SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482904366|ref|YP_007902926.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482904366|ref|YP_007902926.1|
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.44e-185
Family GABA-aminotransferase-like 0.000000000000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|482904366|ref|YP_007902926.1|
Sequence length 417
Comment serine hydroxymethyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYP
GKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLQPGDTVLGMN
LAQGGHLTHGSPVNFSGKLYNIVPYGIDESGKIDYDEMAKLAKEHKPKMIIGGFSAYSGV
VDWAKMREIADSIGAYLFVDMAHVAGLIAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLIL
AKGGDEELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEFKVYQQQVAKNAKAMVE
VFLNRGYKVVSGGTENHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTS
GIRIGSPAVTRRGFKEAEVKELAGWMCDVLDNINDEATIERVKAKVLDICARFPVYA
Download sequence
Identical sequences A0A0D6F9Z2 A0A0F6B4X3 A0A0F7JC46 A0A0G2NQC4 A0A0H3NPT7 A0A0M0PXF6 A0A0R9P964 A0A0T9W6X4 A0A1C2ZSP6 A0A1R2T4G3 A0A1S0ZMT8 A0A1S1AKW6 A0A1X2RK36 A0A1X2UKG5 A0A1X2Y3S2 A0A1Z3PYQ1 A0A221YNQ6 A0A221YXA1 A0A267S944 A0A271CRH4 A0A2C6E0V8 A0A2D1XBP9 A0A2D3TTZ2 A0A2G1NP67 A0A2H9YE17 A0A2I6MWU9 A0A2I6NAV4 A0A2I6NNJ9 A0A2I6P1H7 A0A2K2ZRA9 A9N1W0 B4T1D1 B4TDC8 B5BAV4 B5F1D2 B5RD24 E8XGP6 G5NGI1 G5PR76 P0A2E1 P0A2E2 Q57LF7 Q5PII3 S5HY17 V1WZS2 V7UBE5
gi|29140835|ref|NP_804177.1| gi|378958447|ref|YP_005215933.1| gi|198245708|ref|YP_002216621.1| d3gbxa1 d3gbxb1 gi|16765875|ref|NP_461490.1| IDP01011 gi|161612678|ref|YP_001586643.1| gi|205353652|ref|YP_002227453.1| gi|525858513|ref|YP_008261826.1| gi|378445972|ref|YP_005233604.1| gi|379701786|ref|YP_005243514.1| gi|383497243|ref|YP_005397932.1| gi|529219014|ref|YP_008379869.1| gi|409251225|ref|YP_006887027.1| NP_457085.1.84458 NP_461490.1.58477 WP_000919178.1.100002 WP_000919178.1.100008 WP_000919178.1.100010 WP_000919178.1.100017 WP_000919178.1.100031 WP_000919178.1.100036 WP_000919178.1.100077 WP_000919178.1.100079 WP_000919178.1.100115 WP_000919178.1.100129 WP_000919178.1.10013 WP_000919178.1.100149 WP_000919178.1.100165 WP_000919178.1.100191 WP_000919178.1.100196 WP_000919178.1.1002 WP_000919178.1.100234 WP_000919178.1.100258 WP_000919178.1.100266 WP_000919178.1.100284 WP_000919178.1.100288 WP_000919178.1.100313 WP_000919178.1.100314 WP_000919178.1.100321 WP_000919178.1.100354 WP_000919178.1.100376 WP_000919178.1.100392 WP_000919178.1.100412 WP_000919178.1.100413 WP_000919178.1.100421 WP_000919178.1.100424 WP_000919178.1.100432 WP_000919178.1.100436 WP_000919178.1.100438 WP_000919178.1.100446 WP_000919178.1.100450 WP_000919178.1.100457 WP_000919178.1.100472 WP_000919178.1.100484 WP_000919178.1.100488 WP_000919178.1.100502 WP_000919178.1.100521 WP_000919178.1.100541 WP_000919178.1.100557 WP_000919178.1.100584 WP_000919178.1.100589 WP_000919178.1.100592 WP_000919178.1.100597 WP_000919178.1.100605 WP_000919178.1.100610 WP_000919178.1.100642 WP_000919178.1.10065 WP_000919178.1.100650 WP_000919178.1.100707 WP_000919178.1.100711 WP_000919178.1.100714 WP_000919178.1.100721 WP_000919178.1.100730 WP_000919178.1.100732 WP_000919178.1.100733 WP_000919178.1.10074 WP_000919178.1.100750 WP_000919178.1.10076 WP_000919178.1.100764 WP_000919178.1.100773 WP_000919178.1.100776 WP_000919178.1.100781 WP_000919178.1.100790 WP_000919178.1.100793 WP_000919178.1.100799 WP_000919178.1.10081 WP_000919178.1.100857 WP_000919178.1.100865 WP_000919178.1.100869 WP_000919178.1.100870 WP_000919178.1.100871 WP_000919178.1.100882 WP_000919178.1.100895 WP_000919178.1.100932 WP_000919178.1.100941 WP_000919178.1.100944 WP_000919178.1.100948 WP_000919178.1.100953 WP_000919178.1.101007 WP_000919178.1.101011 WP_000919178.1.101020 WP_000919178.1.101042 WP_000919178.1.101074 WP_000919178.1.101078 WP_000919178.1.10108 WP_000919178.1.101094 WP_000919178.1.101111 WP_000919178.1.101112 WP_000919178.1.101126 WP_000919178.1.101180 WP_000919178.1.101185 WP_000919178.1.101199 WP_000919178.1.101223 WP_000919178.1.101226 WP_000919178.1.101239 WP_000919178.1.10124 WP_000919178.1.101259 WP_000919178.1.101271 WP_000919178.1.101284 WP_000919178.1.101291 WP_000919178.1.1013 WP_000919178.1.101312 WP_000919178.1.101320 WP_000919178.1.101322 WP_000919178.1.101353 WP_000919178.1.101374 WP_000919178.1.101386 WP_000919178.1.101404 WP_000919178.1.101420 WP_000919178.1.101425 WP_000919178.1.101454 WP_000919178.1.101473 WP_000919178.1.101519 WP_000919178.1.101520 WP_000919178.1.101541 WP_000919178.1.101589 WP_000919178.1.101609 WP_000919178.1.101612 WP_000919178.1.101616 WP_000919178.1.101634 WP_000919178.1.101636 WP_000919178.1.101639 WP_000919178.1.101666 WP_000919178.1.101674 WP_000919178.1.101707 WP_000919178.1.101724 WP_000919178.1.101734 WP_000919178.1.101740 WP_000919178.1.101741 WP_000919178.1.101744 WP_000919178.1.101759 WP_000919178.1.10177 WP_000919178.1.101776 WP_000919178.1.101815 WP_000919178.1.101832 WP_000919178.1.101839 WP_000919178.1.101841 WP_000919178.1.101878 WP_000919178.1.101890 WP_000919178.1.101904 WP_000919178.1.10191 WP_000919178.1.101917 WP_000919178.1.101927 WP_000919178.1.101941 WP_000919178.1.101949 WP_000919178.1.101953 WP_000919178.1.101975 WP_000919178.1.102009 WP_000919178.1.102050 WP_000919178.1.102087 WP_000919178.1.102103 WP_000919178.1.102111 WP_000919178.1.10220 WP_000919178.1.10266 WP_000919178.1.10300 WP_000919178.1.10310 WP_000919178.1.10338 WP_000919178.1.1038 WP_000919178.1.10394 WP_000919178.1.104 WP_000919178.1.10401 WP_000919178.1.10428 WP_000919178.1.10429 WP_000919178.1.10439 WP_000919178.1.10459 WP_000919178.1.10463 WP_000919178.1.10465 WP_000919178.1.10475 WP_000919178.1.10498 WP_000919178.1.10507 WP_000919178.1.10511 WP_000919178.1.10514 WP_000919178.1.10521 WP_000919178.1.10530 WP_000919178.1.10532 WP_000919178.1.10547 WP_000919178.1.10562 WP_000919178.1.10566 WP_000919178.1.10568 WP_000919178.1.10595 WP_000919178.1.106 WP_000919178.1.10631 WP_000919178.1.10642 WP_000919178.1.10654 WP_000919178.1.10675 WP_000919178.1.10677 WP_000919178.1.10678 WP_000919178.1.10711 WP_000919178.1.10720 WP_000919178.1.10753 WP_000919178.1.10755 WP_000919178.1.10797 WP_000919178.1.10857 WP_000919178.1.10868 WP_000919178.1.10873 WP_000919178.1.10898 WP_000919178.1.10926 WP_000919178.1.10936 WP_000919178.1.10992 WP_000919178.1.11000 WP_000919178.1.11012 WP_000919178.1.11024 WP_000919178.1.11031 WP_000919178.1.11041 WP_000919178.1.11055 WP_000919178.1.11098 WP_000919178.1.1110 WP_000919178.1.11119 WP_000919178.1.11126 WP_000919178.1.11142 WP_000919178.1.11156 WP_000919178.1.11168 WP_000919178.1.11190 WP_000919178.1.11213 WP_000919178.1.11216 WP_000919178.1.11239 WP_000919178.1.11253 WP_000919178.1.11254 WP_000919178.1.11295 WP_000919178.1.113 WP_000919178.1.11304 WP_000919178.1.11314 WP_000919178.1.1135 WP_000919178.1.11362 WP_000919178.1.11369 WP_000919178.1.1137 WP_000919178.1.11385 WP_000919178.1.11405 WP_000919178.1.1142 WP_000919178.1.11426 WP_000919178.1.11429 WP_000919178.1.11444 WP_000919178.1.11455 WP_000919178.1.11458 WP_000919178.1.11479 WP_000919178.1.1150 WP_000919178.1.11511 WP_000919178.1.11518 WP_000919178.1.11526 WP_000919178.1.11528 WP_000919178.1.11532 WP_000919178.1.11543 WP_000919178.1.11544 WP_000919178.1.11557 WP_000919178.1.1156 WP_000919178.1.11565 WP_000919178.1.11567 WP_000919178.1.11603 WP_000919178.1.11621 WP_000919178.1.11638 WP_000919178.1.11687 WP_000919178.1.1169 WP_000919178.1.1174 WP_000919178.1.11763 WP_000919178.1.11772 WP_000919178.1.11810 WP_000919178.1.11824 WP_000919178.1.11834 WP_000919178.1.11841 WP_000919178.1.11865 WP_000919178.1.11868 WP_000919178.1.11875 WP_000919178.1.11883 WP_000919178.1.11897 WP_000919178.1.11900 WP_000919178.1.11908 WP_000919178.1.11914 WP_000919178.1.11936 WP_000919178.1.11938 WP_000919178.1.11964 WP_000919178.1.11978 WP_000919178.1.12007 WP_000919178.1.12017 WP_000919178.1.12025 WP_000919178.1.12027 WP_000919178.1.12040 WP_000919178.1.12059 WP_000919178.1.12061 WP_000919178.1.12063 WP_000919178.1.1207 WP_000919178.1.12106 WP_000919178.1.12114 WP_000919178.1.12141 WP_000919178.1.1215 WP_000919178.1.12159 WP_000919178.1.12160 WP_000919178.1.12168 WP_000919178.1.12172 WP_000919178.1.12192 WP_000919178.1.12210 WP_000919178.1.1224 WP_000919178.1.12244 WP_000919178.1.12280 WP_000919178.1.12282 WP_000919178.1.12308 WP_000919178.1.12340 WP_000919178.1.12351 WP_000919178.1.12364 WP_000919178.1.12370 WP_000919178.1.12374 WP_000919178.1.1239 WP_000919178.1.12396 WP_000919178.1.12397 WP_000919178.1.12398 WP_000919178.1.12441 WP_000919178.1.1246 WP_000919178.1.12472 WP_000919178.1.12484 WP_000919178.1.12485 WP_000919178.1.1250 WP_000919178.1.12546 WP_000919178.1.12568 WP_000919178.1.12569 WP_000919178.1.12581 WP_000919178.1.12584 WP_000919178.1.12585 WP_000919178.1.12620 WP_000919178.1.1264 WP_000919178.1.12648 WP_000919178.1.12650 WP_000919178.1.12683 WP_000919178.1.12696 WP_000919178.1.12701 WP_000919178.1.12718 WP_000919178.1.12726 WP_000919178.1.12727 WP_000919178.1.12728 WP_000919178.1.12741 WP_000919178.1.12834 WP_000919178.1.12864 WP_000919178.1.12865 WP_000919178.1.12879 WP_000919178.1.12936 WP_000919178.1.1299 WP_000919178.1.12995 WP_000919178.1.1300 WP_000919178.1.13027 WP_000919178.1.13076 WP_000919178.1.13101 WP_000919178.1.13102 WP_000919178.1.13106 WP_000919178.1.13108 WP_000919178.1.13130 WP_000919178.1.13161 WP_000919178.1.13207 WP_000919178.1.1321 WP_000919178.1.13247 WP_000919178.1.1326 WP_000919178.1.13262 WP_000919178.1.13268 WP_000919178.1.13274 WP_000919178.1.13291 WP_000919178.1.133 WP_000919178.1.13311 WP_000919178.1.13314 WP_000919178.1.13334 WP_000919178.1.13338 WP_000919178.1.13342 WP_000919178.1.13352 WP_000919178.1.13367 WP_000919178.1.13391 WP_000919178.1.13406 WP_000919178.1.13414 WP_000919178.1.13429 WP_000919178.1.13440 WP_000919178.1.13443 WP_000919178.1.13446 WP_000919178.1.1346 WP_000919178.1.13476 WP_000919178.1.13488 WP_000919178.1.13509 WP_000919178.1.13573 WP_000919178.1.13599 WP_000919178.1.13602 WP_000919178.1.13625 WP_000919178.1.13661 WP_000919178.1.13669 WP_000919178.1.13677 WP_000919178.1.13686 WP_000919178.1.13691 WP_000919178.1.1372 WP_000919178.1.13732 WP_000919178.1.13741 WP_000919178.1.13750 WP_000919178.1.13764 WP_000919178.1.13819 WP_000919178.1.1382 WP_000919178.1.13829 WP_000919178.1.13857 WP_000919178.1.1387 WP_000919178.1.13908 WP_000919178.1.13932 WP_000919178.1.13967 WP_000919178.1.13968 WP_000919178.1.1397 WP_000919178.1.13972 WP_000919178.1.140 WP_000919178.1.14001 WP_000919178.1.1401 WP_000919178.1.14041 WP_000919178.1.14050 WP_000919178.1.14056 WP_000919178.1.1408 WP_000919178.1.14089 WP_000919178.1.14099 WP_000919178.1.14111 WP_000919178.1.1412 WP_000919178.1.14120 WP_000919178.1.14123 WP_000919178.1.14150 WP_000919178.1.14151 WP_000919178.1.14191 WP_000919178.1.14197 WP_000919178.1.14239 WP_000919178.1.14280 WP_000919178.1.14286 WP_000919178.1.14320 WP_000919178.1.14333 WP_000919178.1.14369 WP_000919178.1.14379 WP_000919178.1.14399 WP_000919178.1.1440 WP_000919178.1.14406 WP_000919178.1.14410 WP_000919178.1.14436 WP_000919178.1.14444 WP_000919178.1.14446 WP_000919178.1.14466 WP_000919178.1.14467 WP_000919178.1.14474 WP_000919178.1.14495 WP_000919178.1.14500 WP_000919178.1.14505 WP_000919178.1.14516 WP_000919178.1.14519 WP_000919178.1.14524 WP_000919178.1.14526 WP_000919178.1.14528 WP_000919178.1.14550 WP_000919178.1.14554 WP_000919178.1.14575 WP_000919178.1.146 WP_000919178.1.14618 WP_000919178.1.14688 WP_000919178.1.14701 WP_000919178.1.14703 WP_000919178.1.14706 WP_000919178.1.14708 WP_000919178.1.14719 WP_000919178.1.14725 WP_000919178.1.1473 WP_000919178.1.14737 WP_000919178.1.14765 WP_000919178.1.14789 WP_000919178.1.14793 WP_000919178.1.14810 WP_000919178.1.14819 WP_000919178.1.14852 WP_000919178.1.14876 WP_000919178.1.14877 WP_000919178.1.14884 WP_000919178.1.1489 WP_000919178.1.14894 WP_000919178.1.14913 WP_000919178.1.14917 WP_000919178.1.14930 WP_000919178.1.14932 WP_000919178.1.14936 WP_000919178.1.14947 WP_000919178.1.14948 WP_000919178.1.14964 WP_000919178.1.15011 WP_000919178.1.15046 WP_000919178.1.15055 WP_000919178.1.15059 WP_000919178.1.15067 WP_000919178.1.15079 WP_000919178.1.15100 WP_000919178.1.15102 WP_000919178.1.15124 WP_000919178.1.15184 WP_000919178.1.15214 WP_000919178.1.15223 WP_000919178.1.15226 WP_000919178.1.15244 WP_000919178.1.15265 WP_000919178.1.15276 WP_000919178.1.15316 WP_000919178.1.15318 WP_000919178.1.15353 WP_000919178.1.15362 WP_000919178.1.15369 WP_000919178.1.1540 WP_000919178.1.15415 WP_000919178.1.15423 WP_000919178.1.15433 WP_000919178.1.15439 WP_000919178.1.15468 WP_000919178.1.15479 WP_000919178.1.15483 WP_000919178.1.15487 WP_000919178.1.15508 WP_000919178.1.1551 WP_000919178.1.15535 WP_000919178.1.15581 WP_000919178.1.15585 WP_000919178.1.15586 WP_000919178.1.15597 WP_000919178.1.15612 WP_000919178.1.15616 WP_000919178.1.15625 WP_000919178.1.15627 WP_000919178.1.15644 WP_000919178.1.1568 WP_000919178.1.15708 WP_000919178.1.15710 WP_000919178.1.15717 WP_000919178.1.15775 WP_000919178.1.15777 WP_000919178.1.15784 WP_000919178.1.15795 WP_000919178.1.15830 WP_000919178.1.15835 WP_000919178.1.15881 WP_000919178.1.15905 WP_000919178.1.15909 WP_000919178.1.15912 WP_000919178.1.1592 WP_000919178.1.15922 WP_000919178.1.15938 WP_000919178.1.15970 WP_000919178.1.15978 