540.1.82225 WP_000074540.1.82232 WP_000074540.1.82258 WP_000074540.1.82269 WP_000074540.1.82337 WP_000074540.1.82347 WP_000074540.1.82352 WP_000074540.1.8236 WP_000074540.1.82369 WP_000074540.1.82395 WP_000074540.1.8240 WP_000074540.1.82401 WP_000074540.1.82408 WP_000074540.1.82416 WP_000074540.1.8242 WP_000074540.1.82420 WP_000074540.1.82434 WP_000074540.1.82456 WP_000074540.1.82464 WP_000074540.1.82465 WP_000074540.1.8247 WP_000074540.1.82473 WP_000074540.1.82474 WP_000074540.1.82479 WP_000074540.1.82503 WP_000074540.1.82515 WP_000074540.1.82529 WP_000074540.1.82530 WP_000074540.1.82553 WP_000074540.1.82562 WP_000074540.1.82569 WP_000074540.1.82570 WP_000074540.1.82584 WP_000074540.1.82636 WP_000074540.1.82637 WP_000074540.1.82646 WP_000074540.1.82670 WP_000074540.1.82676 WP_000074540.1.82692 WP_000074540.1.82731 WP_000074540.1.82763 WP_000074540.1.82812 WP_000074540.1.8282 WP_000074540.1.82841 WP_000074540.1.82843 WP_000074540.1.82850 WP_000074540.1.82867 WP_000074540.1.82872 WP_000074540.1.82886 WP_000074540.1.82895 WP_000074540.1.82899 WP_000074540.1.82908 WP_000074540.1.82937 WP_000074540.1.8294 WP_000074540.1.82944 WP_000074540.1.82946 WP_000074540.1.82956 WP_000074540.1.82959 WP_000074540.1.82964 WP_000074540.1.82992 WP_000074540.1.83005 WP_000074540.1.83006 WP_000074540.1.83007 WP_000074540.1.8304 WP_000074540.1.83061 WP_000074540.1.83092 WP_000074540.1.83119 WP_000074540.1.83128 WP_000074540.1.83139 WP_000074540.1.83163 WP_000074540.1.83180 WP_000074540.1.83204 WP_000074540.1.8322 WP_000074540.1.83221 WP_000074540.1.83229 WP_000074540.1.83235 WP_000074540.1.83247 WP_000074540.1.83252 WP_000074540.1.83258 WP_000074540.1.83280 WP_000074540.1.83290 WP_000074540.1.83301 WP_000074540.1.83305 WP_000074540.1.83331 WP_000074540.1.83333 WP_000074540.1.83354 WP_000074540.1.83356 WP_000074540.1.83360 WP_000074540.1.83365 WP_000074540.1.83378 WP_000074540.1.83382 WP_000074540.1.83388 WP_000074540.1.83407 WP_000074540.1.83413 WP_000074540.1.83491 WP_000074540.1.83516 WP_000074540.1.83523 WP_000074540.1.8354 WP_000074540.1.83558 WP_000074540.1.83572 WP_000074540.1.83598 WP_000074540.1.83650 WP_000074540.1.83657 WP_000074540.1.83677 WP_000074540.1.83710 WP_000074540.1.83721 WP_000074540.1.83739 WP_000074540.1.8375 WP_000074540.1.83759 WP_000074540.1.83760 WP_000074540.1.83806 WP_000074540.1.83854 WP_000074540.1.83897 WP_000074540.1.83923 WP_000074540.1.83960 WP_000074540.1.83979 WP_000074540.1.8399 WP_000074540.1.83994 WP_000074540.1.83995 WP_000074540.1.84 WP_000074540.1.84000 WP_000074540.1.84001 WP_000074540.1.84011 WP_000074540.1.84031 WP_000074540.1.8406 WP_000074540.1.84075 WP_000074540.1.84076 WP_000074540.1.84077 WP_000074540.1.84083 WP_000074540.1.84086 WP_000074540.1.84100 WP_000074540.1.84103 WP_000074540.1.84106 WP_000074540.1.84110 WP_000074540.1.84115 WP_000074540.1.84127 WP_000074540.1.84150 WP_000074540.1.84154 WP_000074540.1.84168 WP_000074540.1.84179 WP_000074540.1.84198 WP_000074540.1.84205 WP_000074540.1.84209 WP_000074540.1.84229 WP_000074540.1.84230 WP_000074540.1.8425 WP_000074540.1.84252 WP_000074540.1.84283 WP_000074540.1.84291 WP_000074540.1.84300 WP_000074540.1.8431 WP_000074540.1.84325 WP_000074540.1.84345 WP_000074540.1.84359 WP_000074540.1.84369 WP_000074540.1.84373 WP_000074540.1.84392 WP_000074540.1.84397 WP_000074540.1.84401 WP_000074540.1.84403 WP_000074540.1.8441 WP_000074540.1.84435 WP_000074540.1.84459 WP_000074540.1.84461 WP_000074540.1.84475 WP_000074540.1.84497 WP_000074540.1.84515 WP_000074540.1.84523 WP_000074540.1.84532 WP_000074540.1.84567 WP_000074540.1.84572 WP_000074540.1.84598 WP_000074540.1.84631 WP_000074540.1.84644 