WP_000919178.1.15986 WP_000919178.1.15995 WP_000919178.1.16000 WP_000919178.1.16004 WP_000919178.1.16006 WP_000919178.1.1601 WP_000919178.1.16028 WP_000919178.1.16032 WP_000919178.1.16046 WP_000919178.1.16051 WP_000919178.1.16052 WP_000919178.1.16058 WP_000919178.1.16062 WP_000919178.1.16063 WP_000919178.1.16103 WP_000919178.1.1611 WP_000919178.1.16125 WP_000919178.1.16150 WP_000919178.1.16155 WP_000919178.1.16158 WP_000919178.1.16166 WP_000919178.1.16172 WP_000919178.1.16201 WP_000919178.1.16226 WP_000919178.1.16233 WP_000919178.1.16244 WP_000919178.1.1626 WP_000919178.1.16264 WP_000919178.1.16273 WP_000919178.1.16284 WP_000919178.1.16328 WP_000919178.1.16331 WP_000919178.1.16344 WP_000919178.1.1635 WP_000919178.1.16361 WP_000919178.1.16363 WP_000919178.1.16365 WP_000919178.1.16366 WP_000919178.1.16394 WP_000919178.1.16452 WP_000919178.1.16453 WP_000919178.1.16461 WP_000919178.1.16462 WP_000919178.1.16465 WP_000919178.1.16468 WP_000919178.1.16474 WP_000919178.1.16508 WP_000919178.1.16522 WP_000919178.1.16525 WP_000919178.1.16551 WP_000919178.1.16565 WP_000919178.1.16581 WP_000919178.1.16588 WP_000919178.1.16614 WP_000919178.1.16650 WP_000919178.1.16656 WP_000919178.1.16658 WP_000919178.1.16666 WP_000919178.1.16673 WP_000919178.1.16686 WP_000919178.1.16691 WP_000919178.1.167 WP_000919178.1.16710 WP_000919178.1.16729 WP_000919178.1.16732 WP_000919178.1.16735 WP_000919178.1.16736 WP_000919178.1.1674 WP_000919178.1.16767 WP_000919178.1.16781 WP_000919178.1.16786 WP_000919178.1.16819 WP_000919178.1.16826 WP_000919178.1.16846 WP_000919178.1.16855 WP_000919178.1.16858 WP_000919178.1.16873 WP_000919178.1.16879 WP_000919178.1.1689 WP_000919178.1.16893 WP_000919178.1.16896 WP_000919178.1.16903 WP_000919178.1.16905 WP_000919178.1.16910 WP_000919178.1.16916 WP_000919178.1.16941 WP_000919178.1.16942 WP_000919178.1.16944 WP_000919178.1.16948 WP_000919178.1.16949 WP_000919178.1.16965 WP_000919178.1.16972 WP_000919178.1.1700 WP_000919178.1.17031 WP_000919178.1.17049 WP_000919178.1.17058 WP_000919178.1.17060 WP_000919178.1.17078 WP_000919178.1.17093 WP_000919178.1.17096 WP_000919178.1.17105 WP_000919178.1.17188 WP_000919178.1.17202 WP_000919178.1.17219 WP_000919178.1.1722 WP_000919178.1.17285 WP_000919178.1.17302 WP_000919178.1.17307 WP_000919178.1.17308 WP_000919178.1.1733 WP_000919178.1.17368 WP_000919178.1.1737 WP_000919178.1.17390 WP_000919178.1.174 WP_000919178.1.17405 WP_000919178.1.17406 WP_000919178.1.17439 WP_000919178.1.17447 WP_000919178.1.17480 WP_000919178.1.17482 WP_000919178.1.1749 WP_000919178.1.17504 WP_000919178.1.17513 WP_000919178.1.17525 WP_000919178.1.17543 WP_000919178.1.17546 WP_000919178.1.17560 WP_000919178.1.17563 WP_000919178.1.1757 WP_000919178.1.17578 WP_000919178.1.17583 WP_000919178.1.17622 WP_000919178.1.17629 WP_000919178.1.17659 WP_000919178.1.17667 WP_000919178.1.17686 WP_000919178.1.17693 WP_000919178.1.17702 WP_000919178.1.17703 WP_000919178.1.17705 WP_000919178.1.17732 WP_000919178.1.17741 WP_000919178.1.17743 WP_000919178.1.17747 WP_000919178.1.17755 WP_000919178.1.17758 WP_000919178.1.17840 WP_000919178.1.17865 WP_000919178.1.17886 WP_000919178.1.17891 WP_000919178.1.17901 WP_000919178.1.17914 WP_000919178.1.17919 WP_000919178.1.17936 WP_000919178.1.17949 WP_000919178.1.17956 WP_000919178.1.17991 WP_000919178.1.18005 WP_000919178.1.1801 WP_000919178.1.18019 WP_000919178.1.18021 WP_000919178.1.18022 WP_000919178.1.18056 WP_000919178.1.18061 WP_000919178.1.1807 WP_000919178.1.18089 WP_000919178.1.18092 WP_000919178.1.18099 WP_000919178.1.18103 WP_000919178.1.18109 WP_000919178.1.18111 WP_000919178.1.18122 WP_000919178.1.18124 WP_000919178.1.1814 WP_000919178.1.18144 WP_000919178.1.18149 WP_000919178.1.18163 WP_000919178.1.18173 WP_000919178.1.18177 WP_000919178.1.18178 WP_000919178.1.18192 WP_000919178.1.18249 WP_000919178.1.1825 WP_000919178.1.18254 WP_000919178.1.18265 WP_000919178.1.18267 WP_000919178.1.18270 WP_000919178.1.18280 WP_000919178.1.18281 WP_000919178.1.18282 WP_000919178.1.18328 WP_000919178.1.18355 WP_000919178.1.18358 WP_000919178.1.18370 WP_000919178.1.18384 WP_000919178.1.18406 WP_000919178.1.18441 WP_000919178.1.18445 WP_000919178.1.18468 WP_000919178.1.18474 WP_000919178.1.18485 WP_000919178.1.18489 WP_000919178.1.18513 WP_000919178.1.18607 WP_000919178.1.18610 WP_000919178.1.18641 WP_000919178.1.18678 WP_000919178.1.18686 WP_000919178.1.18705 WP_000919178.1.18715 WP_000919178.1.18722 WP_000919178.1.18737 WP_000919178.1.18766 WP_000919178.1.18776 WP_000919178.1.1880 WP_000919178.1.18822 WP_000919178.1.18847 WP_000919178.1.1885 WP_000919178.1.18860 WP_000919178.1.18881 WP_000919178.1.18886 WP_000919178.1.18895 WP_000919178.1.18919 WP_000919178.1.18922 WP_000919178.1.18940 WP_000919178.1.18949 WP_000919178.1.1895 WP_000919178.1.18959 WP_000919178.1.1897 WP_000919178.1.18972 WP_000919178.1.19001 WP_000919178.1.19006 WP_000919178.1.19030 WP_000919178.1.19038 WP_000919178.1.19044 WP_000919178.1.19053 WP_000919178.1.19064 WP_000919178.1.19084 WP_000919178.1.19093 WP_000919178.1.19163 WP_000919178.1.19187 WP_000919178.1.19228 WP_000919178.1.19240 WP_000919178.1.19288 WP_000919178.1.19291 WP_000919178.1.19300 WP_000919178.1.19320 WP_000919178.1.19340 WP_000919178.1.19357 WP_000919178.1.19373 WP_000919178.1.1939 WP_000919178.1.19422 WP_000919178.1.19433 WP_000919178.1.19454 WP_000919178.1.19456 WP_000919178.1.19458 WP_000919178.1.19460 WP_000919178.1.19461 WP_000919178.1.19469 WP_000919178.1.19496 WP_000919178.1.19535 WP_000919178.1.19538 WP_000919178.1.1954 WP_000919178.1.1955 WP_000919178.1.19588 WP_000919178.1.19589 WP_000919178.1.19614 WP_000919178.1.19616 WP_000919178.1.19642 WP_000919178.1.19656 WP_000919178.1.19660 WP_000919178.1.19663 WP_000919178.1.1968 WP_000919178.1.19683 WP_000919178.1.19686 WP_000919178.1.19702 WP_000919178.1.19706 WP_000919178.1.19723 WP_000919178.1.19724 WP_000919178.1.19731 WP_000919178.1.19740 WP_000919178.1.19749 WP_000919178.1.19784 WP_000919178.1.19794 WP_000919178.1.19802 WP_000919178.1.19809 WP_000919178.1.19823 WP_000919178.1.19834 WP_000919178.1.19851 WP_000919178.1.19863 WP_000919178.1.19867 WP_000919178.1.19882 WP_000919178.1.19884 WP_000919178.1.1990 WP_000919178.1.1992 WP_000919178.1.19938 WP_000919178.1.19967 WP_000919178.1.19970 WP_000919178.1.19975 WP_000919178.1.1998 WP_000919178.1.19987 WP_000919178.1.19999 WP_000919178.1.20 WP_000919178.1.20034 WP_000919178.1.20081 WP_000919178.1.20086 WP_000919178.1.20089 WP_000919178.1.20091 WP_000919178.1.2010 WP_000919178.1.20212 WP_000919178.1.20254 WP_000919178.1.20255 WP_000919178.1.2026 WP_000919178.1.20261 WP_000919178.1.20266 WP_000919178.1.20271 WP_000919178.1.20296 WP_000919178.1.20330 WP_000919178.1.20339 WP_000919178.1.2036 WP_000919178.1.20362 WP_000919178.1.20364 WP_000919178.1.20376 WP_000919178.1.20391 WP_000919178.1.2041 WP_000919178.1.20418 WP_000919178.1.20419 WP_000919178.1.20425 WP_000919178.1.20437 WP_000919178.1.20443 WP_000919178.1.20446 WP_000919178.1.20465 WP_000919178.1.2047 WP_000919178.1.20488 WP_000919178.1.20492 WP_000919178.1.20503 WP_000919178.1.20525 WP_000919178.1.2053 WP_000919178.1.2054 WP_000919178.1.20553 WP_000919178.1.20564 WP_000919178.1.20573 WP_000919178.1.20626 WP_000919178.1.20631 WP_000919178.1.20635 WP_000919178.1.20646 WP_000919178.1.20695 WP_000919178.1.20700 WP_000919178.1.20718 WP_000919178.1.20721 WP_000919178.1.2073 WP_000919178.1.20740 WP_000919178.1.20760 WP_000919178.1.20767 WP_000919178.1.20787 WP_000919178.1.20789 WP_000919178.1.20795 WP_000919178.1.20828 WP_000919178.1.20839 WP_000919178.1.20862 WP_000919178.1.2087 WP_000919178.1.20883 WP_000919178.1.20886 WP_000919178.1.20894 WP_000919178.1.20900 WP_000919178.1.20908 WP_000919178.1.2091 WP_000919178.1.20947 WP_000919178.1.20953 WP_000919178.1.2101 WP_000919178.1.21010 WP_000919178.1.21049 WP_000919178.1.2106 WP_000919178.1.21062 WP_000919178.1.2107 WP_000919178.1.21075 WP_000919178.1.21079 WP_000919178.1.21086 WP_000919178.1.21089 WP_000919178.1.21103 WP_000919178.1.21136 WP_000919178.1.21144 WP_000919178.1.21146 WP_000919178.1.2116 WP_000919178.1.21162 WP_000919178.1.21165 WP_000919178.1.21181 WP_000919178.1.21184 WP_000919178.1.21185 WP_000919178.1.21194 WP_000919178.1.21202 WP_000919178.1.21241 WP_000919178.1.21245 WP_000919178.1.21246 WP_000919178.1.21269 WP_000919178.1.21286 WP_000919178.1.21309 WP_000919178.1.21326 WP_000919178.1.21332 WP_000919178.1.21351 WP_000919178.1.21362 WP_000919178.1.21366 WP_000919178.1.2139 WP_000919178.1.21399 WP_000919178.1.21400 WP_000919178.1.21404 WP_000919178.1.21423 WP_000919178.1.21443 WP_000919178.1.21453 WP_000919178.1.2146 WP_000919178.1.21492 WP_000919178.1.21497 WP_000919178.1.21499 WP_000919178.1.21534 WP_000919178.1.21548 WP_000919178.1.21603 WP_000919178.1.21616 WP_000919178.1.2166 WP_000919178.1.21674 WP_000919178.1.21681 WP_000919178.1.21692 WP_000919178.1.21715 WP_000919178.1.21728 WP_000919178.1.21730 WP_000919178.1.21750 WP_000919178.1.21751 WP_000919178.1.21757 WP_000919178.1.21792 WP_000919178.1.21825 WP_000919178.1.21845 WP_000919178.1.21877 WP_000919178.1.21886 WP_000919178.1.21909 WP_000919178.1.21910 WP_000919178.1.21940 WP_000919178.1.21946 WP_000919178.1.21950 WP_000919178.1.21966 WP_000919178.1.21981 WP_000919178.1.21991 WP_000919178.1.22019 WP_000919178.1.22024 WP_000919178.1.22030 WP_000919178.1.2205 WP_000919178.1.22051 WP_000919178.1.22062 WP_000919178.1.22064 WP_000919178.1.22067 WP_000919178.1.22096 WP_000919178.1.22117 WP_000919178.1.22118 WP_000919178.1.22126 WP_000919178.1.22136 WP_000919178.1.22158 WP_000919178.1.2216 WP_000919178.1.22162 WP_000919178.1.22169 WP_000919178.1.22205 WP_000919178.1.22208 WP_000919178.1.2221 WP_000919178.1.22235 WP_000919178.1.2224 WP_000919178.1.22240 WP_000919178.1.2227 WP_000919178.1.22270 WP_000919178.1.22296 WP_000919178.1.22315 WP_000919178.1.22323 WP_000919178.1.22337 WP_000919178.1.22346 WP_000919178.1.2235 WP_000919178.1.22373 WP_000919178.1.22379 WP_000919178.1.22388 WP_000919178.1.22427 WP_000919178.1.22449 WP_000919178.1.22451 WP_000919178.1.22453 WP_000919178.1.22454 WP_000919178.1.2246 WP_000919178.1.22460 WP_000919178.1.22476 WP_000919178.1.22485 WP_000919178.1.22514 WP_000919178.1.22537 WP_000919178.1.22565 WP_000919178.1.22566 WP_000919178.1.22575 WP_000919178.1.22582 WP_000919178.1.22590 WP_000919178.1.22595 WP_000919178.1.22604 WP_000919178.1.22605 WP_000919178.1.22614 WP_000919178.1.22620 WP_000919178.1.22623 WP_000919178.1.22652 WP_000919178.1.22676 WP_000919178.1.22683 WP_000919178.1.22760 WP_000919178.1.2283 WP_000919178.1.2284 WP_000919178.1.22845 WP_000919178.1.22855 WP_000919178.1.22857 WP_000919178.1.22870 WP_000919178.1.22880 WP_000919178.1.22895 WP_000919178.1.22902 WP_000919178.1.22926 WP_000919178.1.22943 WP_000919178.1.22947 WP_000919178.1.22967 WP_000919178.1.22979 WP_000919178.1.23010 WP_000919178.1.23040 WP_000919178.1.23058 WP_000919178.1.23080 WP_000919178.1.23102 WP_000919178.1.23114 WP_000919178.1.2314 WP_000919178.1.23148 WP_000919178.1.23155 WP_000919178.1.23169 WP_000919178.1.23172 WP_000919178.1.23175 WP_000919178.1.23192 WP_000919178.1.23201 WP_000919178.1.23218 WP_000919178.1.2324 WP_000919178.1.23246 WP_000919178.1.23258 WP_000919178.1.23259 WP_000919178.1.23274 WP_000919178.1.23279 WP_000919178.1.23309 WP_000919178.1.2331 WP_000919178.1.23311 WP_000919178.1.2332 WP_000919178.1.23329 WP_000919178.1.23340 WP_000919178.1.23343 WP_000919178.1.2336 WP_000919178.1.23365 WP_000919178.1.23379 WP_000919178.1.23409 WP_000919178.1.23412 WP_000919178.1.2342 WP_000919178.1.23426 WP_000919178.1.23442 WP_000919178.1.23444 WP_000919178.1.23460 WP_000919178.1.23466 WP_000919178.1.23472 WP_000919178.1.23482 WP_000919178.1.23485 WP_000919178.1.23492 WP_000919178.1.235 WP_000919178.1.23500 WP_000919178.1.23503 WP_000919178.1.23509 WP_000919178.1.23513 WP_000919178.1.23515 WP_000919178.1.23529 WP_000919178.1.23548 WP_000919178.1.23571 WP_000919178.1.2358 WP_000919178.1.23587 WP_000919178.1.23604 WP_000919178.1.23621 WP_000919178.1.23629 WP_000919178.1.23631 WP_000919178.1.23634 WP_000919178.1.23639 WP_000919178.1.2364 WP_000919178.1.23643 WP_000919178.1.23646 WP_000919178.1.23670 WP_000919178.1.23675 WP_000919178.1.23679 WP_000919178.1.23685 WP_000919178.1.237 WP_000919178.1.23707 WP_000919178.1.23720 WP_000919178.1.23728 WP_000919178.1.23736 WP_000919178.1.23746 WP_000919178.1.2375 WP_000919178.1.23755 WP_000919178.1.2376 WP_000919178.1.23783 WP_000919178.1.23786 WP_000919178.1.23787 WP_000919178.1.2380 WP_000919178.1.23801 WP_000919178.1.23819 WP_000919178.1.23932 WP_000919178.1.24017 WP_000919178.1.24028 WP_000919178.1.24061 WP_000919178.1.24082 WP_000919178.1.24083 WP_000919178.1.24117 WP_000919178.1.24125 WP_000919178.1.24138 WP_000919178.1.24145 WP_000919178.1.2415 WP_000919178.1.24153 WP_000919178.1.24158 WP_000919178.1.24163 WP_000919178.1.24206 WP_000919178.1.24214 WP_000919178.1.24250 WP_000919178.1.24259 WP_000919178.1.24291 WP_000919178.1.24297 WP_000919178.1.24303 WP_000919178.1.24308 WP_000919178.1.24322 WP_000919178.1.24325 WP_000919178.1.24355 WP_000919178.1.24361 WP_000919178.1.24375 WP_000919178.1.24392 WP_000919178.1.24394 WP_000919178.1.24400 WP_000919178.1.24408 WP_000919178.1.24409 WP_000919178.1.24419 WP_000919178.1.24420 WP_000919178.1.24433 WP_000919178.1.24444 WP_000919178.1.24450 WP_000919178.1.24476 WP_000919178.1.24494 WP_000919178.1.24555 WP_000919178.1.24578 WP_000919178.1.24619 WP_000919178.1.24643 WP_000919178.1.2467 WP_000919178.1.24673 WP_000919178.1.24686 WP_000919178.1.24688 WP_000919178.1.24689 WP_000919178.1.24696 WP_000919178.1.24716 WP_000919178.1.24723 WP_000919178.1.24727 WP_000919178.1.24737 WP_000919178.1.24779 WP_000919178.1.24803 WP_000919178.1.2481 WP_000919178.1.24832 WP_000919178.1.24837 WP_000919178.1.24839 WP_000919178.1.24873 WP_000919178.1.24901 WP_000919178.1.24944 WP_000919178.1.24964 WP_000919178.1.24995 WP_000919178.1.25008 WP_000919178.1.25015 WP_000919178.1.25017 WP_000919178.1.25032 WP_000919178.1.25041 WP_000919178.1.25053 WP_000919178.1.25064 WP_000919178.1.25072 WP_000919178.1.25130 WP_000919178.1.25140 WP_000919178.1.25159 WP_000919178.1.25175 WP_000919178.1.25185 WP_000919178.1.25196 WP_000919178.1.25205 WP_000919178.1.25206 WP_000919178.1.25210 WP_000919178.1.25217 WP_000919178.1.25219 WP_000919178.1.25229 WP_000919178.1.2525 WP_000919178.1.25297 WP_000919178.1.25304 WP_000919178.1.25354 WP_000919178.1.25374 WP_000919178.1.25405 WP_000919178.1.25421 WP_000919178.1.25426 WP_000919178.1.25454 WP_000919178.1.25475 WP_000919178.1.25490 WP_000919178.1.25493 WP_000919178.1.25498 WP_000919178.1.25508 WP_000919178.1.25512 WP_000919178.1.25514 WP_000919178.1.2554 WP_000919178.1.25546 WP_000919178.1.25564 WP_000919178.1.25596 WP_000919178.1.25603 WP_000919178.1.25618 WP_000919178.1.2562 WP_000919178.1.25666 WP_000919178.1.25668 WP_000919178.1.2568 WP_000919178.1.25690 WP_000919178.1.2570 WP_000919178.1.25700 WP_000919178.1.25703 WP_000919178.1.25709 WP_000919178.1.25722 WP_000919178.1.25740 WP_000919178.1.25780 WP_000919178.1.25793 WP_000919178.1.25807 WP_000919178.1.25809 WP_000919178.1.2581 WP_000919178.1.25814 WP_000919178.1.25821 WP_000919178.1.25825 WP_000919178.1.25833 WP_000919178.1.25835 WP_000919178.1.25846 WP_000919178.1.25882 WP_000919178.1.25911 WP_000919178.1.25928 WP_000919178.1.25932 WP_000919178.1.25944 WP_000919178.1.25951 WP_000919178.1.25962 WP_000919178.1.25963 WP_000919178.1.25988 WP_000919178.1.26001 WP_000919178.1.26027 WP_000919178.1.26030 WP_000919178.1.26034 WP_000919178.1.26075 WP_000919178.1.26083 WP_000919178.1.26093 WP_000919178.1.26107 WP_000919178.1.26122 WP_000919178.1.26123 WP_000919178.1.26129 WP_000919178.1.2615 WP_000919178.1.26194 WP_000919178.1.26199 WP_000919178.1.26213 WP_000919178.1.26217 WP_000919178.1.26224 WP_000919178.1.26230 WP_000919178.1.26232 WP_000919178.1.26269 WP_000919178.1.26272 WP_000919178.1.26282 WP_000919178.1.26286 WP_000919178.1.26288 WP_000919178.1.26311 WP_000919178.1.26319 WP_000919178.1.2634 WP_000919178.1.26363 WP_000919178.1.26384 WP_000919178.1.26394 WP_000919178.1.26426 WP_000919178.1.26429 WP_000919178.1.26440 WP_000919178.1.26441 WP_000919178.1.26491 WP_000919178.1.26493 WP_000919178.1.26512 WP_000919178.1.26532 WP_000919178.1.2654 WP_000919178.1.26551 WP_000919178.1.26554 WP_000919178.1.26563 WP_000919178.1.26567 WP_000919178.1.26582 WP_000919178.1.26587 WP_000919178.1.2660 WP_000919178.1.26636 WP_000919178.1.26646 WP_000919178.1.2667 WP_000919178.1.26687 WP_000919178.1.26689 WP_000919178.1.26709 WP_000919178.1.2672 WP_000919178.1.26750 WP_000919178.1.26787 WP_000919178.1.2679 WP_000919178.1.26794 WP_000919178.1.26856 WP_000919178.1.26882 WP_000919178.1.26883 WP_000919178.1.26892 WP_000919178.1.26908 WP_000919178.1.26919 WP_000919178.1.2692 WP_000919178.1.26924 WP_000919178.1.26928 WP_000919178.1.26936 WP_000919178.1.26980 WP_000919178.1.270 WP_000919178.1.27008 WP_000919178.1.27027 WP_000919178.1.27055 WP_000919178.1.27070 WP_000919178.1.27072 WP_000919178.1.27077 WP_000919178.1.27086 WP_000919178.1.27087 WP_000919178.1.27111 WP_000919178.1.27115 WP_000919178.1.2713 WP_000919178.1.27169 WP_000919178.1.2717 WP_000919178.1.27173 WP_000919178.1.272 WP_000919178.1.27206 WP_000919178.1.27223 WP_000919178.1.27228 WP_000919178.1.2723 WP_000919178.1.27255 WP_000919178.1.27272 WP_000919178.1.27279 WP_000919178.1.27282 WP_000919178.1.27285 WP_000919178.1.27309 WP_000919178.1.27314 WP_000919178.1.27329 WP_000919178.1.27342 WP_000919178.1.27361 WP_000919178.1.27383 WP_000919178.1.27419 WP_000919178.1.27423 WP_000919178.1.27452 WP_000919178.1.27513 WP_000919178.1.27523 WP_000919178.1.27535 WP_000919178.1.27544 WP_000919178.1.27547 WP_000919178.1.27556 WP_000919178.1.27561 WP_000919178.1.27565 WP_000919178.1.27595 WP_000919178.1.27598 WP_000919178.1.27616 WP_000919178.1.2763 WP_000919178.1.27632 WP_000919178.1.27638 WP_000919178.1.27658 WP_000919178.1.27665 WP_000919178.1.27679 WP_000919178.1.27706 WP_000919178.1.27707 WP_000919178.1.27713 WP_000919178.1.27755 WP_000919178.1.27761 WP_000919178.1.2777 WP_000919178.1.27775 WP_000919178.1.27776 WP_000919178.1.27785 WP_000919178.1.27798 WP_000919178.1.27800 WP_000919178.1.27815 WP_000919178.1.27833 WP_000919178.1.27857 WP_000919178.1.27883 WP_000919178.1.27900 WP_000919178.1.27928 WP_000919178.1.27945 WP_000919178.1.27969 WP_000919178.1.27977 WP_000919178.1.27995 WP_000919178.1.27997 WP_000919178.1.28002 WP_000919178.1.28004 WP_000919178.1.28032 WP_000919178.1.28037 WP_000919178.1.28056 WP_000919178.1.28073 WP_000919178.1.2809 WP_000919178.1.28094 WP_000919178.1.28116 WP_000919178.1.28126 WP_000919178.1.28139 WP_000919178.1.28155 WP_000919178.1.28170 WP_000919178.1.28198 WP_000919178.1.28200 WP_000919178.1.2822 WP_000919178.1.28225 WP_000919178.1.28229 WP_000919178.1.28232 WP_000919178.1.28233 WP_000919178.1.28235 WP_000919178.1.2825 WP_000919178.1.28267 WP_000919178.1.2829 WP_000919178.1.28301 WP_000919178.1.28302 WP_000919178.1.28303 WP_000919178.1.2835 WP_000919178.1.28370 WP_000919178.1.28384 WP_000919178.1.28386 WP_000919178.1.28393 WP_000919178.1.28395 WP_000919178.1.284 WP_000919178.1.2845 WP_000919178.1.28462 WP_000919178.1.28479 WP_000919178.1.28504 WP_000919178.1.28514 WP_000919178.1.2853 WP_000919178.1.28538 WP_000919178.1.28570 WP_000919178.1.28575 WP_000919178.1.28612 WP_000919178.1.28620 WP_000919178.1.28625 WP_000919178.1.28627 WP_000919178.1.28655 WP_000919178.1.28673 WP_000919178.1.28692 WP_000919178.1.28694 WP_000919178.1.287 WP_000919178.1.2873 WP_000919178.1.28733 WP_000919178.1.28773 WP_000919178.1.28775 WP_000919178.1.28776 WP_000919178.1.2879 WP_000919178.1.28811 WP_000919178.1.28830 WP_000919178.1.2890 WP_000919178.1.28902 WP_000919178.1.28917 WP_000919178.1.28938 WP_000919178.1.28946 WP_000919178.1.28948 WP_000919178.1.28962 WP_000919178.1.29006 WP_000919178.1.29010 WP_000919178.1.29023 WP_000919178.1.29042 WP_000919178.1.2905 WP_000919178.1.2907 WP_000919178.1.29081 WP_000919178.1.29089 WP_000919178.1.29099 WP_000919178.1.2910 WP_000919178.1.29113 WP_000919178.1.29130 WP_000919178.1.29153 WP_000919178.1.29168 WP_000919178.1.29174 WP_000919178.1.29190 WP_000919178.1.29203 WP_000919178.1.29218 WP_000919178.1.29237 WP_000919178.1.2924 WP_000919178.1.29248 WP_000919178.1.29255 WP_000919178.1.29274 WP_000919178.1.29288 WP_000919178.1.2932 WP_000919178.1.29349 WP_000919178.1.29379 WP_000919178.1.29389 WP_000919178.1.29422 WP_000919178.1.29436 WP_000919178.1.29439 WP_000919178.1.2946 WP_000919178.1.29462 WP_000919178.1.29530 WP_000919178.1.29563 WP_000919178.1.29576 WP_000919178.1.29588 WP_000919178.1.29601 WP_000919178.1.29606 WP_000919178.1.29615 WP_000919178.1.29682 WP_000919178.1.29704 WP_000919178.1.29711 WP_000919178.1.29727 WP_000919178.1.29732 WP_000919178.1.29743 WP_000919178.1.29768 WP_000919178.1.29774 WP_000919178.1.29775 WP_000919178.1.29782 WP_000919178.1.29833 WP_000919178.1.2984 WP_000919178.1.29845 WP_000919178.1.29851 WP_000919178.1.29865 WP_000919178.1.29886 WP_000919178.1.29898 WP_000919178.1.29919 WP_000919178.1.29923 WP_000919178.1.29924 WP_000919178.1.2994 WP_000919178.1.29964 WP_000919178.1.29969 WP_000919178.1.29983 WP_000919178.1.30006 WP_000919178.1.30009 WP_000919178.1.30013 WP_000919178.1.30018 WP_000919178.1.3002 WP_000919178.1.30022 WP_000919178.1.30027 WP_000919178.1.30034 WP_000919178.1.30049 WP_000919178.1.3005 WP_000919178.1.30058 WP_000919178.1.30059 WP_000919178.1.30086 WP_000919178.1.30093 WP_000919178.1.30165 WP_000919178.1.3017 WP_000919178.1.30170 WP_000919178.1.30172 WP_000919178.1.30179 WP_000919178.1.30180 WP_000919178.1.30185 WP_000919178.1.30195 WP_000919178.1.30210 WP_000919178.1.30213 WP_000919178.1.30238 WP_000919178.1.30246 WP_000919178.1.30278 WP_000919178.1.30331 WP_000919178.1.30354 WP_000919178.1.30357 WP_000919178.1.30362 WP_000919178.1.30386 WP_000919178.1.30389 WP_000919178.1.3042 WP_000919178.1.30421 WP_000919178.1.30425 WP_000919178.1.30437 WP_000919178.1.30440 WP_000919178.1.30448 WP_000919178.1.30469 WP_000919178.1.30489 WP_000919178.1.30492 WP_000919178.1.30505 WP_000919178.1.30507 WP_000919178.1.30517 WP_000919178.1.30535 WP_000919178.1.30542 WP_000919178.1.30544 WP_000919178.1.30547 WP_000919178.1.30548 WP_000919178.1.30555 WP_000919178.1.30556 WP_000919178.1.30572 WP_000919178.1.30573 WP_000919178.1.30585 WP_000919178.1.30589 WP_000919178.1.30602 WP_000919178.1.30618 WP_000919178.1.30619 WP_000919178.1.30627 WP_000919178.1.30635 WP_000919178.1.3066 WP_000919178.1.30664 WP_000919178.1.3067 WP_000919178.1.3068 WP_000919178.1.30688 WP_000919178.1.30696 WP_000919178.1.30752 WP_000919178.1.3076 WP_000919178.1.30794 WP_000919178.1.3080 WP_000919178.1.30802 WP_000919178.1.30803 WP_000919178.1.30806 WP_000919178.1.30819 WP_000919178.1.30833 WP_000919178.1.30835 WP_000919178.1.3089 WP_000919178.1.30909 WP_000919178.1.30934 WP_000919178.1.3095 WP_000919178.1.30967 WP_000919178.1.30968 WP_000919178.1.30972 WP_000919178.1.31 WP_000919178.1.31011 WP_000919178.1.31042 WP_000919178.1.31046 WP_000919178.1.31066 WP_000919178.1.31069 WP_000919178.1.31078 WP_000919178.1.31092 WP_000919178.1.31107 WP_000919178.1.31111 WP_000919178.1.31122 WP_000919178.1.3113 WP_000919178.1.31139 WP_000919178.1.3114 WP_000919178.1.31155 WP_000919178.1.31156 WP_000919178.1.31167 WP_000919178.1.31171 WP_000919178.1.31182 WP_000919178.1.31185 WP_000919178.1.3119 WP_000919178.1.31190 WP_000919178.1.31195 WP_000919178.1.31196 WP_000919178.1.31198 WP_000919178.1.31205 WP_000919178.1.3121 WP_000919178.1.31210 WP_000919178.1.31214 WP_000919178.1.31219 WP_000919178.1.31222 WP_000919178.1.31223 WP_000919178.1.3124 WP_000919178.1.31262 WP_000919178.1.3127 WP_000919178.1.31272 WP_000919178.1.31281 WP_000919178.1.31303 WP_000919178.1.3131 WP_000919178.1.31335 WP_000919178.1.31352 WP_000919178.1.31362 WP_000919178.1.31389 WP_000919178.1.31413 WP_000919178.1.31435 WP_000919178.1.31446 WP_000919178.1.31451 WP_000919178.1.31476 WP_000919178.1.31504 WP_000919178.1.31515 WP_000919178.1.31533 WP_000919178.1.31546 WP_000919178.1.31578 WP_000919178.1.31585 WP_000919178.1.31658 WP_000919178.1.31665 WP_000919178.1.3167 WP_000919178.1.3170 WP_000919178.1.31725 WP_000919178.1.31762 WP_000919178.1.31782 WP_000919178.1.31799 WP_000919178.1.31836 WP_000919178.1.31845 WP_000919178.1.31854 WP_000919178.1.31895 WP_000919178.1.31901 WP_000919178.1.31927 WP_000919178.1.31940 WP_000919178.1.31951 WP_000919178.1.31952 WP_000919178.1.31967 WP_000919178.1.31972 WP_000919178.1.31983 WP_000919178.1.32006 WP_000919178.1.32038 WP_000919178.1.32041 WP_000919178.1.32042 WP_000919178.1.32054 WP_000919178.1.32056 WP_000919178.1.3207 WP_000919178.1.32109 WP_000919178.1.32116 WP_000919178.1.32170 WP_000919178.1.32189 WP_000919178.1.32192 WP_000919178.1.32202 WP_000919178.1.32204 WP_000919178.1.32206 WP_000919178.1.32252 WP_000919178.1.32255 WP_000919178.1.32260 WP_000919178.1.32263 WP_000919178.1.32274 WP_000919178.1.32275 WP_000919178.1.32277 WP_000919178.1.32293 WP_000919178.1.32299 WP_000919178.1.32309 WP_000919178.1.32368 WP_000919178.1.32422 WP_000919178.1.32423 WP_000919178.1.32424 WP_000919178.1.32425 WP_000919178.1.32434 WP_000919178.1.32438 WP_000919178.1.32458 WP_000919178.1.32459 WP_000919178.1.32460 WP_000919178.1.32491 WP_000919178.1.32493 WP_000919178.1.32515 WP_000919178.1.32519 WP_000919178.1.32527 WP_000919178.1.32529 WP_000919178.1.32545 WP_000919178.1.32563 WP_000919178.1.32578 WP_000919178.1.32617 WP_000919178.1.32629 WP_000919178.1.32660 WP_000919178.1.32668 WP_000919178.1.3270 WP_000919178.1.32702 WP_000919178.1.32714 WP_000919178.1.32725 WP_000919178.1.32740 WP_000919178.1.32747 WP_000919178.1.32750 WP_000919178.1.3278 WP_000919178.1.32786 WP_000919178.1.32804 WP_000919178.1.32832 WP_000919178.1.32838 WP_000919178.1.32848 WP_000919178.1.32860 WP_000919178.1.32868 WP_000919178.1.32881 WP_000919178.1.32899 WP_000919178.1.329 WP_000919178.1.3290 WP_000919178.1.32900 WP_000919178.1.32902 WP_000919178.1.32907 WP_000919178.1.32930 WP_000919178.1.32940 WP_000919178.1.32941 WP_000919178.1.3296 WP_000919178.1.32961 WP_000919178.1.32966 WP_000919178.1.32977 WP_000919178.1.32985 WP_000919178.1.33010 WP_000919178.1.33030 WP_000919178.1.33037 WP_000919178.1.3305 WP_000919178.1.33051 WP_000919178.1.33065 WP_000919178.1.33078 WP_000919178.1.3310 WP_000919178.1.33106 WP_000919178.1.33114 WP_000919178.1.33122 WP_000919178.1.33127 WP_000919178.1.33143 WP_000919178.1.3315 WP_000919178.1.33160 WP_000919178.1.33208 WP_000919178.1.33214 WP_000919178.1.33247 WP_000919178.1.33248 WP_000919178.1.33253 WP_000919178.1.33261 WP_000919178.1.33270 