WP_000074540.1.84659 WP_000074540.1.84683 WP_000074540.1.84693 WP_000074540.1.84711 WP_000074540.1.84721 WP_000074540.1.84727 WP_000074540.1.84744 WP_000074540.1.84745 WP_000074540.1.84773 WP_000074540.1.84814 WP_000074540.1.84860 WP_000074540.1.84872 WP_000074540.1.84876 WP_000074540.1.84879 WP_000074540.1.84899 WP_000074540.1.849 WP_000074540.1.84945 WP_000074540.1.84967 WP_000074540.1.8497 WP_000074540.1.84983 WP_000074540.1.850 WP_000074540.1.85004 WP_000074540.1.85014 WP_000074540.1.8502 WP_000074540.1.85031 WP_000074540.1.85039 WP_000074540.1.85040 WP_000074540.1.85079 WP_000074540.1.85094 WP_000074540.1.85120 WP_000074540.1.85126 WP_000074540.1.85134 WP_000074540.1.85147 WP_000074540.1.85153 WP_000074540.1.85178 WP_000074540.1.85180 WP_000074540.1.85190 WP_000074540.1.85192 WP_000074540.1.85217 WP_000074540.1.8526 WP_000074540.1.85271 WP_000074540.1.85273 WP_000074540.1.85301 WP_000074540.1.8533 WP_000074540.1.85338 WP_000074540.1.85339 WP_000074540.1.8537 WP_000074540.1.85408 WP_000074540.1.85433 WP_000074540.1.8545 WP_000074540.1.85456 WP_000074540.1.85469 WP_000074540.1.85481 WP_000074540.1.85483 WP_000074540.1.85511 WP_000074540.1.85512 WP_000074540.1.8552 WP_000074540.1.85541 WP_000074540.1.8556 WP_000074540.1.85568 WP_000074540.1.8557 WP_000074540.1.85606 WP_000074540.1.85615 WP_000074540.1.85617 WP_000074540.1.85635 WP_000074540.1.85646 WP_000074540.1.85654 WP_000074540.1.85663 WP_000074540.1.85665 WP_000074540.1.85669 WP_000074540.1.85671 WP_000074540.1.85672 WP_000074540.1.85675 WP_000074540.1.85688 WP_000074540.1.85703 WP_000074540.1.85728 WP_000074540.1.85742 WP_000074540.1.85746 WP_000074540.1.85759 WP_000074540.1.85777 WP_000074540.1.85780 WP_000074540.1.85784 WP_000074540.1.85797 WP_000074540.1.85811 WP_000074540.1.85854 WP_000074540.1.85855 WP_000074540.1.85864 WP_000074540.1.85886 WP_000074540.1.859 WP_000074540.1.85900 WP_000074540.1.85904 WP_000074540.1.8591 WP_000074540.1.85917 WP_000074540.1.8594 WP_000074540.1.85943 WP_000074540.1.85976 WP_000074540.1.85977 WP_000074540.1.85982 WP_000074540.1.860 WP_000074540.1.86007 WP_000074540.1.86010 WP_000074540.1.86017 WP_000074540.1.86043 WP_000074540.1.8605 WP_000074540.1.86084 WP_000074540.1.86092 WP_000074540.1.8610 WP_000074540.1.86120 WP_000074540.1.86126 WP_000074540.1.86138 WP_000074540.1.8614 WP_000074540.1.86156 WP_000074540.1.86157 WP_000074540.1.86159 WP_000074540.1.8616 WP_000074540.1.86173 WP_000074540.1.86206 WP_000074540.1.86224 WP_000074540.1.86240 WP_000074540.1.86259 WP_000074540.1.86284 WP_000074540.1.86285 WP_000074540.1.86306 WP_000074540.1.86310 WP_000074540.1.86316 WP_000074540.1.86323 WP_000074540.1.86335 WP_000074540.1.86342 WP_000074540.1.86347 WP_000074540.1.86356 WP_000074540.1.86380 WP_000074540.1.86389 WP_000074540.1.8640 WP_000074540.1.8642 WP_000074540.1.86426 WP_000074540.1.86442 WP_000074540.1.86450 WP_000074540.1.86453 WP_000074540.1.86466 WP_000074540.1.86469 WP_000074540.1.8647 WP_000074540.1.86489 WP_000074540.1.86514 WP_000074540.1.86530 WP_000074540.1.86580 WP_000074540.1.86588 WP_000074540.1.86593 WP_000074540.1.86601 WP_000074540.1.86610 WP_000074540.1.86634 WP_000074540.1.86656 WP_000074540.1.86658 WP_000074540.1.86661 WP_000074540.1.86663 WP_000074540.1.86676 WP_000074540.1.86699 WP_000074540.1.8671 WP_000074540.1.8672 WP_000074540.1.86744 WP_000074540.1.86770 WP_000074540.1.8678 WP_000074540.1.86794 WP_000074540.1.86800 WP_000074540.1.86807 WP_000074540.1.86810 WP_000074540.1.86811 WP_000074540.1.86815 WP_000074540.1.8684 WP_000074540.1.86859 WP_000074540.1.86860 WP_000074540.1.86895 WP_000074540.1.86902 WP_000074540.1.86906 WP_000074540.1.86915 WP_000074540.1.86921 