WP_000919178.1.33280 WP_000919178.1.33283 WP_000919178.1.333 WP_000919178.1.33313 WP_000919178.1.33339 WP_000919178.1.33382 WP_000919178.1.33392 WP_000919178.1.33409 WP_000919178.1.33420 WP_000919178.1.33486 WP_000919178.1.33490 WP_000919178.1.33492 WP_000919178.1.335 WP_000919178.1.33501 WP_000919178.1.33504 WP_000919178.1.33529 WP_000919178.1.33553 WP_000919178.1.3356 WP_000919178.1.33580 WP_000919178.1.33586 WP_000919178.1.33592 WP_000919178.1.33609 WP_000919178.1.33629 WP_000919178.1.3364 WP_000919178.1.33659 WP_000919178.1.33689 WP_000919178.1.33693 WP_000919178.1.3370 WP_000919178.1.33730 WP_000919178.1.33741 WP_000919178.1.33817 WP_000919178.1.33825 WP_000919178.1.33840 WP_000919178.1.33865 WP_000919178.1.33894 WP_000919178.1.3392 WP_000919178.1.33926 WP_000919178.1.3395 WP_000919178.1.33957 WP_000919178.1.3396 WP_000919178.1.33969 WP_000919178.1.33986 WP_000919178.1.34 WP_000919178.1.34001 WP_000919178.1.34043 WP_000919178.1.34059 WP_000919178.1.34075 WP_000919178.1.34081 WP_000919178.1.34084 WP_000919178.1.34091 WP_000919178.1.34107 WP_000919178.1.34118 WP_000919178.1.34126 WP_000919178.1.34184 WP_000919178.1.34185 WP_000919178.1.34211 WP_000919178.1.34214 WP_000919178.1.34234 WP_000919178.1.34257 WP_000919178.1.34279 WP_000919178.1.34284 WP_000919178.1.34292 WP_000919178.1.34304 WP_000919178.1.34319 WP_000919178.1.34330 WP_000919178.1.34376 WP_000919178.1.3438 WP_000919178.1.34382 WP_000919178.1.34417 WP_000919178.1.34424 WP_000919178.1.34431 WP_000919178.1.3445 WP_000919178.1.34453 WP_000919178.1.34454 WP_000919178.1.34458 WP_000919178.1.34484 WP_000919178.1.34496 WP_000919178.1.34517 WP_000919178.1.34530 WP_000919178.1.34610 WP_000919178.1.34614 WP_000919178.1.34647 WP_000919178.1.34659 WP_000919178.1.34665 WP_000919178.1.34667 WP_000919178.1.34684 WP_000919178.1.34694 WP_000919178.1.34703 WP_000919178.1.34704 WP_000919178.1.34707 WP_000919178.1.34711 WP_000919178.1.34745 WP_000919178.1.34751 WP_000919178.1.34801 WP_000919178.1.34808 WP_000919178.1.34817 WP_000919178.1.34820 WP_000919178.1.34824 WP_000919178.1.34834 WP_000919178.1.34854 WP_000919178.1.34856 WP_000919178.1.34881 WP_000919178.1.3489 WP_000919178.1.34932 WP_000919178.1.34962 WP_000919178.1.34972 WP_000919178.1.34975 WP_000919178.1.34977 WP_000919178.1.35001 WP_000919178.1.35035 WP_000919178.1.35040 WP_000919178.1.35045 WP_000919178.1.35074 WP_000919178.1.35075 WP_000919178.1.35125 WP_000919178.1.35129 WP_000919178.1.35175 WP_000919178.1.35184 WP_000919178.1.35219 WP_000919178.1.35240 WP_000919178.1.35274 WP_000919178.1.35294 WP_000919178.1.35298 WP_000919178.1.35321 WP_000919178.1.35331 WP_000919178.1.35332 WP_000919178.1.35404 WP_000919178.1.35408 WP_000919178.1.3541 WP_000919178.1.35425 WP_000919178.1.35429 WP_000919178.1.35446 WP_000919178.1.35460 WP_000919178.1.35494 WP_000919178.1.35503 WP_000919178.1.35509 WP_000919178.1.35532 WP_000919178.1.3556 WP_000919178.1.35560 WP_000919178.1.35563 WP_000919178.1.3557 WP_000919178.1.35570 WP_000919178.1.35590 WP_000919178.1.35594 WP_000919178.1.35619 WP_000919178.1.35624 WP_000919178.1.35628 WP_000919178.1.35648 WP_000919178.1.3566 WP_000919178.1.3570 WP_000919178.1.35712 WP_000919178.1.35713 WP_000919178.1.3572 WP_000919178.1.35736 WP_000919178.1.35777 WP_000919178.1.35791 WP_000919178.1.35795 WP_000919178.1.35835 WP_000919178.1.35868 WP_000919178.1.35870 WP_000919178.1.35887 WP_000919178.1.35892 WP_000919178.1.35916 WP_000919178.1.35936 WP_000919178.1.35938 WP_000919178.1.35940 WP_000919178.1.35961 WP_000919178.1.35966 WP_000919178.1.36000 WP_000919178.1.36003 WP_000919178.1.3601 WP_000919178.1.36011 WP_000919178.1.36017 WP_000919178.1.36034 WP_000919178.1.36036 WP_000919178.1.36037 WP_000919178.1.36057 WP_000919178.1.36063 WP_000919178.1.36069 WP_000919178.1.36157 WP_000919178.1.36172 WP_000919178.1.36229 WP_000919178.1.36232 WP_000919178.1.36286 WP_000919178.1.36291 WP_000919178.1.36298 WP_000919178.1.36308 WP_000919178.1.36323 WP_000919178.1.36343 WP_000919178.1.36409 WP_000919178.1.36445 WP_000919178.1.36460 WP_000919178.1.3649 WP_000919178.1.36495 WP_000919178.1.36512 WP_000919178.1.36526 WP_000919178.1.36542 WP_000919178.1.36564 WP_000919178.1.36567 WP_000919178.1.36579 WP_000919178.1.36584 WP_000919178.1.36586 WP_000919178.1.36592 WP_000919178.1.36609 WP_000919178.1.36617 WP_000919178.1.36618 WP_000919178.1.36643 WP_000919178.1.36652 WP_000919178.1.36663 WP_000919178.1.36685 WP_000919178.1.36690 WP_000919178.1.3670 WP_000919178.1.36701 WP_000919178.1.36705 WP_000919178.1.36721 WP_000919178.1.36725 WP_000919178.1.36751 WP_000919178.1.36764 WP_000919178.1.36765 WP_000919178.1.36779 WP_000919178.1.36792 WP_000919178.1.36798 WP_000919178.1.36802 WP_000919178.1.36821 WP_000919178.1.36839 WP_000919178.1.36853 WP_000919178.1.36875 WP_000919178.1.3688 WP_000919178.1.36885 WP_000919178.1.36889 WP_000919178.1.36899 WP_000919178.1.36918 WP_000919178.1.36931 WP_000919178.1.36948 WP_000919178.1.36949 WP_000919178.1.36950 WP_000919178.1.37013 WP_000919178.1.37014 WP_000919178.1.37021 WP_000919178.1.37029 WP_000919178.1.37063 WP_000919178.1.37073 WP_000919178.1.37111 WP_000919178.1.37112 WP_000919178.1.37114 WP_000919178.1.37133 WP_000919178.1.37147 WP_000919178.1.37158 WP_000919178.1.37176 WP_000919178.1.37190 WP_000919178.1.37191 WP_000919178.1.37199 WP_000919178.1.37200 WP_000919178.1.37256 WP_000919178.1.37258 WP_000919178.1.3726 WP_000919178.1.37267 WP_000919178.1.3728 WP_000919178.1.37293 WP_000919178.1.37297 WP_000919178.1.37303 WP_000919178.1.37320 WP_000919178.1.3734 WP_000919178.1.37351 WP_000919178.1.37363 WP_000919178.1.37370 WP_000919178.1.37376 WP_000919178.1.37405 WP_000919178.1.3744 WP_000919178.1.37478 WP_000919178.1.3748 WP_000919178.1.37498 WP_000919178.1.37504 WP_000919178.1.3751 WP_000919178.1.37513 WP_000919178.1.37521 WP_000919178.1.37558 WP_000919178.1.3756 WP_000919178.1.37584 WP_000919178.1.37590 WP_000919178.1.37593 WP_000919178.1.37600 WP_000919178.1.37610 WP_000919178.1.37613 WP_000919178.1.37618 WP_000919178.1.37659 WP_000919178.1.37662 WP_000919178.1.37666 WP_000919178.1.37675 WP_000919178.1.37687 WP_000919178.1.37691 WP_000919178.1.3771 WP_000919178.1.37719 WP_000919178.1.37761 WP_000919178.1.37775 WP_000919178.1.37777 WP_000919178.1.3778 WP_000919178.1.378 WP_000919178.1.37848 WP_000919178.1.37864 WP_000919178.1.379 WP_000919178.1.3790 WP_000919178.1.37911 WP_000919178.1.37941 WP_000919178.1.37965 WP_000919178.1.37968 WP_000919178.1.37978 WP_000919178.1.37985 WP_000919178.1.38001 WP_000919178.1.38026 WP_000919178.1.38037 WP_000919178.1.38047 WP_000919178.1.38055 WP_000919178.1.38061 WP_000919178.1.38064 WP_000919178.1.38108 WP_000919178.1.38113 WP_000919178.1.38125 WP_000919178.1.38145 WP_000919178.1.3816 WP_000919178.1.38199 WP_000919178.1.38207 WP_000919178.1.38261 WP_000919178.1.38266 WP_000919178.1.38273 WP_000919178.1.3828 WP_000919178.1.383 WP_000919178.1.38310 WP_000919178.1.38322 WP_000919178.1.3834 WP_000919178.1.38341 WP_000919178.1.38344 WP_000919178.1.38349 WP_000919178.1.38351 WP_000919178.1.3838 WP_000919178.1.38381 WP_000919178.1.38393 WP_000919178.1.38408 WP_000919178.1.38440 WP_000919178.1.38452 WP_000919178.1.3848 WP_000919178.1.38486 WP_000919178.1.38512 WP_000919178.1.38515 WP_000919178.1.38569 WP_000919178.1.38595 WP_000919178.1.3860 WP_000919178.1.38609 WP_000919178.1.38613 WP_000919178.1.38620 WP_000919178.1.38622 WP_000919178.1.38642 WP_000919178.1.38673 WP_000919178.1.3869 WP_000919178.1.38693 WP_000919178.1.38734 WP_000919178.1.38740 WP_000919178.1.38773 WP_000919178.1.38797 WP_000919178.1.38830 WP_000919178.1.38857 WP_000919178.1.38877 WP_000919178.1.38881 WP_000919178.1.38882 WP_000919178.1.38895 WP_000919178.1.3891 WP_000919178.1.38913 WP_000919178.1.38942 WP_000919178.1.38983 WP_000919178.1.38995 WP_000919178.1.38996 WP_000919178.1.39003 WP_000919178.1.39038 WP_000919178.1.39048 WP_000919178.1.39055 WP_000919178.1.39056 WP_000919178.1.39065 WP_000919178.1.3907 WP_000919178.1.39075 WP_000919178.1.39105 WP_000919178.1.39112 WP_000919178.1.39113 WP_000919178.1.39128 WP_000919178.1.39136 WP_000919178.1.3914 WP_000919178.1.39140 WP_000919178.1.39146 WP_000919178.1.39147 WP_000919178.1.39161 WP_000919178.1.39183 WP_000919178.1.39197 WP_000919178.1.39210 WP_000919178.1.39229 WP_000919178.1.39235 WP_000919178.1.39275 WP_000919178.1.3931 WP_000919178.1.39312 WP_000919178.1.39385 WP_000919178.1.39395 WP_000919178.1.39405 WP_000919178.1.39414 WP_000919178.1.39420 WP_000919178.1.39435 WP_000919178.1.39449 WP_000919178.1.39466 WP_000919178.1.39471 WP_000919178.1.39502 WP_000919178.1.39503 WP_000919178.1.39512 WP_000919178.1.39530 WP_000919178.1.39553 WP_000919178.1.39556 WP_000919178.1.39584 WP_000919178.1.39609 WP_000919178.1.39614 WP_000919178.1.39619 WP_000919178.1.39620 WP_000919178.1.39624 WP_000919178.1.39629 WP_000919178.1.39632 WP_000919178.1.39659 WP_000919178.1.39667 WP_000919178.1.39722 WP_000919178.1.39723 WP_000919178.1.39724 WP_000919178.1.39763 WP_000919178.1.39775 WP_000919178.1.39808 WP_000919178.1.39862 WP_000919178.1.39879 WP_000919178.1.39890 WP_000919178.1.39923 WP_000919178.1.39941 WP_000919178.1.39945 WP_000919178.1.39947 WP_000919178.1.39953 WP_000919178.1.40008 WP_000919178.1.40017 WP_000919178.1.40025 WP_000919178.1.40031 WP_000919178.1.40072 WP_000919178.1.40073 WP_000919178.1.40081 WP_000919178.1.40095 WP_000919178.1.40097 WP_000919178.1.401 WP_000919178.1.4011 WP_000919178.1.40111 WP_000919178.1.40155 WP_000919178.1.40158 WP_000919178.1.40160 WP_000919178.1.40167 WP_000919178.1.40170 WP_000919178.1.40171 WP_000919178.1.40205 WP_000919178.1.40208 WP_000919178.1.40224 WP_000919178.1.40229 WP_000919178.1.40240 WP_000919178.1.40254 WP_000919178.1.40257 WP_000919178.1.40258 WP_000919178.1.40259 WP_000919178.1.40279 WP_000919178.1.40284 WP_000919178.1.40292 WP_000919178.1.40305 WP_000919178.1.40307 WP_000919178.1.40311 WP_000919178.1.40361 WP_000919178.1.40374 WP_000919178.1.40380 WP_000919178.1.4042 WP_000919178.1.40465 WP_000919178.1.40467 WP_000919178.1.40492 WP_000919178.1.40493 WP_000919178.1.40496 WP_000919178.1.40508 WP_000919178.1.40517 WP_000919178.1.40528 WP_000919178.1.40533 WP_000919178.1.40577 WP_000919178.1.40583 WP_000919178.1.40605 WP_000919178.1.40622 WP_000919178.1.40688 WP_000919178.1.40695 WP_000919178.1.40698 WP_000919178.1.40710 WP_000919178.1.40722 WP_000919178.1.40745 WP_000919178.1.4075 WP_000919178.1.40750 WP_000919178.1.40763 WP_000919178.1.40771 WP_000919178.1.40788 WP_000919178.1.40849 WP_000919178.1.40854 WP_000919178.1.4087 WP_000919178.1.40877 WP_000919178.1.4088 WP_000919178.1.4089 WP_000919178.1.40910 WP_000919178.1.40924 WP_000919178.1.40930 WP_000919178.1.40932 WP_000919178.1.40935 WP_000919178.1.40946 WP_000919178.1.40973 WP_000919178.1.40979 WP_000919178.1.41004 WP_000919178.1.41017 WP_000919178.1.41018 WP_000919178.1.41048 WP_000919178.1.41050 WP_000919178.1.4106 WP_000919178.1.41070 WP_000919178.1.41074 WP_000919178.1.41075 WP_000919178.1.41086 WP_000919178.1.4109 WP_000919178.1.41091 WP_000919178.1.41097 WP_000919178.1.41116 WP_000919178.1.41128 WP_000919178.1.41132 WP_000919178.1.41176 WP_000919178.1.41192 WP_000919178.1.41225 WP_000919178.1.41226 WP_000919178.1.41251 WP_000919178.1.41258 WP_000919178.1.41265 WP_000919178.1.41277 WP_000919178.1.41279 WP_000919178.1.41299 WP_000919178.1.41305 WP_000919178.1.41308 WP_000919178.1.41310 WP_000919178.1.41321 WP_000919178.1.41333 WP_000919178.1.41335 WP_000919178.1.41345 WP_000919178.1.4136 WP_000919178.1.41375 WP_000919178.1.4141 WP_000919178.1.41415 WP_000919178.1.41427 WP_000919178.1.41434 WP_000919178.1.41438 WP_000919178.1.41440 WP_000919178.1.41459 WP_000919178.1.41468 WP_000919178.1.41498 WP_000919178.1.41516 WP_000919178.1.41519 WP_000919178.1.41524 WP_000919178.1.41528 WP_000919178.1.41554 WP_000919178.1.41572 WP_000919178.1.41591 WP_000919178.1.41593 WP_000919178.1.41610 WP_000919178.1.41628 WP_000919178.1.41631 WP_000919178.1.41658 WP_000919178.1.41659 WP_000919178.1.41662 WP_000919178.1.41688 WP_000919178.1.41690 WP_000919178.1.41708 WP_000919178.1.41716 WP_000919178.1.41724 WP_000919178.1.41735 WP_000919178.1.41746 WP_000919178.1.41761 WP_000919178.1.4178 WP_000919178.1.41799 WP_000919178.1.41802 WP_000919178.1.41824 WP_000919178.1.41825 WP_000919178.1.41836 WP_000919178.1.4184 WP_000919178.1.41859 WP_000919178.1.41862 WP_000919178.1.41877 WP_000919178.1.41882 WP_000919178.1.41894 WP_000919178.1.41897 WP_000919178.1.41904 WP_000919178.1.41911 WP_000919178.1.41919 WP_000919178.1.41929 WP_000919178.1.41931 WP_000919178.1.41938 WP_000919178.1.4194 WP_000919178.1.41949 WP_000919178.1.41978 WP_000919178.1.41985 WP_000919178.1.41994 WP_000919178.1.41998 WP_000919178.1.42009 WP_000919178.1.42069 WP_000919178.1.42081 WP_000919178.1.42090 WP_000919178.1.42098 WP_000919178.1.42104 WP_000919178.1.42109 WP_000919178.1.42111 WP_000919178.1.42136 WP_000919178.1.42156 WP_000919178.1.42187 WP_000919178.1.422 WP_000919178.1.42200 WP_000919178.1.42219 WP_000919178.1.4222 WP_000919178.1.42238 WP_000919178.1.42244 WP_000919178.1.42257 WP_000919178.1.42261 WP_000919178.1.42262 WP_000919178.1.42263 WP_000919178.1.42276 WP_000919178.1.4229 WP_000919178.1.42320 WP_000919178.1.42322 WP_000919178.1.42328 WP_000919178.1.42342 WP_000919178.1.42349 WP_000919178.1.42364 WP_000919178.1.42371 