WP_000074540.1.86945 WP_000074540.1.86982 WP_000074540.1.86989 WP_000074540.1.87023 WP_000074540.1.87034 WP_000074540.1.87038 WP_000074540.1.87041 WP_000074540.1.87051 WP_000074540.1.87095 WP_000074540.1.87136 WP_000074540.1.87143 WP_000074540.1.87148 WP_000074540.1.87155 WP_000074540.1.87187 WP_000074540.1.87219 WP_000074540.1.8722 WP_000074540.1.87220 WP_000074540.1.87258 WP_000074540.1.87265 WP_000074540.1.87276 WP_000074540.1.87282 WP_000074540.1.87283 WP_000074540.1.87293 WP_000074540.1.87323 WP_000074540.1.87346 WP_000074540.1.8736 WP_000074540.1.87365 WP_000074540.1.87370 WP_000074540.1.87376 WP_000074540.1.87420 WP_000074540.1.87460 WP_000074540.1.87484 WP_000074540.1.87493 WP_000074540.1.87500 WP_000074540.1.87528 WP_000074540.1.87552 WP_000074540.1.87560 WP_000074540.1.87583 WP_000074540.1.87584 WP_000074540.1.8760 WP_000074540.1.87600 WP_000074540.1.87609 WP_000074540.1.87612 WP_000074540.1.87615 WP_000074540.1.87618 WP_000074540.1.87626 WP_000074540.1.87651 WP_000074540.1.87653 WP_000074540.1.87659 WP_000074540.1.8767 WP_000074540.1.87687 WP_000074540.1.87695 WP_000074540.1.87698 WP_000074540.1.87706 WP_000074540.1.87712 WP_000074540.1.87739 WP_000074540.1.87741 WP_000074540.1.87742 WP_000074540.1.87760 WP_000074540.1.87779 WP_000074540.1.87813 WP_000074540.1.87852 WP_000074540.1.87875 WP_000074540.1.87891 WP_000074540.1.87899 WP_000074540.1.87905 WP_000074540.1.8792 WP_000074540.1.87945 WP_000074540.1.87949 WP_000074540.1.87999 WP_000074540.1.8800 WP_000074540.1.88014 WP_000074540.1.88019 WP_000074540.1.88025 WP_000074540.1.88026 WP_000074540.1.8805 WP_000074540.1.88052 WP_000074540.1.8806 WP_000074540.1.88073 WP_000074540.1.8809 WP_000074540.1.88092 WP_000074540.1.881 WP_000074540.1.88136 WP_000074540.1.88145 WP_000074540.1.88174 WP_000074540.1.88185 WP_000074540.1.88199 WP_000074540.1.88214 WP_000074540.1.88222 WP_000074540.1.88244 WP_000074540.1.88264 WP_000074540.1.88275 WP_000074540.1.88291 WP_000074540.1.88293 WP_000074540.1.88299 WP_000074540.1.88303 WP_000074540.1.88313 WP_000074540.1.88356 WP_000074540.1.88359 WP_000074540.1.8837 WP_000074540.1.88393 WP_000074540.1.88407 WP_000074540.1.88414 WP_000074540.1.88423 WP_000074540.1.88444 WP_000074540.1.88446 WP_000074540.1.88458 WP_000074540.1.88474 WP_000074540.1.88483 WP_000074540.1.8849 WP_000074540.1.88501 WP_000074540.1.88508 WP_000074540.1.88538 WP_000074540.1.88547 WP_000074540.1.88597 WP_000074540.1.886 WP_000074540.1.88609 WP_000074540.1.88620 WP_000074540.1.88624 WP_000074540.1.88647 WP_000074540.1.88648 WP_000074540.1.88651 WP_000074540.1.88675 WP_000074540.1.88683 WP_000074540.1.88692 WP_000074540.1.88698 WP_000074540.1.88703 WP_000074540.1.88707 WP_000074540.1.88727 WP_000074540.1.88731 WP_000074540.1.88772 WP_000074540.1.88776 WP_000074540.1.88792 WP_000074540.1.88817 WP_000074540.1.88845 WP_000074540.1.88850 WP_000074540.1.88854 WP_000074540.1.8889 WP_000074540.1.88892 WP_000074540.1.88894 WP_000074540.1.88902 WP_000074540.1.8891 WP_000074540.1.88942 WP_000074540.1.88957 WP_000074540.1.88966 WP_000074540.1.88967 WP_000074540.1.88968 WP_000074540.1.88970 WP_000074540.1.88980 WP_000074540.1.88981 WP_000074540.1.88982 WP_000074540.1.88995 WP_000074540.1.88998 WP_000074540.1.89008 WP_000074540.1.89054 WP_000074540.1.89114 WP_000074540.1.89116 WP_000074540.1.89119 WP_000074540.1.89120 WP_000074540.1.89138 WP_000074540.1.89174 WP_000074540.1.89177 WP_000074540.1.89182 WP_000074540.1.89188 WP_000074540.1.89215 WP_000074540.1.89221 WP_000074540.1.89291 WP_000074540.1.89298 WP_000074540.1.89304 WP_000074540.1.89308 WP_000074540.1.89311 WP_000074540.1.89314 WP_000074540.1.89328 WP_000074540.1.89332 