WP_000919178.1.42372 WP_000919178.1.42379 WP_000919178.1.4239 WP_000919178.1.42391 WP_000919178.1.42392 WP_000919178.1.42399 WP_000919178.1.42404 WP_000919178.1.42422 WP_000919178.1.42433 WP_000919178.1.42444 WP_000919178.1.42453 WP_000919178.1.42489 WP_000919178.1.42491 WP_000919178.1.42539 WP_000919178.1.4257 WP_000919178.1.42595 WP_000919178.1.42603 WP_000919178.1.42650 WP_000919178.1.42655 WP_000919178.1.42666 WP_000919178.1.4267 WP_000919178.1.42675 WP_000919178.1.42683 WP_000919178.1.42685 WP_000919178.1.42701 WP_000919178.1.42707 WP_000919178.1.42734 WP_000919178.1.4276 WP_000919178.1.42767 WP_000919178.1.42794 WP_000919178.1.42797 WP_000919178.1.42805 WP_000919178.1.42815 WP_000919178.1.42829 WP_000919178.1.42859 WP_000919178.1.42861 WP_000919178.1.42864 WP_000919178.1.4288 WP_000919178.1.42887 WP_000919178.1.4289 WP_000919178.1.42892 WP_000919178.1.42932 WP_000919178.1.42957 WP_000919178.1.42978 WP_000919178.1.4298 WP_000919178.1.42981 WP_000919178.1.43008 WP_000919178.1.43016 WP_000919178.1.43018 WP_000919178.1.43019 WP_000919178.1.43041 WP_000919178.1.43065 WP_000919178.1.43068 WP_000919178.1.43069 WP_000919178.1.43070 WP_000919178.1.43077 WP_000919178.1.43086 WP_000919178.1.43089 WP_000919178.1.43126 WP_000919178.1.43128 WP_000919178.1.43141 WP_000919178.1.43149 WP_000919178.1.43157 WP_000919178.1.43160 WP_000919178.1.43161 WP_000919178.1.43190 WP_000919178.1.43198 WP_000919178.1.43201 WP_000919178.1.43244 WP_000919178.1.4326 WP_000919178.1.43272 WP_000919178.1.43276 WP_000919178.1.43290 WP_000919178.1.43292 WP_000919178.1.43299 WP_000919178.1.43307 WP_000919178.1.43312 WP_000919178.1.4332 WP_000919178.1.43334 WP_000919178.1.43339 WP_000919178.1.43351 WP_000919178.1.43437 WP_000919178.1.43438 WP_000919178.1.4344 WP_000919178.1.43441 WP_000919178.1.43476 WP_000919178.1.43508 WP_000919178.1.43513 WP_000919178.1.43520 WP_000919178.1.43522 WP_000919178.1.43528 WP_000919178.1.43535 WP_000919178.1.43606 WP_000919178.1.43613 WP_000919178.1.43633 WP_000919178.1.43637 WP_000919178.1.43651 WP_000919178.1.43668 WP_000919178.1.43676 WP_000919178.1.43685 WP_000919178.1.43710 WP_000919178.1.43711 WP_000919178.1.43722 WP_000919178.1.4373 WP_000919178.1.43778 WP_000919178.1.43782 WP_000919178.1.43785 WP_000919178.1.43801 WP_000919178.1.43812 WP_000919178.1.43828 WP_000919178.1.43839 WP_000919178.1.43864 WP_000919178.1.43873 WP_000919178.1.43875 WP_000919178.1.43878 WP_000919178.1.43886 WP_000919178.1.43888 WP_000919178.1.43919 WP_000919178.1.43951 WP_000919178.1.43954 WP_000919178.1.43974 WP_000919178.1.44005 WP_000919178.1.44010 WP_000919178.1.4404 WP_000919178.1.44043 WP_000919178.1.44049 WP_000919178.1.4405 WP_000919178.1.44063 WP_000919178.1.44099 WP_000919178.1.44101 WP_000919178.1.44113 WP_000919178.1.44121 WP_000919178.1.44132 WP_000919178.1.44144 WP_000919178.1.44160 WP_000919178.1.44180 WP_000919178.1.44187 WP_000919178.1.44196 WP_000919178.1.4422 WP_000919178.1.4423 WP_000919178.1.44248 WP_000919178.1.44250 WP_000919178.1.44262 WP_000919178.1.44268 WP_000919178.1.4427 WP_000919178.1.44291 WP_000919178.1.44296 WP_000919178.1.44300 WP_000919178.1.44310 WP_000919178.1.44337 WP_000919178.1.44343 WP_000919178.1.44351 WP_000919178.1.44359 WP_000919178.1.44360 WP_000919178.1.44397 WP_000919178.1.4440 WP_000919178.1.44416 WP_000919178.1.44431 WP_000919178.1.44437 WP_000919178.1.44438 WP_000919178.1.44440 WP_000919178.1.44453 WP_000919178.1.44474 WP_000919178.1.44479 WP_000919178.1.44546 WP_000919178.1.44549 WP_000919178.1.44578 WP_000919178.1.44593 WP_000919178.1.44606 WP_000919178.1.44607 WP_000919178.1.44636 WP_000919178.1.44640 WP_000919178.1.4467 WP_000919178.1.4468 WP_000919178.1.44687 WP_000919178.1.44702 WP_000919178.1.44705 WP_000919178.1.44747 WP_000919178.1.44762 WP_000919178.1.44791 WP_000919178.1.44795 WP_000919178.1.44815 WP_000919178.1.44828 WP_000919178.1.44831 WP_000919178.1.4485 WP_000919178.1.44877 WP_000919178.1.44879 WP_000919178.1.44887 WP_000919178.1.449 WP_000919178.1.44917 WP_000919178.1.44927 WP_000919178.1.44943 WP_000919178.1.44966 WP_000919178.1.44971 WP_000919178.1.44978 WP_000919178.1.44996 WP_000919178.1.44997 WP_000919178.1.44998 WP_000919178.1.4500 WP_000919178.1.4501 WP_000919178.1.45027 WP_000919178.1.45038 WP_000919178.1.45045 WP_000919178.1.4505 WP_000919178.1.45067 WP_000919178.1.45072 WP_000919178.1.45074 WP_000919178.1.45079 WP_000919178.1.45093 WP_000919178.1.45098 WP_000919178.1.45123 WP_000919178.1.45134 WP_000919178.1.45136 WP_000919178.1.45138 WP_000919178.1.45145 WP_000919178.1.45173 WP_000919178.1.45177 WP_000919178.1.45184 WP_000919178.1.45229 WP_000919178.1.45241 WP_000919178.1.45259 WP_000919178.1.45302 WP_000919178.1.4531 WP_000919178.1.45322 WP_000919178.1.45344 WP_000919178.1.45349 WP_000919178.1.45351 WP_000919178.1.45365 WP_000919178.1.4540 WP_000919178.1.45432 WP_000919178.1.45434 WP_000919178.1.45435 WP_000919178.1.45462 WP_000919178.1.45468 WP_000919178.1.45522 WP_000919178.1.45523 WP_000919178.1.45535 WP_000919178.1.45544 WP_000919178.1.45549 WP_000919178.1.45550 WP_000919178.1.45569 WP_000919178.1.45571 WP_000919178.1.45582 WP_000919178.1.45583 WP_000919178.1.45585 WP_000919178.1.45596 WP_000919178.1.45622 WP_000919178.1.45648 WP_000919178.1.45660 WP_000919178.1.45690 WP_000919178.1.45706 WP_000919178.1.45781 WP_000919178.1.45797 WP_000919178.1.458 WP_000919178.1.45829 WP_000919178.1.45844 WP_000919178.1.45848 WP_000919178.1.45871 WP_000919178.1.45906 WP_000919178.1.45918 WP_000919178.1.4592 WP_000919178.1.46011 WP_000919178.1.46028 WP_000919178.1.46030 WP_000919178.1.46069 WP_000919178.1.46077 WP_000919178.1.46091 WP_000919178.1.46112 WP_000919178.1.46124 WP_000919178.1.46169 WP_000919178.1.46173 WP_000919178.1.46174 WP_000919178.1.46187 WP_000919178.1.46203 WP_000919178.1.46205 WP_000919178.1.46215 WP_000919178.1.46225 WP_000919178.1.46232 WP_000919178.1.46241 WP_000919178.1.46243 WP_000919178.1.46250 WP_000919178.1.46278 WP_000919178.1.46286 WP_000919178.1.46299 WP_000919178.1.46303 WP_000919178.1.46307 WP_000919178.1.46322 WP_000919178.1.46323 WP_000919178.1.46345 WP_000919178.1.46355 WP_000919178.1.46358 WP_000919178.1.464 WP_000919178.1.46434 WP_000919178.1.46454 WP_000919178.1.46461 WP_000919178.1.46504 WP_000919178.1.46505 WP_000919178.1.46551 WP_000919178.1.46559 WP_000919178.1.46572 WP_000919178.1.46574 WP_000919178.1.46578 WP_000919178.1.46595 WP_000919178.1.46620 WP_000919178.1.46637 WP_000919178.1.46666 WP_000919178.1.46675 WP_000919178.1.46689 WP_000919178.1.46693 WP_000919178.1.46701 WP_000919178.1.46726 WP_000919178.1.46730 WP_000919178.1.46732 WP_000919178.1.4674 WP_000919178.1.46781 WP_000919178.1.46803 WP_000919178.1.46804 WP_000919178.1.46816 WP_000919178.1.46842 WP_000919178.1.4686 WP_000919178.1.4690 WP_000919178.1.46920 WP_000919178.1.46930 WP_000919178.1.46945 WP_000919178.1.46961 WP_000919178.1.46967 WP_000919178.1.46976 WP_000919178.1.47005 WP_000919178.1.47014 WP_000919178.1.47023 WP_000919178.1.47036 WP_000919178.1.47037 WP_000919178.1.47042 WP_000919178.1.47057 WP_000919178.1.47058 WP_000919178.1.47059 WP_000919178.1.47061 WP_000919178.1.47085 WP_000919178.1.47110 WP_000919178.1.47123 WP_000919178.1.47214 WP_000919178.1.47215 WP_000919178.1.47243 WP_000919178.1.47245 WP_000919178.1.47257 WP_000919178.1.47389 WP_000919178.1.47429 WP_000919178.1.47442 WP_000919178.1.47448 WP_000919178.1.47460 WP_000919178.1.4747 WP_000919178.1.47472 WP_000919178.1.47478 WP_000919178.1.47482 WP_000919178.1.47492 WP_000919178.1.47506 WP_000919178.1.47507 WP_000919178.1.47523 WP_000919178.1.47531 WP_000919178.1.47532 WP_000919178.1.47567 WP_000919178.1.47576 WP_000919178.1.47579 WP_000919178.1.4758 WP_000919178.1.47587 WP_000919178.1.47605 WP_000919178.1.47614 WP_000919178.1.47621 WP_000919178.1.47630 WP_000919178.1.47649 WP_000919178.1.47660 WP_000919178.1.4769 WP_000919178.1.4770 WP_000919178.1.47714 WP_000919178.1.4774 WP_000919178.1.4775 WP_000919178.1.47756 WP_000919178.1.47767 WP_000919178.1.47799 WP_000919178.1.4781 WP_000919178.1.47814 WP_000919178.1.47817 WP_000919178.1.47829 WP_000919178.1.47849 WP_000919178.1.47850 WP_000919178.1.47875 WP_000919178.1.47886 WP_000919178.1.47898 WP_000919178.1.47902 WP_000919178.1.47911 WP_000919178.1.47928 WP_000919178.1.4795 WP_000919178.1.47988 WP_000919178.1.47992 WP_000919178.1.48019 WP_000919178.1.48100 WP_000919178.1.48114 WP_000919178.1.48124 WP_000919178.1.48132 WP_000919178.1.48134 WP_000919178.1.48139 WP_000919178.1.48190 WP_000919178.1.48209 WP_000919178.1.48215 WP_000919178.1.48218 WP_000919178.1.48242 WP_000919178.1.48244 WP_000919178.1.48247 WP_000919178.1.48253 WP_000919178.1.48268 WP_000919178.1.48292 WP_000919178.1.483 WP_000919178.1.48324 WP_000919178.1.48367 WP_000919178.1.48377 WP_000919178.1.4839 WP_000919178.1.48399 WP_000919178.1.48426 WP_000919178.1.48430 WP_000919178.1.48436 WP_000919178.1.48455 WP_000919178.1.48493 WP_000919178.1.48510 WP_000919178.1.48524 WP_000919178.1.4853 WP_000919178.1.48570 WP_000919178.1.48586 WP_000919178.1.4859 WP_000919178.1.48591 WP_000919178.1.48610 WP_000919178.1.48631 WP_000919178.1.48651 WP_000919178.1.48663 WP_000919178.1.48690 WP_000919178.1.48734 WP_000919178.1.48751 WP_000919178.1.48755 WP_000919178.1.48756 WP_000919178.1.48768 WP_000919178.1.48774 WP_000919178.1.48778 WP_000919178.1.48788 WP_000919178.1.48797 WP_000919178.1.48841 WP_000919178.1.48849 WP_000919178.1.4885 WP_000919178.1.48855 WP_000919178.1.48876 WP_000919178.1.48886 WP_000919178.1.48894 WP_000919178.1.48896 WP_000919178.1.48908 WP_000919178.1.48918 WP_000919178.1.48919 WP_000919178.1.48931 WP_000919178.1.48955 WP_000919178.1.48963 WP_000919178.1.48973 WP_000919178.1.48985 WP_000919178.1.49004 WP_000919178.1.49005 WP_000919178.1.49012 WP_000919178.1.49084 WP_000919178.1.49102 WP_000919178.1.49106 WP_000919178.1.49117 WP_000919178.1.49121 WP_000919178.1.4914 WP_000919178.1.49140 WP_000919178.1.49153 WP_000919178.1.49155 WP_000919178.1.49162 WP_000919178.1.49166 WP_000919178.1.49175 WP_000919178.1.49204 WP_000919178.1.49214 WP_000919178.1.49226 WP_000919178.1.49233 WP_000919178.1.49239 WP_000919178.1.49256 WP_000919178.1.49262 WP_000919178.1.49276 WP_000919178.1.49290 WP_000919178.1.49304 WP_000919178.1.49309 WP_000919178.1.49311 WP_000919178.1.49334 WP_000919178.1.49340 WP_000919178.1.49355 WP_000919178.1.49358 WP_000919178.1.49366 WP_000919178.1.49375 WP_000919178.1.49429 WP_000919178.1.49430 WP_000919178.1.49434 WP_000919178.1.49443 WP_000919178.1.49450 WP_000919178.1.49472 WP_000919178.1.49490 WP_000919178.1.49494 WP_000919178.1.495 WP_000919178.1.49515 WP_000919178.1.49545 WP_000919178.1.49550 WP_000919178.1.49572 WP_000919178.1.49574 WP_000919178.1.49590 WP_000919178.1.49595 WP_000919178.1.49602 WP_000919178.1.49626 WP_000919178.1.49630 WP_000919178.1.49647 WP_000919178.1.49650 WP_000919178.1.49686 WP_000919178.1.49703 WP_000919178.1.49769 WP_000919178.1.49770 WP_000919178.1.49778 WP_000919178.1.49780 WP_000919178.1.4979 WP_000919178.1.49790 WP_000919178.1.49803 WP_000919178.1.49805 WP_000919178.1.49827 WP_000919178.1.49846 WP_000919178.1.49848 WP_000919178.1.4991 WP_000919178.1.49929 WP_000919178.1.49931 WP_000919178.1.49947 WP_000919178.1.49959 WP_000919178.1.49997 WP_000919178.1.50 WP_000919178.1.50007 WP_000919178.1.50014 WP_000919178.1.50030 WP_000919178.1.50043 WP_000919178.1.50080 WP_000919178.1.5009 WP_000919178.1.50103 WP_000919178.1.50128 WP_000919178.1.50153 WP_000919178.1.50158 WP_000919178.1.50161 WP_000919178.1.50198 WP_000919178.1.50211 WP_000919178.1.50238 WP_000919178.1.50247 WP_000919178.1.50251 WP_000919178.1.50285 WP_000919178.1.50308 WP_000919178.1.50309 WP_000919178.1.50332 WP_000919178.1.50349 WP_000919178.1.50376 WP_000919178.1.50387 WP_000919178.1.50389 WP_000919178.1.50404 WP_000919178.1.50406 WP_000919178.1.50413 WP_000919178.1.50449 WP_000919178.1.50468 WP_000919178.1.50469 WP_000919178.1.50478 WP_000919178.1.50480 WP_000919178.1.50497 WP_000919178.1.5051 WP_000919178.1.50517 WP_000919178.1.50529 WP_000919178.1.50563 WP_000919178.1.50565 WP_000919178.1.50566 WP_000919178.1.50570 WP_000919178.1.50576 WP_000919178.1.5058 WP_000919178.1.50593 WP_000919178.1.50626 WP_000919178.1.50652 WP_000919178.1.50676 WP_000919178.1.50684 WP_000919178.1.50726 WP_000919178.1.50750 WP_000919178.1.50769 WP_000919178.1.50771 WP_000919178.1.50774 WP_000919178.1.50777 WP_000919178.1.50782 WP_000919178.1.50800 WP_000919178.1.50804 WP_000919178.1.50808 WP_000919178.1.50811 WP_000919178.1.50875 WP_000919178.1.5088 WP_000919178.1.50882 WP_000919178.1.50885 WP_000919178.1.50893 WP_000919178.1.509 WP_000919178.1.50905 WP_000919178.1.50908 WP_000919178.1.50918 WP_000919178.1.50929 WP_000919178.1.50941 WP_000919178.1.50954 WP_000919178.1.50960 WP_000919178.1.50970 WP_000919178.1.51014 WP_000919178.1.51022 WP_000919178.1.51025 WP_000919178.1.51036 WP_000919178.1.51040 WP_000919178.1.51048 WP_000919178.1.51100 WP_000919178.1.51117 WP_000919178.1.51131 WP_000919178.1.51134 WP_000919178.1.51139 WP_000919178.1.5114 WP_000919178.1.51162 WP_000919178.1.51179 WP_000919178.1.51182 WP_000919178.1.51186 WP_000919178.1.51227 WP_000919178.1.5125 WP_000919178.1.5127 WP_000919178.1.51305 WP_000919178.1.51315 WP_000919178.1.51331 WP_000919178.1.51338 WP_000919178.1.51356 WP_000919178.1.5136 WP_000919178.1.5138 