WP_000074540.1.89343 WP_000074540.1.89354 WP_000074540.1.89355 WP_000074540.1.89362 WP_000074540.1.89395 WP_000074540.1.8940 WP_000074540.1.89408 WP_000074540.1.89425 WP_000074540.1.89449 WP_000074540.1.89452 WP_000074540.1.89462 WP_000074540.1.8947 WP_000074540.1.89503 WP_000074540.1.89512 WP_000074540.1.89527 WP_000074540.1.89570 WP_000074540.1.8958 WP_000074540.1.89580 WP_000074540.1.89591 WP_000074540.1.89604 WP_000074540.1.89606 WP_000074540.1.8961 WP_000074540.1.89612 WP_000074540.1.89622 WP_000074540.1.89632 WP_000074540.1.89634 WP_000074540.1.89647 WP_000074540.1.89657 WP_000074540.1.89659 WP_000074540.1.89668 WP_000074540.1.89680 WP_000074540.1.89706 WP_000074540.1.89713 WP_000074540.1.89733 WP_000074540.1.89746 WP_000074540.1.89764 WP_000074540.1.89765 WP_000074540.1.89777 WP_000074540.1.89789 WP_000074540.1.89796 WP_000074540.1.89804 WP_000074540.1.89815 WP_000074540.1.89817 WP_000074540.1.89832 WP_000074540.1.89845 WP_000074540.1.89870 WP_000074540.1.89888 WP_000074540.1.89902 WP_000074540.1.89911 WP_000074540.1.89914 WP_000074540.1.89940 WP_000074540.1.8995 WP_000074540.1.89952 WP_000074540.1.8996 WP_000074540.1.89965 WP_000074540.1.89975 WP_000074540.1.90007 WP_000074540.1.9002 WP_000074540.1.9003 WP_000074540.1.90033 WP_000074540.1.90084 WP_000074540.1.90097 WP_000074540.1.90108 WP_000074540.1.9011 WP_000074540.1.90196 WP_000074540.1.90211 WP_000074540.1.90220 WP_000074540.1.90240 WP_000074540.1.90248 WP_000074540.1.90252 WP_000074540.1.90274 WP_000074540.1.90280 WP_000074540.1.90293 WP_000074540.1.90311 WP_000074540.1.90330 WP_000074540.1.90338 WP_000074540.1.90348 WP_000074540.1.90363 WP_000074540.1.90365 WP_000074540.1.90409 WP_000074540.1.90417 WP_000074540.1.90421 WP_000074540.1.90428 WP_000074540.1.90440 WP_000074540.1.90453 WP_000074540.1.90458 WP_000074540.1.90472 WP_000074540.1.90489 WP_000074540.1.90513 WP_000074540.1.90521 WP_000074540.1.90522 WP_000074540.1.90540 WP_000074540.1.90557 WP_000074540.1.90563 WP_000074540.1.90566 WP_000074540.1.90582 WP_000074540.1.90585 WP_000074540.1.90620 WP_000074540.1.90625 WP_000074540.1.9064 WP_000074540.1.90641 WP_000074540.1.90686 WP_000074540.1.90701 WP_000074540.1.90713 WP_000074540.1.90734 WP_000074540.1.90748 WP_000074540.1.90759 WP_000074540.1.90792 WP_000074540.1.90794 WP_000074540.1.90796 WP_000074540.1.90811 WP_000074540.1.90814 WP_000074540.1.90859 WP_000074540.1.90866 WP_000074540.1.90876 WP_000074540.1.90878 WP_000074540.1.9089 WP_000074540.1.9091 WP_000074540.1.9093 WP_000074540.1.90959 WP_000074540.1.90973 WP_000074540.1.90984 WP_000074540.1.90991 WP_000074540.1.91003 WP_000074540.1.91023 WP_000074540.1.91042 WP_000074540.1.91049 WP_000074540.1.91056 WP_000074540.1.91067 WP_000074540.1.91069 WP_000074540.1.91107 WP_000074540.1.91156 WP_000074540.1.91164 WP_000074540.1.91179 WP_000074540.1.91189 WP_000074540.1.91205 WP_000074540.1.91215 WP_000074540.1.91239 WP_000074540.1.91278 WP_000074540.1.91282 WP_000074540.1.91291 WP_000074540.1.9131 WP_000074540.1.91312 WP_000074540.1.91313 WP_000074540.1.91331 WP_000074540.1.91334 WP_000074540.1.9135 WP_000074540.1.9137 WP_000074540.1.91372 WP_000074540.1.91381 WP_000074540.1.91405 WP_000074540.1.91424 WP_000074540.1.91453 WP_000074540.1.91459 WP_000074540.1.91470 WP_000074540.1.91473 WP_000074540.1.91474 WP_000074540.1.91505 WP_000074540.1.91506 WP_000074540.1.91512 WP_000074540.1.91528 WP_000074540.1.91536 WP_000074540.1.91557 WP_000074540.1.91564 WP_000074540.1.91579 WP_000074540.1.91580 WP_000074540.1.91597 WP_000074540.1.91621 WP_000074540.1.91625 WP_000074540.1.91655 WP_000074540.1.9166 WP_000074540.1.91702 WP_000074540.1.91715 WP_000074540.1.91724 WP_000074540.1.91732 WP_000074540.1.91736 WP_000074540.1.91742 WP_000074540.1.91772 WP_000074540.1.91776 WP_000074540.1.91788 WP_000074540.1.91795 WP_000074540.1.91806 WP_000074540.1.91864 WP_000074540.1.9187 WP_000074540.1.91870 WP_000074540.1.91880 WP_000074540.1.91898 WP_000074540.1.91903 WP_000074540.1.91904 WP_000074540.1.91914 WP_000074540.1.91974 WP_000074540.1.91984 WP_000074540.1.92013 WP_000074540.1.92018 WP_000074540.1.92039 WP_000074540.1.92044 WP_000074540.1.92047 WP_000074540.1.92060 WP_000074540.1.92067 WP_000074540.1.92068 WP_000074540.1.92082 WP_000074540.1.92087 WP_000074540.1.92093 WP_000074540.1.92098 WP_000074540.1.92099 WP_000074540.1.92108 WP_000074540.1.92122 WP_000074540.1.92129 WP_000074540.1.92149 WP_000074540.1.92156 WP_000074540.1.92165 WP_000074540.1.92171 WP_000074540.1.92172 WP_000074540.1.92183 WP_000074540.1.92208 WP_000074540.1.92213 WP_000074540.1.9222 WP_000074540.1.92240 WP_000074540.1.92243 WP_000074540.1.92270 WP_000074540.1.92299 WP_000074540.1.92310 WP_000074540.1.92318 WP_000074540.1.92327 WP_000074540.1.92375 WP_000074540.1.92394 WP_000074540.1.92399 WP_000074540.1.92408 WP_000074540.1.92411 WP_000074540.1.92439 WP_000074540.1.92443 WP_000074540.1.92452 WP_000074540.1.92470 WP_000074540.1.92477 WP_000074540.1.92482 WP_000074540.1.92529 WP_000074540.1.9253 WP_000074540.1.92531 WP_000074540.1.92545 WP_000074540.1.92557 WP_000074540.1.92562 WP_000074540.1.92570 WP_000074540.1.92575 WP_000074540.1.92588 WP_000074540.1.926 WP_000074540.1.92628 WP_000074540.1.92633 WP_000074540.1.92646 WP_000074540.1.92649 WP_000074540.1.92659 WP_000074540.1.92669 WP_000074540.1.92671 WP_000074540.1.92676 WP_000074540.1.92705 WP_000074540.1.9271 WP_000074540.1.92729 WP_000074540.1.92734 WP_000074540.1.92738 WP_000074540.1.92754 WP_000074540.1.92758 WP_000074540.1.92786 WP_000074540.1.92806 WP_000074540.1.92810 WP_000074540.1.92823 WP_000074540.1.92832 WP_000074540.1.92836 WP_000074540.1.92842 WP_000074540.1.92843 WP_000074540.1.92875 WP_000074540.1.92879 WP_000074540.1.92883 WP_000074540.1.92890 WP_000074540.1.92893 WP_000074540.1.92895 WP_000074540.1.92926 WP_000074540.1.92929 WP_000074540.1.92936 WP_000074540.1.92939 WP_000074540.1.92947 WP_000074540.1.92975 WP_000074540.1.92987 WP_000074540.1.92988 WP_000074540.1.93007 WP_000074540.1.93022 WP_000074540.1.93059 WP_000074540.1.93061 WP_000074540.1.93076 WP_000074540.1.93086 WP_000074540.1.93101 WP_000074540.1.93103 WP_000074540.1.93105 WP_000074540.1.93111 WP_000074540.1.93118 WP_000074540.1.93121 WP_000074540.1.93136 WP_000074540.1.93155 WP_000074540.1.93168 WP_000074540.1.93184 WP_000074540.1.93213 WP_000074540.1.93215 WP_000074540.1.93221 WP_000074540.1.93223 WP_000074540.1.93239 WP_000074540.1.93275 WP_000074540.1.93302 WP_000074540.1.93322 WP_000074540.1.93339 WP_000074540.1.93350 WP_000074540.1.9336 WP_000074540.1.93365 WP_000074540.1.93376 WP_000074540.1.93387 WP_000074540.1.93410 WP_000074540.1.93469 WP_000074540.1.93511 WP_000074540.1.93512 WP_000074540.1.93524 WP_000074540.1.93543 WP_000074540.1.93577 WP_000074540.1.93596 WP_000074540.1.93604 WP_000074540.1.93635 WP_000074540.1.93648 WP_000074540.1.93650 WP_000074540.1.93656 WP_000074540.1.93657 WP_000074540.1.93662 WP_000074540.1.93671 WP_000074540.1.93691 WP_000074540.1.937 WP_000074540.1.93705 WP_000074540.1.9374 WP_000074540.1.93741 WP_000074540.1.9375 WP_000074540.1.93754 WP_000074540.1.93761 WP_000074540.1.93767 WP_000074540.1.93780 WP_000074540.1.9380 WP_000074540.1.93803 WP_000074540.1.93804 WP_000074540.1.93809 WP_000074540.1.93828 WP_000074540.1.93837 WP_000074540.1.93842 WP_000074540.1.93843 WP_000074540.1.93875 