WP_000919178.1.51394 WP_000919178.1.51412 WP_000919178.1.51414 WP_000919178.1.51419 WP_000919178.1.51451 WP_000919178.1.51474 WP_000919178.1.51487 WP_000919178.1.51488 WP_000919178.1.51502 WP_000919178.1.51506 WP_000919178.1.51518 WP_000919178.1.51519 WP_000919178.1.51555 WP_000919178.1.51594 WP_000919178.1.51598 WP_000919178.1.51611 WP_000919178.1.51613 WP_000919178.1.51615 WP_000919178.1.51634 WP_000919178.1.51642 WP_000919178.1.51644 WP_000919178.1.51649 WP_000919178.1.51686 WP_000919178.1.51704 WP_000919178.1.51724 WP_000919178.1.51734 WP_000919178.1.51764 WP_000919178.1.51810 WP_000919178.1.51838 WP_000919178.1.51841 WP_000919178.1.5185 WP_000919178.1.51863 WP_000919178.1.51868 WP_000919178.1.51888 WP_000919178.1.51910 WP_000919178.1.51911 WP_000919178.1.51914 WP_000919178.1.51930 WP_000919178.1.51932 WP_000919178.1.51935 WP_000919178.1.51989 WP_000919178.1.51994 WP_000919178.1.520 WP_000919178.1.52047 WP_000919178.1.52057 WP_000919178.1.52101 WP_000919178.1.5211 WP_000919178.1.52114 WP_000919178.1.52121 WP_000919178.1.52123 WP_000919178.1.52129 WP_000919178.1.52148 WP_000919178.1.52156 WP_000919178.1.5216 WP_000919178.1.52161 WP_000919178.1.52191 WP_000919178.1.52202 WP_000919178.1.52209 WP_000919178.1.52255 WP_000919178.1.52301 WP_000919178.1.52321 WP_000919178.1.52339 WP_000919178.1.52353 WP_000919178.1.52356 WP_000919178.1.52361 WP_000919178.1.52438 WP_000919178.1.52446 WP_000919178.1.52469 WP_000919178.1.52527 WP_000919178.1.52571 WP_000919178.1.52582 WP_000919178.1.52586 WP_000919178.1.526 WP_000919178.1.52608 WP_000919178.1.52637 WP_000919178.1.52647 WP_000919178.1.52653 WP_000919178.1.52656 WP_000919178.1.52675 WP_000919178.1.52692 WP_000919178.1.52738 WP_000919178.1.52742 WP_000919178.1.52743 WP_000919178.1.52744 WP_000919178.1.52748 WP_000919178.1.52773 WP_000919178.1.52795 WP_000919178.1.52807 WP_000919178.1.52824 WP_000919178.1.52833 WP_000919178.1.52851 WP_000919178.1.52857 WP_000919178.1.52858 WP_000919178.1.52887 WP_000919178.1.52898 WP_000919178.1.52915 WP_000919178.1.52924 WP_000919178.1.52949 WP_000919178.1.52985 WP_000919178.1.5301 WP_000919178.1.53016 WP_000919178.1.53092 WP_000919178.1.53100 WP_000919178.1.53107 WP_000919178.1.53119 WP_000919178.1.5313 WP_000919178.1.53141 WP_000919178.1.53151 WP_000919178.1.53154 WP_000919178.1.53158 WP_000919178.1.53159 WP_000919178.1.5316 WP_000919178.1.53179 WP_000919178.1.53190 WP_000919178.1.53198 WP_000919178.1.53203 WP_000919178.1.53206 WP_000919178.1.53210 WP_000919178.1.53233 WP_000919178.1.53234 WP_000919178.1.53272 WP_000919178.1.53274 WP_000919178.1.53286 WP_000919178.1.53307 WP_000919178.1.53315 WP_000919178.1.53316 WP_000919178.1.53321 WP_000919178.1.5333 WP_000919178.1.53362 WP_000919178.1.53368 WP_000919178.1.53375 WP_000919178.1.53385 WP_000919178.1.53406 WP_000919178.1.53436 WP_000919178.1.53450 WP_000919178.1.53454 WP_000919178.1.53466 WP_000919178.1.5349 WP_000919178.1.53529 WP_000919178.1.53540 WP_000919178.1.53543 WP_000919178.1.53555 WP_000919178.1.53559 WP_000919178.1.5356 WP_000919178.1.53567 WP_000919178.1.53571 WP_000919178.1.5358 WP_000919178.1.53664 WP_000919178.1.53675 WP_000919178.1.53688 WP_000919178.1.53692 WP_000919178.1.53694 WP_000919178.1.53696 WP_000919178.1.53723 WP_000919178.1.5374 WP_000919178.1.53750 WP_000919178.1.53757 WP_000919178.1.53772 WP_000919178.1.53778 WP_000919178.1.53781 WP_000919178.1.53790 WP_000919178.1.53800 WP_000919178.1.53812 WP_000919178.1.53814 WP_000919178.1.53815 WP_000919178.1.53839 WP_000919178.1.53892 WP_000919178.1.53896 WP_000919178.1.53898 WP_000919178.1.53902 WP_000919178.1.53905 WP_000919178.1.5392 WP_000919178.1.53935 WP_000919178.1.53958 WP_000919178.1.53961 WP_000919178.1.53981 WP_000919178.1.53984 WP_000919178.1.54033 WP_000919178.1.54061 WP_000919178.1.54068 WP_000919178.1.54075 WP_000919178.1.54082 WP_000919178.1.54085 WP_000919178.1.54132 WP_000919178.1.54136 WP_000919178.1.5415 WP_000919178.1.54159 WP_000919178.1.54170 WP_000919178.1.54175 WP_000919178.1.54196 WP_000919178.1.542 WP_000919178.1.54203 WP_000919178.1.54209 WP_000919178.1.54259 WP_000919178.1.54271 WP_000919178.1.54273 WP_000919178.1.54274 WP_000919178.1.54283 WP_000919178.1.5430 WP_000919178.1.54319 WP_000919178.1.54324 WP_000919178.1.54333 WP_000919178.1.54340 WP_000919178.1.54364 WP_000919178.1.54366 WP_000919178.1.54371 WP_000919178.1.54400 WP_000919178.1.54431 WP_000919178.1.54442 WP_000919178.1.54469 WP_000919178.1.54482 WP_000919178.1.54500 WP_000919178.1.54522 WP_000919178.1.54558 WP_000919178.1.5456 WP_000919178.1.54569 WP_000919178.1.54589 WP_000919178.1.5459 WP_000919178.1.54607 WP_000919178.1.54615 WP_000919178.1.5462 WP_000919178.1.54644 WP_000919178.1.54662 WP_000919178.1.54667 WP_000919178.1.54678 WP_000919178.1.54681 WP_000919178.1.54694 WP_000919178.1.54722 WP_000919178.1.54748 WP_000919178.1.54749 WP_000919178.1.54764 WP_000919178.1.54774 WP_000919178.1.5481 WP_000919178.1.54814 WP_000919178.1.54822 WP_000919178.1.54833 WP_000919178.1.54845 WP_000919178.1.5485 WP_000919178.1.54865 WP_000919178.1.54877 WP_000919178.1.5493 WP_000919178.1.54935 WP_000919178.1.54936 WP_000919178.1.54979 WP_000919178.1.54984 WP_000919178.1.54992 WP_000919178.1.55008 WP_000919178.1.55010 WP_000919178.1.55034 WP_000919178.1.55073 WP_000919178.1.55152 WP_000919178.1.55156 WP_000919178.1.55163 WP_000919178.1.55165 WP_000919178.1.55166 WP_000919178.1.5517 WP_000919178.1.55178 WP_000919178.1.55200 WP_000919178.1.55215 WP_000919178.1.55223 WP_000919178.1.55224 WP_000919178.1.5523 WP_000919178.1.5525 WP_000919178.1.5527 WP_000919178.1.55285 WP_000919178.1.55290 WP_000919178.1.55294 WP_000919178.1.55310 WP_000919178.1.55317 WP_000919178.1.55361 WP_000919178.1.55379 WP_000919178.1.5539 WP_000919178.1.55418 WP_000919178.1.55430 WP_000919178.1.55461 WP_000919178.1.55468 WP_000919178.1.55475 WP_000919178.1.55477 WP_000919178.1.55496 WP_000919178.1.55506 WP_000919178.1.5552 WP_000919178.1.55528 WP_000919178.1.55554 WP_000919178.1.55557 WP_000919178.1.55559 WP_000919178.1.55604 WP_000919178.1.55614 WP_000919178.1.55623 WP_000919178.1.55639 WP_000919178.1.55640 WP_000919178.1.55647 WP_000919178.1.55672 WP_000919178.1.55680 WP_000919178.1.55699 WP_000919178.1.55706 WP_000919178.1.55718 WP_000919178.1.5572 WP_000919178.1.55725 WP_000919178.1.55743 WP_000919178.1.55768 WP_000919178.1.5577 WP_000919178.1.55780 WP_000919178.1.55782 WP_000919178.1.55796 WP_000919178.1.55803 WP_000919178.1.55853 WP_000919178.1.55923 WP_000919178.1.55948 WP_000919178.1.55967 WP_000919178.1.55993 WP_000919178.1.55995 WP_000919178.1.56002 WP_000919178.1.56004 WP_000919178.1.56012 WP_000919178.1.56026 WP_000919178.1.56059 WP_000919178.1.56070 WP_000919178.1.56082 WP_000919178.1.56097 WP_000919178.1.56100 WP_000919178.1.56105 WP_000919178.1.56130 WP_000919178.1.56144 WP_000919178.1.56152 WP_000919178.1.56172 WP_000919178.1.5621 WP_000919178.1.56222 WP_000919178.1.56226 WP_000919178.1.56235 WP_000919178.1.56238 WP_000919178.1.56247 WP_000919178.1.56261 WP_000919178.1.56263 WP_000919178.1.56286 WP_000919178.1.56303 WP_000919178.1.56304 WP_000919178.1.56305 WP_000919178.1.56311 WP_000919178.1.5633 WP_000919178.1.56368 WP_000919178.1.56370 WP_000919178.1.56374 WP_000919178.1.56385 WP_000919178.1.56389 WP_000919178.1.56393 WP_000919178.1.56396 WP_000919178.1.56414 WP_000919178.1.56419 WP_000919178.1.56420 WP_000919178.1.56423 WP_000919178.1.56438 WP_000919178.1.56468 WP_000919178.1.56512 WP_000919178.1.56514 WP_000919178.1.56535 WP_000919178.1.56559 WP_000919178.1.56560 WP_000919178.1.56585 WP_000919178.1.56597 WP_000919178.1.56601 WP_000919178.1.56615 WP_000919178.1.56640 WP_000919178.1.56647 WP_000919178.1.56651 WP_000919178.1.56671 WP_000919178.1.5668 WP_000919178.1.56682 WP_000919178.1.56724 WP_000919178.1.56791 WP_000919178.1.56824 WP_000919178.1.56825 WP_000919178.1.56851 WP_000919178.1.56853 WP_000919178.1.56861 WP_000919178.1.56877 WP_000919178.1.56887 WP_000919178.1.56889 WP_000919178.1.56893 WP_000919178.1.56898 WP_000919178.1.56942 WP_000919178.1.56950 WP_000919178.1.56981 WP_000919178.1.57000 WP_000919178.1.57026 WP_000919178.1.57039 WP_000919178.1.57056 WP_000919178.1.57076 WP_000919178.1.57084 WP_000919178.1.57101 WP_000919178.1.5711 WP_000919178.1.57125 WP_000919178.1.57137 WP_000919178.1.57143 WP_000919178.1.57147 WP_000919178.1.57149 WP_000919178.1.57168 WP_000919178.1.57179 WP_000919178.1.57186 WP_000919178.1.57187 WP_000919178.1.57232 WP_000919178.1.57233 WP_000919178.1.57244 WP_000919178.1.57246 WP_000919178.1.57296 WP_000919178.1.57307 WP_000919178.1.57342 WP_000919178.1.57344 WP_000919178.1.57356 WP_000919178.1.57357 WP_000919178.1.57362 WP_000919178.1.57377 WP_000919178.1.57399 WP_000919178.1.57418 WP_000919178.1.57433 WP_000919178.1.57494 WP_000919178.1.57510 WP_000919178.1.57515 WP_000919178.1.57521 WP_000919178.1.57529 WP_000919178.1.5753 WP_000919178.1.57534 WP_000919178.1.57555 WP_000919178.1.57559 WP_000919178.1.57576 WP_000919178.1.57601 WP_000919178.1.57607 WP_000919178.1.5761 WP_000919178.1.57631 WP_000919178.1.57641 WP_000919178.1.57684 WP_000919178.1.57699 WP_000919178.1.57709 WP_000919178.1.57735 WP_000919178.1.5774 WP_000919178.1.57763 WP_000919178.1.57778 WP_000919178.1.57781 WP_000919178.1.57785 WP_000919178.1.57797 WP_000919178.1.57800 WP_000919178.1.57835 WP_000919178.1.57862 WP_000919178.1.57873 WP_000919178.1.57890 WP_000919178.1.57891 WP_000919178.1.57893 WP_000919178.1.57902 WP_000919178.1.57965 WP_000919178.1.57972 WP_000919178.1.57978 WP_000919178.1.58008 WP_000919178.1.5801 WP_000919178.1.58040 WP_000919178.1.58041 WP_000919178.1.58044 WP_000919178.1.58081 WP_000919178.1.5809 WP_000919178.1.58090 WP_000919178.1.58131 WP_000919178.1.58144 WP_000919178.1.58153 WP_000919178.1.58157 WP_000919178.1.58173 WP_000919178.1.58191 WP_000919178.1.58194 WP_000919178.1.58239 WP_000919178.1.58249 WP_000919178.1.58252 WP_000919178.1.58261 WP_000919178.1.58274 WP_000919178.1.5828 WP_000919178.1.58282 WP_000919178.1.58290 WP_000919178.1.58301 WP_000919178.1.58324 WP_000919178.1.58326 WP_000919178.1.58357 WP_000919178.1.58358 WP_000919178.1.5836 WP_000919178.1.58372 WP_000919178.1.58416 WP_000919178.1.58418 WP_000919178.1.58442 WP_000919178.1.58443 WP_000919178.1.58451 WP_000919178.1.5846 WP_000919178.1.58467 WP_000919178.1.58485 WP_000919178.1.58486 WP_000919178.1.58489 WP_000919178.1.58537 WP_000919178.1.5854 WP_000919178.1.58548 WP_000919178.1.58564 WP_000919178.1.58568 WP_000919178.1.5858 WP_000919178.1.58583 WP_000919178.1.58604 WP_000919178.1.58633 WP_000919178.1.58652 WP_000919178.1.58662 WP_000919178.1.58663 WP_000919178.1.58669 WP_000919178.1.58675 WP_000919178.1.58698 WP_000919178.1.587 WP_000919178.1.58724 WP_000919178.1.58729 WP_000919178.1.58744 WP_000919178.1.58745 WP_000919178.1.58749 WP_000919178.1.5875 WP_000919178.1.5878 WP_000919178.1.58796 WP_000919178.1.58803 WP_000919178.1.58807 WP_000919178.1.58831 WP_000919178.1.58834 WP_000919178.1.58847 WP_000919178.1.5886 WP_000919178.1.58861 WP_000919178.1.58883 WP_000919178.1.58884 WP_000919178.1.58898 WP_000919178.1.58926 WP_000919178.1.58932 WP_000919178.1.58949 WP_000919178.1.58963 WP_000919178.1.58970 WP_000919178.1.58974 WP_000919178.1.59006 WP_000919178.1.59012 WP_000919178.1.59020 WP_000919178.1.59043 WP_000919178.1.59056 WP_000919178.1.59061 WP_000919178.1.59064 WP_000919178.1.59068 WP_000919178.1.59084 WP_000919178.1.59094 WP_000919178.1.59097 WP_000919178.1.59125 WP_000919178.1.59136 WP_000919178.1.59142 WP_000919178.1.59148 WP_000919178.1.59163 WP_000919178.1.59224 WP_000919178.1.59236 WP_000919178.1.59276 WP_000919178.1.59282 WP_000919178.1.5929 WP_000919178.1.59295 WP_000919178.1.59299 WP_000919178.1.59313 WP_000919178.1.59335 WP_000919178.1.59336 WP_000919178.1.59375 WP_000919178.1.59381 WP_000919178.1.59412 WP_000919178.1.59420 WP_000919178.1.59427 WP_000919178.1.59439 WP_000919178.1.59458 WP_000919178.1.59486 WP_000919178.1.5949 WP_000919178.1.59490 WP_000919178.1.59501 WP_000919178.1.59508 WP_000919178.1.59510 WP_000919178.1.59512 WP_000919178.1.59521 WP_000919178.1.5953 WP_000919178.1.59538 WP_000919178.1.59548 WP_000919178.1.59562 WP_000919178.1.59587 WP_000919178.1.59636 WP_000919178.1.59641 WP_000919178.1.59646 WP_000919178.1.59648 WP_000919178.1.59684 WP_000919178.1.5969 WP_000919178.1.59694 WP_000919178.1.59751 WP_000919178.1.59771 WP_000919178.1.5979 WP_000919178.1.59827 WP_000919178.1.59829 WP_000919178.1.59830 WP_000919178.1.59847 WP_000919178.1.59848 WP_000919178.1.59863 WP_000919178.1.59928 WP_000919178.1.5993 WP_000919178.1.59953 WP_000919178.1.59969 WP_000919178.1.59979 WP_000919178.1.59994 WP_000919178.1.60004 WP_000919178.1.60008 WP_000919178.1.60021 WP_000919178.1.60045 WP_000919178.1.60052 WP_000919178.1.60069 WP_000919178.1.60076 WP_000919178.1.60114 WP_000919178.1.60126 WP_000919178.1.60137 WP_000919178.1.60140 WP_000919178.1.60154 WP_000919178.1.60155 WP_000919178.1.60168 WP_000919178.1.60192 WP_000919178.1.60199 WP_000919178.1.60209 WP_000919178.1.60212 WP_000919178.1.60213 WP_000919178.1.60226 WP_000919178.1.60253 WP_000919178.1.60285 WP_000919178.1.60320 WP_000919178.1.60322 WP_000919178.1.60324 WP_000919178.1.6033 WP_000919178.1.60330 WP_000919178.1.60356 WP_000919178.1.60379 WP_000919178.1.6038 WP_000919178.1.60380 WP_000919178.1.6041 WP_000919178.1.60424 