WP_000074540.1.9389 WP_000074540.1.93909 WP_000074540.1.93919 WP_000074540.1.93937 WP_000074540.1.93938 WP_000074540.1.93956 WP_000074540.1.93984 WP_000074540.1.93986 WP_000074540.1.9399 WP_000074540.1.93994 WP_000074540.1.94017 WP_000074540.1.94039 WP_000074540.1.94056 WP_000074540.1.94064 WP_000074540.1.94070 WP_000074540.1.94071 WP_000074540.1.94072 WP_000074540.1.94079 WP_000074540.1.94097 WP_000074540.1.94107 WP_000074540.1.94132 WP_000074540.1.94142 WP_000074540.1.94162 WP_000074540.1.94167 WP_000074540.1.94168 WP_000074540.1.94181 WP_000074540.1.94198 WP_000074540.1.94215 WP_000074540.1.94303 WP_000074540.1.9432 WP_000074540.1.94352 WP_000074540.1.94354 WP_000074540.1.94365 WP_000074540.1.94379 WP_000074540.1.94380 WP_000074540.1.94390 WP_000074540.1.9440 WP_000074540.1.94412 WP_000074540.1.94415 WP_000074540.1.94458 WP_000074540.1.94473 WP_000074540.1.94492 WP_000074540.1.94510 WP_000074540.1.94527 WP_000074540.1.94557 WP_000074540.1.94562 WP_000074540.1.94565 WP_000074540.1.94573 WP_000074540.1.94579 WP_000074540.1.94584 WP_000074540.1.94586 WP_000074540.1.94588 WP_000074540.1.94593 WP_000074540.1.94598 WP_000074540.1.94622 WP_000074540.1.9463 WP_000074540.1.94649 WP_000074540.1.94650 WP_000074540.1.94655 WP_000074540.1.94659 WP_000074540.1.94662 WP_000074540.1.94669 WP_000074540.1.94670 WP_000074540.1.94674 WP_000074540.1.94700 WP_000074540.1.94717 WP_000074540.1.94722 WP_000074540.1.94745 WP_000074540.1.94782 WP_000074540.1.94796 WP_000074540.1.94798 WP_000074540.1.9481 WP_000074540.1.94815 WP_000074540.1.94817 WP_000074540.1.94820 WP_000074540.1.94835 WP_000074540.1.94849 WP_000074540.1.94850 WP_000074540.1.94851 WP_000074540.1.94862 WP_000074540.1.94864 WP_000074540.1.94947 WP_000074540.1.94952 WP_000074540.1.94959 WP_000074540.1.94967 WP_000074540.1.94971 WP_000074540.1.94982 WP_000074540.1.94983 WP_000074540.1.94986 WP_000074540.1.94987 WP_000074540.1.95006 WP_000074540.1.9503 WP_000074540.1.95051 WP_000074540.1.95055 WP_000074540.1.95076 WP_000074540.1.95085 WP_000074540.1.95094 WP_000074540.1.95099 WP_000074540.1.95121 WP_000074540.1.95133 WP_000074540.1.95136 WP_000074540.1.95152 WP_000074540.1.9516 WP_000074540.1.95165 WP_000074540.1.95171 WP_000074540.1.95235 WP_000074540.1.95239 WP_000074540.1.95246 WP_000074540.1.95248 WP_000074540.1.95249 WP_000074540.1.9525 WP_000074540.1.95255 WP_000074540.1.95265 WP_000074540.1.9527 WP_000074540.1.95277 WP_000074540.1.95282 WP_000074540.1.95289 WP_000074540.1.95298 WP_000074540.1.9530 WP_000074540.1.95320 WP_000074540.1.95338 WP_000074540.1.95388 WP_000074540.1.95404 WP_000074540.1.95412 WP_000074540.1.95434 WP_000074540.1.95447 WP_000074540.1.95456 WP_000074540.1.95465 WP_000074540.1.95530 WP_000074540.1.95546 WP_000074540.1.95547 WP_000074540.1.95558 WP_000074540.1.95579 WP_000074540.1.95590 WP_000074540.1.95607 WP_000074540.1.95625 WP_000074540.1.95630 WP_000074540.1.95641 WP_000074540.1.95656 WP_000074540.1.95670 WP_000074540.1.95675 WP_000074540.1.95691 WP_000074540.1.95701 WP_000074540.1.95703 WP_000074540.1.95716 WP_000074540.1.9574 WP_000074540.1.95744 WP_000074540.1.95757 WP_000074540.1.95776 WP_000074540.1.95803 WP_000074540.1.95805 WP_000074540.1.95826 WP_000074540.1.95840 WP_000074540.1.9586 WP_000074540.1.95866 WP_000074540.1.95884 WP_000074540.1.95890 WP_000074540.1.95901 WP_000074540.1.95906 WP_000074540.1.95911 WP_000074540.1.95939 WP_000074540.1.95940 WP_000074540.1.95963 WP_000074540.1.96004 WP_000074540.1.96025 WP_000074540.1.96042 WP_000074540.1.96044 WP_000074540.1.96045 WP_000074540.1.96054 WP_000074540.1.9609 WP_000074540.1.96094 WP_000074540.1.96107 WP_000074540.1.96127 WP_000074540.1.96139 WP_000074540.1.96141 WP_000074540.1.96144 WP_000074540.1.96162 WP_000074540.1.96172 WP_000074540.1.96188 WP_000074540.1.96190 WP_000074540.1.96203 WP_000074540.1.96206 WP_000074540.1.96211 WP_000074540.1.96212 WP_000074540.1.9624 WP_000074540.1.96260 WP_000074540.1.9627 WP_000074540.1.9628 WP_000074540.1.96317 WP_000074540.1.96319 WP_000074540.1.9633 WP_000074540.1.96335 WP_000074540.1.96340 WP_000074540.1.96343 WP_000074540.1.96348 WP_000074540.1.96349 WP_000074540.1.96359 WP_000074540.1.96380 WP_000074540.1.96404 WP_000074540.1.96429 WP_000074540.1.9644 WP_000074540.1.96469 WP_000074540.1.96490 WP_000074540.1.96497 WP_000074540.1.96500 WP_000074540.1.96521 WP_000074540.1.96533 WP_000074540.1.96537 WP_000074540.1.96539 WP_000074540.1.96552 WP_000074540.1.96555 WP_000074540.1.96563 WP_000074540.1.96584 WP_000074540.1.96588 WP_000074540.1.96590 WP_000074540.1.96600 WP_000074540.1.96610 WP_000074540.1.96625 WP_000074540.1.96635 WP_000074540.1.9664 WP_000074540.1.96640 WP_000074540.1.96642 WP_000074540.1.96662 WP_000074540.1.96675 WP_000074540.1.9670 WP_000074540.1.96721 WP_000074540.1.96731 WP_000074540.1.96732 WP_000074540.1.96735 WP_000074540.1.9674 WP_000074540.1.96750 WP_000074540.1.96758 WP_000074540.1.96761 WP_000074540.1.96771 WP_000074540.1.96792 WP_000074540.1.96798 WP_000074540.1.96801 WP_000074540.1.96803 WP_000074540.1.96810 WP_000074540.1.9686 WP_000074540.1.96876 WP_000074540.1.96890 WP_000074540.1.96902 WP_000074540.1.96917 WP_000074540.1.96925 WP_000074540.1.96938 WP_000074540.1.96946 WP_000074540.1.96957 WP_000074540.1.96978 WP_000074540.1.96993 WP_000074540.1.97005 WP_000074540.1.97015 WP_000074540.1.97026 WP_000074540.1.97028 WP_000074540.1.97043 WP_000074540.1.97047 WP_000074540.1.97079 WP_000074540.1.97089 WP_000074540.1.97103 WP_000074540.1.97109 WP_000074540.1.97143 WP_000074540.1.97145 WP_000074540.1.97154 WP_000074540.1.97184 WP_000074540.1.97185 WP_000074540.1.97224 WP_000074540.1.97260 WP_000074540.1.97287 WP_000074540.1.97291 WP_000074540.1.97297 WP_000074540.1.97318 WP_000074540.1.97322 WP_000074540.1.97328 WP_000074540.1.97337 WP_000074540.1.97368 WP_000074540.1.97369 WP_000074540.1.97386 WP_000074540.1.97413 WP_000074540.1.97422 WP_000074540.1.97441 WP_000074540.1.97477 WP_000074540.1.97480 WP_000074540.1.97487 WP_000074540.1.97496 WP_000074540.1.97497 WP_000074540.1.97505 WP_000074540.1.97534 WP_000074540.1.97547 WP_000074540.1.97594 WP_000074540.1.97597 WP_000074540.1.97599 WP_000074540.1.97606 WP_000074540.1.97613 WP_000074540.1.97615 WP_000074540.1.97620 WP_000074540.1.97626 WP_000074540.1.97628 WP_000074540.1.97631 WP_000074540.1.97640 WP_000074540.1.97646 WP_000074540.1.97648 WP_000074540.1.97656 WP_000074540.1.97690 WP_000074540.1.97691 WP_000074540.1.97693 WP_000074540.1.97704 WP_000074540.1.97725 WP_000074540.1.97726 WP_000074540.1.97727 WP_000074540.1.97732 WP_000074540.1.97736 WP_000074540.1.9774 WP_000074540.1.9775 WP_000074540.1.97768 WP_000074540.1.97772 WP_000074540.1.97800 WP_000074540.1.97819 WP_000074540.1.97840 WP_000074540.1.97846 WP_000074540.1.97873 WP_000074540.1.97907 WP_000074540.1.9793 WP_000074540.1.97938 WP_000074540.1.97981 WP_000074540.1.97983 WP_000074540.1.97986 WP_000074540.1.9799 WP_000074540.1.97991 WP_000074540.1.98006 WP_000074540.1.98019 WP_000074540.1.98022 WP_000074540.1.98036 WP_000074540.1.9805 WP_000074540.1.98080 WP_000074540.1.98086 WP_000074540.1.98107 WP_000074540.1.9811 WP_000074540.1.98110 WP_000074540.1.98119 WP_000074540.1.98124 WP_000074540.1.98146 WP_000074540.1.98158 WP_000074540.1.98170 WP_000074540.1.98201 WP_000074540.1.98219 WP_000074540.1.98236 WP_000074540.1.98250 WP_000074540.1.9826 