WP_000919178.1.60425 WP_000919178.1.60464 WP_000919178.1.60481 WP_000919178.1.60486 WP_000919178.1.605 WP_000919178.1.60503 WP_000919178.1.60507 WP_000919178.1.6052 WP_000919178.1.60545 WP_000919178.1.60560 WP_000919178.1.6058 WP_000919178.1.60584 WP_000919178.1.60597 WP_000919178.1.6060 WP_000919178.1.60608 WP_000919178.1.60622 WP_000919178.1.60643 WP_000919178.1.60661 WP_000919178.1.60676 WP_000919178.1.60708 WP_000919178.1.60713 WP_000919178.1.60725 WP_000919178.1.60746 WP_000919178.1.60760 WP_000919178.1.60772 WP_000919178.1.60783 WP_000919178.1.60792 WP_000919178.1.608 WP_000919178.1.60807 WP_000919178.1.60809 WP_000919178.1.60838 WP_000919178.1.60851 WP_000919178.1.60855 WP_000919178.1.60857 WP_000919178.1.6086 WP_000919178.1.60863 WP_000919178.1.60866 WP_000919178.1.60874 WP_000919178.1.60882 WP_000919178.1.60889 WP_000919178.1.60897 WP_000919178.1.60919 WP_000919178.1.60926 WP_000919178.1.60941 WP_000919178.1.60950 WP_000919178.1.60976 WP_000919178.1.60988 WP_000919178.1.60990 WP_000919178.1.6104 WP_000919178.1.61044 WP_000919178.1.61045 WP_000919178.1.61076 WP_000919178.1.61078 WP_000919178.1.6108 WP_000919178.1.61087 WP_000919178.1.61114 WP_000919178.1.61123 WP_000919178.1.6114 WP_000919178.1.61146 WP_000919178.1.61147 WP_000919178.1.61168 WP_000919178.1.61184 WP_000919178.1.61200 WP_000919178.1.61201 WP_000919178.1.61210 WP_000919178.1.61218 WP_000919178.1.61232 WP_000919178.1.61233 WP_000919178.1.6129 WP_000919178.1.61309 WP_000919178.1.61345 WP_000919178.1.61356 WP_000919178.1.61357 WP_000919178.1.61381 WP_000919178.1.61417 WP_000919178.1.6143 WP_000919178.1.61434 WP_000919178.1.61497 WP_000919178.1.61501 WP_000919178.1.61509 WP_000919178.1.61511 WP_000919178.1.61519 WP_000919178.1.61539 WP_000919178.1.61542 WP_000919178.1.61553 WP_000919178.1.61574 WP_000919178.1.61582 WP_000919178.1.61594 WP_000919178.1.61595 WP_000919178.1.61609 WP_000919178.1.6164 WP_000919178.1.61649 WP_000919178.1.61652 WP_000919178.1.61662 WP_000919178.1.61667 WP_000919178.1.61671 WP_000919178.1.61694 WP_000919178.1.61697 WP_000919178.1.61712 WP_000919178.1.61714 WP_000919178.1.61730 WP_000919178.1.61732 WP_000919178.1.61743 WP_000919178.1.61809 WP_000919178.1.61857 WP_000919178.1.61877 WP_000919178.1.6190 WP_000919178.1.61908 WP_000919178.1.61918 WP_000919178.1.61920 WP_000919178.1.61922 WP_000919178.1.61924 WP_000919178.1.61952 WP_000919178.1.61968 WP_000919178.1.62007 WP_000919178.1.62025 WP_000919178.1.62063 WP_000919178.1.62076 WP_000919178.1.6210 WP_000919178.1.62120 WP_000919178.1.62122 WP_000919178.1.62124 WP_000919178.1.62142 WP_000919178.1.62144 WP_000919178.1.62158 WP_000919178.1.62195 WP_000919178.1.62199 WP_000919178.1.62201 WP_000919178.1.62204 WP_000919178.1.62210 WP_000919178.1.62219 WP_000919178.1.62222 WP_000919178.1.62223 WP_000919178.1.62241 WP_000919178.1.62245 WP_000919178.1.62271 WP_000919178.1.62302 WP_000919178.1.62304 WP_000919178.1.62310 WP_000919178.1.62314 WP_000919178.1.62323 WP_000919178.1.62333 WP_000919178.1.62338 WP_000919178.1.62339 WP_000919178.1.62344 WP_000919178.1.62361 WP_000919178.1.62364 WP_000919178.1.62374 WP_000919178.1.62380 WP_000919178.1.62403 WP_000919178.1.62411 WP_000919178.1.62412 WP_000919178.1.62436 WP_000919178.1.62475 WP_000919178.1.62486 WP_000919178.1.62488 WP_000919178.1.62504 WP_000919178.1.62522 WP_000919178.1.6253 WP_000919178.1.62536 WP_000919178.1.62564 WP_000919178.1.62570 WP_000919178.1.62619 WP_000919178.1.62640 WP_000919178.1.62648 WP_000919178.1.62677 WP_000919178.1.62686 WP_000919178.1.62693 WP_000919178.1.627 WP_000919178.1.62725 WP_000919178.1.62745 WP_000919178.1.62751 WP_000919178.1.62757 WP_000919178.1.62798 WP_000919178.1.62825 WP_000919178.1.62828 WP_000919178.1.62853 WP_000919178.1.62903 WP_000919178.1.62913 WP_000919178.1.6292 WP_000919178.1.62932 WP_000919178.1.62955 WP_000919178.1.62960 WP_000919178.1.62976 WP_000919178.1.62983 WP_000919178.1.62988 WP_000919178.1.63016 WP_000919178.1.63025 WP_000919178.1.63043 WP_000919178.1.63045 WP_000919178.1.63063 WP_000919178.1.63069 WP_000919178.1.63087 WP_000919178.1.63102 WP_000919178.1.63118 WP_000919178.1.63129 WP_000919178.1.63135 WP_000919178.1.63150 WP_000919178.1.63155 WP_000919178.1.63169 WP_000919178.1.63181 WP_000919178.1.63186 WP_000919178.1.63203 WP_000919178.1.63229 WP_000919178.1.63234 WP_000919178.1.63243 WP_000919178.1.63250 WP_000919178.1.63256 WP_000919178.1.63290 WP_000919178.1.63297 WP_000919178.1.63358 WP_000919178.1.63382 WP_000919178.1.63422 WP_000919178.1.63448 WP_000919178.1.63455 WP_000919178.1.63461 WP_000919178.1.63479 WP_000919178.1.63497 WP_000919178.1.63509 WP_000919178.1.63513 WP_000919178.1.63514 WP_000919178.1.63525 WP_000919178.1.63529 WP_000919178.1.63532 WP_000919178.1.63568 WP_000919178.1.6357 WP_000919178.1.63577 WP_000919178.1.63583 WP_000919178.1.63585 WP_000919178.1.63592 WP_000919178.1.63603 WP_000919178.1.63663 WP_000919178.1.63664 WP_000919178.1.6367 WP_000919178.1.63677 WP_000919178.1.63690 WP_000919178.1.6370 WP_000919178.1.63718 WP_000919178.1.63731 WP_000919178.1.63736 WP_000919178.1.63748 WP_000919178.1.6375 WP_000919178.1.63757 WP_000919178.1.63766 WP_000919178.1.63781 WP_000919178.1.63797 WP_000919178.1.63816 WP_000919178.1.63824 WP_000919178.1.63834 WP_000919178.1.63851 WP_000919178.1.63860 WP_000919178.1.63863 WP_000919178.1.63864 WP_000919178.1.63866 WP_000919178.1.63876 WP_000919178.1.6389 WP_000919178.1.63901 WP_000919178.1.63903 WP_000919178.1.63912 WP_000919178.1.63934 WP_000919178.1.63955 WP_000919178.1.63958 WP_000919178.1.63963 WP_000919178.1.63977 WP_000919178.1.6399 WP_000919178.1.63992 WP_000919178.1.64007 WP_000919178.1.64010 WP_000919178.1.64018 WP_000919178.1.64032 WP_000919178.1.64034 WP_000919178.1.64046 WP_000919178.1.64072 WP_000919178.1.64085 WP_000919178.1.64087 WP_000919178.1.64109 WP_000919178.1.64121 WP_000919178.1.6415 WP_000919178.1.64157 WP_000919178.1.64208 WP_000919178.1.64229 WP_000919178.1.6423 WP_000919178.1.64242 WP_000919178.1.64244 WP_000919178.1.64293 WP_000919178.1.64294 WP_000919178.1.64332 WP_000919178.1.64350 WP_000919178.1.64374 WP_000919178.1.64376 WP_000919178.1.64385 WP_000919178.1.64389 WP_000919178.1.644 WP_000919178.1.64403 WP_000919178.1.64412 WP_000919178.1.64462 WP_000919178.1.64471 WP_000919178.1.64500 WP_000919178.1.64501 WP_000919178.1.6451 WP_000919178.1.64538 WP_000919178.1.64569 WP_000919178.1.64597 WP_000919178.1.64632 WP_000919178.1.64645 WP_000919178.1.64648 WP_000919178.1.64649 WP_000919178.1.64654 WP_000919178.1.64662 WP_000919178.1.64663 WP_000919178.1.64667 WP_000919178.1.64674 WP_000919178.1.64690 WP_000919178.1.64702 WP_000919178.1.64709 WP_000919178.1.64710 WP_000919178.1.64711 WP_000919178.1.64744 WP_000919178.1.64757 WP_000919178.1.64758 WP_000919178.1.64763 WP_000919178.1.64771 WP_000919178.1.64781 WP_000919178.1.64798 WP_000919178.1.64817 WP_000919178.1.64831 WP_000919178.1.64847 WP_000919178.1.6487 WP_000919178.1.6489 WP_000919178.1.64891 WP_000919178.1.64894 WP_000919178.1.64919 WP_000919178.1.64920 WP_000919178.1.64944 WP_000919178.1.64972 WP_000919178.1.64974 WP_000919178.1.64977 WP_000919178.1.65011 WP_000919178.1.65016 WP_000919178.1.65018 WP_000919178.1.65022 WP_000919178.1.65027 WP_000919178.1.65028 WP_000919178.1.65052 WP_000919178.1.65054 WP_000919178.1.65075 WP_000919178.1.6514 WP_000919178.1.65163 WP_000919178.1.65168 WP_000919178.1.65171 WP_000919178.1.65172 WP_000919178.1.65185 WP_000919178.1.65191 WP_000919178.1.65200 WP_000919178.1.65211 WP_000919178.1.65218 WP_000919178.1.65226 WP_000919178.1.65238 WP_000919178.1.65248 WP_000919178.1.65249 WP_000919178.1.6525 WP_000919178.1.65266 WP_000919178.1.65269 WP_000919178.1.65295 WP_000919178.1.65348 WP_000919178.1.6535 WP_000919178.1.65357 WP_000919178.1.65394 WP_000919178.1.65395 WP_000919178.1.65437 WP_000919178.1.65459 WP_000919178.1.65463 WP_000919178.1.65474 WP_000919178.1.65475 WP_000919178.1.65487 WP_000919178.1.6549 WP_000919178.1.65499 WP_000919178.1.6550 WP_000919178.1.65508 WP_000919178.1.65538 WP_000919178.1.6554 WP_000919178.1.65558 WP_000919178.1.65572 WP_000919178.1.6560 WP_000919178.1.65601 WP_000919178.1.6561 WP_000919178.1.65633 WP_000919178.1.6565 WP_000919178.1.65650 WP_000919178.1.65687 WP_000919178.1.65696 WP_000919178.1.65697 WP_000919178.1.65698 WP_000919178.1.65699 WP_000919178.1.65737 WP_000919178.1.6575 WP_000919178.1.65755 WP_000919178.1.65771 WP_000919178.1.65782 WP_000919178.1.65790 WP_000919178.1.65812 WP_000919178.1.65818 WP_000919178.1.65838 WP_000919178.1.65846 WP_000919178.1.65849 WP_000919178.1.65863 WP_000919178.1.65876 WP_000919178.1.65881 WP_000919178.1.65883 WP_000919178.1.65901 WP_000919178.1.6594 WP_000919178.1.65940 WP_000919178.1.65945 WP_000919178.1.6595 WP_000919178.1.65968 WP_000919178.1.65985 WP_000919178.1.66021 WP_000919178.1.66031 WP_000919178.1.66049 WP_000919178.1.66052 WP_000919178.1.66064 WP_000919178.1.66074 WP_000919178.1.66085 WP_000919178.1.66109 WP_000919178.1.66122 WP_000919178.1.66129 WP_000919178.1.66145 WP_000919178.1.66167 WP_000919178.1.66171 WP_000919178.1.66183 WP_000919178.1.6620 WP_000919178.1.66216 WP_000919178.1.66234 WP_000919178.1.66250 WP_000919178.1.66270 WP_000919178.1.66272 WP_000919178.1.66273 WP_000919178.1.66289 WP_000919178.1.6630 WP_000919178.1.66314 WP_000919178.1.66315 WP_000919178.1.66324 WP_000919178.1.6634 WP_000919178.1.66358 WP_000919178.1.66361 WP_000919178.1.66362 WP_000919178.1.66365 WP_000919178.1.66368 WP_000919178.1.6638 WP_000919178.1.66385 WP_000919178.1.6640 WP_000919178.1.66400 WP_000919178.1.66428 WP_000919178.1.66446 WP_000919178.1.66462 WP_000919178.1.6647 WP_000919178.1.66480 WP_000919178.1.66492 WP_000919178.1.66506 WP_000919178.1.66534 WP_000919178.1.66539 WP_000919178.1.66600 WP_000919178.1.66630 WP_000919178.1.66665 WP_000919178.1.66678 WP_000919178.1.66681 WP_000919178.1.66684 WP_000919178.1.66698 WP_000919178.1.66702 WP_000919178.1.66733 WP_000919178.1.66755 WP_000919178.1.66759 WP_000919178.1.6680 WP_000919178.1.66800 WP_000919178.1.66801 WP_000919178.1.66807 WP_000919178.1.66820 WP_000919178.1.66824 WP_000919178.1.66825 WP_000919178.1.66834 WP_000919178.1.66860 WP_000919178.1.66876 WP_000919178.1.66901 WP_000919178.1.6692 WP_000919178.1.66937 WP_000919178.1.66953 WP_000919178.1.66955 WP_000919178.1.66959 WP_000919178.1.66962 WP_000919178.1.66981 WP_000919178.1.67 WP_000919178.1.67024 WP_000919178.1.67037 WP_000919178.1.67045 WP_000919178.1.67075 WP_000919178.1.6710 WP_000919178.1.67100 WP_000919178.1.67101 WP_000919178.1.67143 WP_000919178.1.67173 WP_000919178.1.67181 WP_000919178.1.67184 WP_000919178.1.67201 WP_000919178.1.67211 WP_000919178.1.67228 WP_000919178.1.67235 WP_000919178.1.67237 WP_000919178.1.67268 WP_000919178.1.67279 WP_000919178.1.67288 WP_000919178.1.67336 WP_000919178.1.67339 WP_000919178.1.67347 WP_000919178.1.67374 WP_000919178.1.67387 WP_000919178.1.6739 WP_000919178.1.67394 WP_000919178.1.67397 WP_000919178.1.67403 WP_000919178.1.67405 WP_000919178.1.67424 WP_000919178.1.67430 WP_000919178.1.67442 WP_000919178.1.67465 WP_000919178.1.67539 WP_000919178.1.67552 WP_000919178.1.67556 WP_000919178.1.67576 WP_000919178.1.6760 WP_000919178.1.67603 WP_000919178.1.67604 WP_000919178.1.67617 WP_000919178.1.67619 WP_000919178.1.67625 WP_000919178.1.67627 WP_000919178.1.67633 WP_000919178.1.67637 WP_000919178.1.67641 WP_000919178.1.67657 WP_000919178.1.67673 WP_000919178.1.67682 WP_000919178.1.67700 WP_000919178.1.67707 WP_000919178.1.67718 WP_000919178.1.67729 WP_000919178.1.67731 WP_000919178.1.67772 WP_000919178.1.67774 WP_000919178.1.67776 WP_000919178.1.67803 WP_000919178.1.67814 WP_000919178.1.6782 WP_000919178.1.67820 WP_000919178.1.67825 WP_000919178.1.67827 WP_000919178.1.67829 WP_000919178.1.6785 WP_000919178.1.67887 WP_000919178.1.67905 WP_000919178.1.67910 WP_000919178.1.67932 WP_000919178.1.67954 WP_000919178.1.67969 WP_000919178.1.67970 WP_000919178.1.67977 WP_000919178.1.67988 WP_000919178.1.68 WP_000919178.1.68036 WP_000919178.1.68043 WP_000919178.1.68075 WP_000919178.1.6809 WP_000919178.1.68105 WP_000919178.1.68113 WP_000919178.1.68115 WP_000919178.1.68131 WP_000919178.1.68140 WP_000919178.1.68159 WP_000919178.1.68167 WP_000919178.1.68182 WP_000919178.1.6819 WP_000919178.1.68201 WP_000919178.1.68206 WP_000919178.1.68210 WP_000919178.1.6827 WP_000919178.1.68275 WP_000919178.1.68285 WP_000919178.1.6833 WP_000919178.1.68359 WP_000919178.1.68401 WP_000919178.1.68420 WP_000919178.1.68478 WP_000919178.1.6849 WP_000919178.1.68514 WP_000919178.1.68532 WP_000919178.1.68547 WP_000919178.1.68564 WP_000919178.1.6857 WP_000919178.1.6858 WP_000919178.1.68589 WP_000919178.1.68629 WP_000919178.1.68652 WP_000919178.1.68655 WP_000919178.1.68656 WP_000919178.1.68658 WP_000919178.1.68677 WP_000919178.1.68688 WP_000919178.1.6869 WP_000919178.1.68690 WP_000919178.1.68742 WP_000919178.1.6875 WP_000919178.1.68770 WP_000919178.1.68778 WP_000919178.1.68787 WP_000919178.1.6879 WP_000919178.1.68809 WP_000919178.1.68816 WP_000919178.1.68818 WP_000919178.1.6883 WP_000919178.1.68893 WP_000919178.1.68894 WP_000919178.1.68895 WP_000919178.1.68914 WP_000919178.1.68928 WP_000919178.1.68958 WP_000919178.1.68966 WP_000919178.1.68975 WP_000919178.1.68999 WP_000919178.1.69001 WP_000919178.1.69006 WP_000919178.1.69011 WP_000919178.1.69029 WP_000919178.1.6905 