WP_000074540.1.98263 WP_000074540.1.98338 WP_000074540.1.98392 WP_000074540.1.98402 WP_000074540.1.98403 WP_000074540.1.9841 WP_000074540.1.98418 WP_000074540.1.98438 WP_000074540.1.98440 WP_000074540.1.98446 WP_000074540.1.98448 WP_000074540.1.98457 WP_000074540.1.98472 WP_000074540.1.98483 WP_000074540.1.98495 WP_000074540.1.9850 WP_000074540.1.98502 WP_000074540.1.98513 WP_000074540.1.98531 WP_000074540.1.98551 WP_000074540.1.98570 WP_000074540.1.98577 WP_000074540.1.98607 WP_000074540.1.98608 WP_000074540.1.98627 WP_000074540.1.9863 WP_000074540.1.98634 WP_000074540.1.98676 WP_000074540.1.98677 WP_000074540.1.98726 WP_000074540.1.98731 WP_000074540.1.98751 WP_000074540.1.98760 WP_000074540.1.98762 WP_000074540.1.98763 WP_000074540.1.9877 WP_000074540.1.98779 WP_000074540.1.98801 WP_000074540.1.98818 WP_000074540.1.98843 WP_000074540.1.9887 WP_000074540.1.98931 WP_000074540.1.98947 WP_000074540.1.9898 WP_000074540.1.99040 WP_000074540.1.99057 WP_000074540.1.99071 WP_000074540.1.99083 WP_000074540.1.99097 WP_000074540.1.99098 WP_000074540.1.99107 WP_000074540.1.99163 WP_000074540.1.99164 WP_000074540.1.99184 WP_000074540.1.9919 WP_000074540.1.99197 WP_000074540.1.99198 WP_000074540.1.99215 WP_000074540.1.99219 WP_000074540.1.99255 WP_000074540.1.99267 WP_000074540.1.99276 WP_000074540.1.99278 WP_000074540.1.99327 WP_000074540.1.99335 WP_000074540.1.99339 WP_000074540.1.99350 WP_000074540.1.99360 WP_000074540.1.99363 WP_000074540.1.99369 WP_000074540.1.99370 WP_000074540.1.99388 WP_000074540.1.99397 WP_000074540.1.99426 WP_000074540.1.99456 WP_000074540.1.99463 WP_000074540.1.99469 WP_000074540.1.99483 WP_000074540.1.99490 WP_000074540.1.99493 WP_000074540.1.99531 WP_000074540.1.9954 WP_000074540.1.99546 WP_000074540.1.99561 WP_000074540.1.99577 WP_000074540.1.99579 WP_000074540.1.99595 WP_000074540.1.99613 WP_000074540.1.99626 WP_000074540.1.99630 WP_000074540.1.99637 WP_000074540.1.99646 WP_000074540.1.99657 WP_000074540.1.99660 WP_000074540.1.99671 WP_000074540.1.99676 WP_000074540.1.99712 WP_000074540.1.99725 WP_000074540.1.99747 WP_000074540.1.99764 WP_000074540.1.99783 WP_000074540.1.99813 WP_000074540.1.99824 WP_000074540.1.99829 WP_000074540.1.99837 WP_000074540.1.99841 WP_000074540.1.99858 WP_000074540.1.99889 WP_000074540.1.9992 WP_000074540.1.99924 WP_000074540.1.99958 WP_000074540.1.99961 WP_000074540.1.99996 gi|549724987|ref|YP_008645177.1| gi|528820149|ref|YP_008361352.1| gi|549479968|ref|YP_008614102.1| gi|161612939|ref|YP_001586904.1| gi|386592138|ref|YP_006088538.1| gi|197250966|ref|YP_002147290.1| gi|378989717|ref|YP_005252881.1| gi|379701563|ref|YP_005243291.1| gi|488653082|ref|YP_007924885.1| gi|563653790|ref|YP_008861866.1| gi|378700241|ref|YP_005182198.1| gi|525946702|ref|YP_008307918.1| gi|16765658|ref|NP_461273.1| gi|16761256|ref|NP_456873.1| gi|525837576|ref|YP_008254418.1| gi|525818218|ref|YP_008248236.1| gi|525829635|ref|YP_008252780.1| gi|56412772|ref|YP_149847.1| gi|378984893|ref|YP_005248048.1| gi|409250938|ref|YP_006886745.1| gi|197361706|ref|YP_002141342.1| gi|29141048|ref|NP_804390.1| 209261.t0533 220341.STY2561 272994.SPAB_00645 295319.SPA0533 321314.SC2332 423368.SNSL254_A2516 439843.SeSA_A2559 454166.SeAg_B2471 454169.SeHA_C2571 476213.SPC_1377 550537.SEN2313 554290.SSPA0497 99287.STM2331 gi|224583182|ref|YP_002636980.1| gi|378451050|ref|YP_005238409.1| gi|452123844|ref|YP_007474092.1| gi|378958680|ref|YP_005216166.1| gi|482904146|ref|YP_007902706.1| gi|526220878|ref|YP_008266577.1| gi|194734179|ref|YP_002115400.1| gi|538362945|ref|YP_008506230.1| gi|207857749|ref|YP_002244400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]