WP_000919178.1.69053 WP_000919178.1.69058 WP_000919178.1.6907 WP_000919178.1.69080 WP_000919178.1.69086 WP_000919178.1.6913 WP_000919178.1.69131 WP_000919178.1.69139 WP_000919178.1.69146 WP_000919178.1.69151 WP_000919178.1.69170 WP_000919178.1.69210 WP_000919178.1.69236 WP_000919178.1.69255 WP_000919178.1.69270 WP_000919178.1.69273 WP_000919178.1.69282 WP_000919178.1.69288 WP_000919178.1.69296 WP_000919178.1.69320 WP_000919178.1.69346 WP_000919178.1.69357 WP_000919178.1.69371 WP_000919178.1.69376 WP_000919178.1.69385 WP_000919178.1.69396 WP_000919178.1.69397 WP_000919178.1.69433 WP_000919178.1.69465 WP_000919178.1.69466 WP_000919178.1.69485 WP_000919178.1.69515 WP_000919178.1.6954 WP_000919178.1.69554 WP_000919178.1.69564 WP_000919178.1.69575 WP_000919178.1.69588 WP_000919178.1.69592 WP_000919178.1.69611 WP_000919178.1.69616 WP_000919178.1.69636 WP_000919178.1.69642 WP_000919178.1.69644 WP_000919178.1.69656 WP_000919178.1.69657 WP_000919178.1.69690 WP_000919178.1.69696 WP_000919178.1.69704 WP_000919178.1.69710 WP_000919178.1.69754 WP_000919178.1.69758 WP_000919178.1.69760 WP_000919178.1.69767 WP_000919178.1.69787 WP_000919178.1.69790 WP_000919178.1.69807 WP_000919178.1.69808 WP_000919178.1.69817 WP_000919178.1.69839 WP_000919178.1.69848 WP_000919178.1.69890 WP_000919178.1.69923 WP_000919178.1.69948 WP_000919178.1.69953 WP_000919178.1.69965 WP_000919178.1.69975 WP_000919178.1.69977 WP_000919178.1.70003 WP_000919178.1.70010 WP_000919178.1.70028 WP_000919178.1.70047 WP_000919178.1.70049 WP_000919178.1.70058 WP_000919178.1.70061 WP_000919178.1.70088 WP_000919178.1.7010 WP_000919178.1.7014 WP_000919178.1.7016 WP_000919178.1.70169 WP_000919178.1.70205 WP_000919178.1.7021 WP_000919178.1.70240 WP_000919178.1.70241 WP_000919178.1.70248 WP_000919178.1.70249 WP_000919178.1.70261 WP_000919178.1.70269 WP_000919178.1.70272 WP_000919178.1.70289 WP_000919178.1.70303 WP_000919178.1.70314 WP_000919178.1.70321 WP_000919178.1.70326 WP_000919178.1.70327 WP_000919178.1.7033 WP_000919178.1.70427 WP_000919178.1.70433 WP_000919178.1.70440 WP_000919178.1.70447 WP_000919178.1.70485 WP_000919178.1.70488 WP_000919178.1.70491 WP_000919178.1.70523 WP_000919178.1.70531 WP_000919178.1.70545 WP_000919178.1.70547 WP_000919178.1.7055 WP_000919178.1.70580 WP_000919178.1.70596 WP_000919178.1.7060 WP_000919178.1.70623 WP_000919178.1.70643 WP_000919178.1.70644 WP_000919178.1.70662 WP_000919178.1.70671 WP_000919178.1.70678 WP_000919178.1.70679 WP_000919178.1.70683 WP_000919178.1.70685 WP_000919178.1.70708 WP_000919178.1.70712 WP_000919178.1.70717 WP_000919178.1.70731 WP_000919178.1.70732 WP_000919178.1.70733 WP_000919178.1.70761 WP_000919178.1.70772 WP_000919178.1.70785 WP_000919178.1.70792 WP_000919178.1.70797 WP_000919178.1.70837 WP_000919178.1.70845 WP_000919178.1.70846 WP_000919178.1.70869 WP_000919178.1.70883 WP_000919178.1.70899 WP_000919178.1.70914 WP_000919178.1.70922 WP_000919178.1.70929 WP_000919178.1.70948 WP_000919178.1.70969 WP_000919178.1.70977 WP_000919178.1.70981 WP_000919178.1.70985 WP_000919178.1.70995 WP_000919178.1.71007 WP_000919178.1.71010 WP_000919178.1.71039 WP_000919178.1.71057 WP_000919178.1.71069 WP_000919178.1.71081 WP_000919178.1.7110 WP_000919178.1.71116 WP_000919178.1.71117 WP_000919178.1.71120 WP_000919178.1.71146 WP_000919178.1.71150 WP_000919178.1.71165 WP_000919178.1.71171 WP_000919178.1.71172 WP_000919178.1.71184 WP_000919178.1.71186 WP_000919178.1.71188 WP_000919178.1.71201 WP_000919178.1.71202 WP_000919178.1.71243 WP_000919178.1.71248 WP_000919178.1.71268 WP_000919178.1.71299 WP_000919178.1.71305 WP_000919178.1.71306 WP_000919178.1.71337 WP_000919178.1.71378 WP_000919178.1.714 WP_000919178.1.71401 WP_000919178.1.71407 WP_000919178.1.71418 WP_000919178.1.7142 WP_000919178.1.71446 WP_000919178.1.71452 WP_000919178.1.71455 WP_000919178.1.71456 WP_000919178.1.71481 WP_000919178.1.71487 WP_000919178.1.71500 WP_000919178.1.71523 WP_000919178.1.71542 WP_000919178.1.71566 WP_000919178.1.71600 WP_000919178.1.71626 WP_000919178.1.71636 WP_000919178.1.71640 WP_000919178.1.71649 WP_000919178.1.71651 WP_000919178.1.71653 WP_000919178.1.71656 WP_000919178.1.71667 WP_000919178.1.71691 WP_000919178.1.71702 WP_000919178.1.71716 WP_000919178.1.7174 WP_000919178.1.71746 WP_000919178.1.71750 WP_000919178.1.71756 WP_000919178.1.71848 WP_000919178.1.71872 WP_000919178.1.71881 WP_000919178.1.71908 WP_000919178.1.71923 WP_000919178.1.71929 WP_000919178.1.71941 WP_000919178.1.71950 WP_000919178.1.71952 WP_000919178.1.71954 WP_000919178.1.71973 WP_000919178.1.71979 WP_000919178.1.71984 WP_000919178.1.71985 WP_000919178.1.720 WP_000919178.1.72003 WP_000919178.1.72065 WP_000919178.1.72068 WP_000919178.1.72073 WP_000919178.1.72100 WP_000919178.1.72105 WP_000919178.1.72107 WP_000919178.1.72119 WP_000919178.1.72121 WP_000919178.1.72182 WP_000919178.1.72188 WP_000919178.1.72190 WP_000919178.1.72203 WP_000919178.1.72220 WP_000919178.1.72221 WP_000919178.1.72226 WP_000919178.1.72234 WP_000919178.1.72243 WP_000919178.1.72254 WP_000919178.1.72269 WP_000919178.1.72277 WP_000919178.1.72281 WP_000919178.1.72283 WP_000919178.1.72300 WP_000919178.1.72307 WP_000919178.1.72325 WP_000919178.1.72339 WP_000919178.1.72350 WP_000919178.1.72351 WP_000919178.1.72372 WP_000919178.1.72376 WP_000919178.1.72383 WP_000919178.1.72412 WP_000919178.1.7243 WP_000919178.1.72461 WP_000919178.1.72470 WP_000919178.1.72527 WP_000919178.1.72532 WP_000919178.1.7255 WP_000919178.1.72594 WP_000919178.1.72602 WP_000919178.1.72625 WP_000919178.1.72629 WP_000919178.1.72631 WP_000919178.1.72638 WP_000919178.1.72642 WP_000919178.1.72667 WP_000919178.1.72674 WP_000919178.1.72689 WP_000919178.1.72716 WP_000919178.1.72718 WP_000919178.1.72724 WP_000919178.1.72789 WP_000919178.1.72793 WP_000919178.1.72797 WP_000919178.1.72828 WP_000919178.1.72843 WP_000919178.1.72850 WP_000919178.1.72865 WP_000919178.1.72871 WP_000919178.1.72872 WP_000919178.1.72887 WP_000919178.1.72892 WP_000919178.1.72894 WP_000919178.1.72896 WP_000919178.1.72897 WP_000919178.1.72944 WP_000919178.1.72946 WP_000919178.1.7295 WP_000919178.1.72968 WP_000919178.1.72969 WP_000919178.1.72975 WP_000919178.1.72987 WP_000919178.1.7304 WP_000919178.1.73052 WP_000919178.1.73062 WP_000919178.1.73068 WP_000919178.1.73102 WP_000919178.1.7311 WP_000919178.1.73114 WP_000919178.1.73125 WP_000919178.1.73144 WP_000919178.1.7315 WP_000919178.1.7316 WP_000919178.1.73164 WP_000919178.1.73177 WP_000919178.1.73180 WP_000919178.1.73200 WP_000919178.1.73258 WP_000919178.1.73270 WP_000919178.1.73285 WP_000919178.1.7332 WP_000919178.1.73328 WP_000919178.1.7333 WP_000919178.1.7334 WP_000919178.1.73352 WP_000919178.1.73362 WP_000919178.1.73377 WP_000919178.1.73379 WP_000919178.1.73389 WP_000919178.1.7341 WP_000919178.1.73425 WP_000919178.1.73461 WP_000919178.1.73481 WP_000919178.1.73488 WP_000919178.1.73504 WP_000919178.1.73512 WP_000919178.1.7353 WP_000919178.1.73535 WP_000919178.1.73544 WP_000919178.1.7356 WP_000919178.1.73561 WP_000919178.1.73581 WP_000919178.1.73596 WP_000919178.1.73598 WP_000919178.1.7361 WP_000919178.1.73617 WP_000919178.1.73648 WP_000919178.1.73667 WP_000919178.1.73701 WP_000919178.1.73708 WP_000919178.1.7374 WP_000919178.1.73753 WP_000919178.1.73758 WP_000919178.1.73764 WP_000919178.1.73768 WP_000919178.1.73794 WP_000919178.1.73804 WP_000919178.1.73831 WP_000919178.1.73849 WP_000919178.1.7386 WP_000919178.1.7387 WP_000919178.1.73901 WP_000919178.1.73926 WP_000919178.1.7394 WP_000919178.1.73945 WP_000919178.1.73948 WP_000919178.1.73958 WP_000919178.1.73999 WP_000919178.1.74024 WP_000919178.1.74028 WP_000919178.1.74030 WP_000919178.1.74038 WP_000919178.1.74040 WP_000919178.1.74043 WP_000919178.1.7405 WP_000919178.1.74058 WP_000919178.1.74070 WP_000919178.1.74077 WP_000919178.1.74089 WP_000919178.1.74135 WP_000919178.1.74174 WP_000919178.1.74181 WP_000919178.1.74191 WP_000919178.1.74207 WP_000919178.1.74214 WP_000919178.1.74228 WP_000919178.1.74241 WP_000919178.1.74248 WP_000919178.1.74285 WP_000919178.1.743 WP_000919178.1.7430 WP_000919178.1.74300 WP_000919178.1.74317 WP_000919178.1.7433 WP_000919178.1.74402 WP_000919178.1.74410 WP_000919178.1.74414 WP_000919178.1.74415 WP_000919178.1.74418 WP_000919178.1.74422 WP_000919178.1.7444 WP_000919178.1.74454 WP_000919178.1.74466 WP_000919178.1.745 WP_000919178.1.74500 WP_000919178.1.74529 WP_000919178.1.74545 WP_000919178.1.74570 WP_000919178.1.74578 WP_000919178.1.7458 WP_000919178.1.74616 WP_000919178.1.74620 WP_000919178.1.74621 WP_000919178.1.74639 WP_000919178.1.74644 WP_000919178.1.74647 WP_000919178.1.74661 WP_000919178.1.74677 WP_000919178.1.74699 WP_000919178.1.74702 WP_000919178.1.74741 WP_000919178.1.74745 WP_000919178.1.74806 WP_000919178.1.74807 WP_000919178.1.74826 WP_000919178.1.74831 WP_000919178.1.74884 WP_000919178.1.74894 WP_000919178.1.74929 WP_000919178.1.74939 WP_000919178.1.74946 WP_000919178.1.74972 WP_000919178.1.74973 WP_000919178.1.74996 WP_000919178.1.75009 WP_000919178.1.75051 WP_000919178.1.75056 WP_000919178.1.75058 WP_000919178.1.7507 WP_000919178.1.75089 WP_000919178.1.75114 WP_000919178.1.75116 WP_000919178.1.75129 WP_000919178.1.75134 WP_000919178.1.75148 WP_000919178.1.75159 WP_000919178.1.75180 WP_000919178.1.75187 WP_000919178.1.75237 WP_000919178.1.75273 WP_000919178.1.75288 WP_000919178.1.75296 WP_000919178.1.75301 WP_000919178.1.75334 WP_000919178.1.75362 WP_000919178.1.75371 WP_000919178.1.75385 WP_000919178.1.75392 WP_000919178.1.75400 WP_000919178.1.75402 WP_000919178.1.75413 WP_000919178.1.7543 WP_000919178.1.75433 WP_000919178.1.75450 WP_000919178.1.75494 WP_000919178.1.75532 WP_000919178.1.75565 WP_000919178.1.7558 WP_000919178.1.75585 WP_000919178.1.75593 WP_000919178.1.75607 WP_000919178.1.75609 WP_000919178.1.75610 WP_000919178.1.75626 WP_000919178.1.75633 WP_000919178.1.75664 WP_000919178.1.75703 WP_000919178.1.75716 WP_000919178.1.75718 WP_000919178.1.75740 WP_000919178.1.75745 WP_000919178.1.75751 WP_000919178.1.75760 WP_000919178.1.75764 WP_000919178.1.75793 WP_000919178.1.75794 WP_000919178.1.75810 WP_000919178.1.75828 WP_000919178.1.75837 WP_000919178.1.75844 WP_000919178.1.75863 WP_000919178.1.75873 WP_000919178.1.75874 WP_000919178.1.75886 WP_000919178.1.75898 WP_000919178.1.75902 WP_000919178.1.75932 WP_000919178.1.75945 WP_000919178.1.75957 WP_000919178.1.76 WP_000919178.1.76020 WP_000919178.1.76055 WP_000919178.1.76081 WP_000919178.1.76097 WP_000919178.1.76102 WP_000919178.1.76108 WP_000919178.1.76115 WP_000919178.1.76116 WP_000919178.1.76122 WP_000919178.1.76137 WP_000919178.1.76156 WP_000919178.1.76162 WP_000919178.1.76164 WP_000919178.1.76170 WP_000919178.1.76186 WP_000919178.1.76197 WP_000919178.1.76208 WP_000919178.1.76252 WP_000919178.1.76256 WP_000919178.1.7629 WP_000919178.1.76327 WP_000919178.1.7633 WP_000919178.1.76339 WP_000919178.1.7634 WP_000919178.1.76345 WP_000919178.1.76346 WP_000919178.1.76364 WP_000919178.1.76366 WP_000919178.1.76417 WP_000919178.1.76434 WP_000919178.1.76445 WP_000919178.1.76451 WP_000919178.1.7646 WP_000919178.1.76471 WP_000919178.1.76495 WP_000919178.1.76510 WP_000919178.1.76532 WP_000919178.1.76548 WP_000919178.1.7655 WP_000919178.1.76558 WP_000919178.1.7657 WP_000919178.1.76572 WP_000919178.1.76576 WP_000919178.1.7660 WP_000919178.1.76641 WP_000919178.1.76651 WP_000919178.1.76653 WP_000919178.1.76673 WP_000919178.1.76706 WP_000919178.1.7672 WP_000919178.1.76721 WP_000919178.1.76724 WP_000919178.1.76738 WP_000919178.1.76756 WP_000919178.1.76760 WP_000919178.1.76776 WP_000919178.1.76788 WP_000919178.1.76799 WP_000919178.1.76806 WP_000919178.1.7684 WP_000919178.1.76854 WP_000919178.1.76866 WP_000919178.1.76875 WP_000919178.1.76880 WP_000919178.1.76899 WP_000919178.1.76913 WP_000919178.1.76916 WP_000919178.1.76932 WP_000919178.1.76968 WP_000919178.1.76973 WP_000919178.1.76988 WP_000919178.1.77016 WP_000919178.1.77017 WP_000919178.1.77033 WP_000919178.1.77038 WP_000919178.1.77047 WP_000919178.1.77067 WP_000919178.1.77087 WP_000919178.1.77090 WP_000919178.1.77111 WP_000919178.1.7712 WP_000919178.1.77177 WP_000919178.1.77180 WP_000919178.1.77184 WP_000919178.1.77193 WP_000919178.1.77241 WP_000919178.1.77244 WP_000919178.1.77292 WP_000919178.1.77299 WP_000919178.1.77306 WP_000919178.1.77313 WP_000919178.1.77349 WP_000919178.1.77356 WP_000919178.1.77384 WP_000919178.1.77390 WP_000919178.1.77414 WP_000919178.1.77431 WP_000919178.1.77436 WP_000919178.1.77440 WP_000919178.1.77475 WP_000919178.1.77496 WP_000919178.1.77501 WP_000919178.1.77512 WP_000919178.1.77513 WP_000919178.1.77514 WP_000919178.1.77529 WP_000919178.1.77543 WP_000919178.1.77549 WP_000919178.1.77555 WP_000919178.1.77563 WP_000919178.1.77565 WP_000919178.1.77575 WP_000919178.1.77596 WP_000919178.1.77629 WP_000919178.1.77646 WP_000919178.1.77653 WP_000919178.1.77692 WP_000919178.1.77702 WP_000919178.1.77710 WP_000919178.1.77713 WP_000919178.1.7772 WP_000919178.1.77729 WP_000919178.1.77754 WP_000919178.1.77761 WP_000919178.1.7782 WP_000919178.1.77825 WP_000919178.1.77837 WP_000919178.1.7784 WP_000919178.1.77846 WP_000919178.1.77851 WP_000919178.1.77871 WP_000919178.1.77898 WP_000919178.1.77900 WP_000919178.1.77918 WP_000919178.1.7792 WP_000919178.1.77923 WP_000919178.1.7793 WP_000919178.1.77951 WP_000919178.1.77960 WP_000919178.1.77971 WP_000919178.1.77975 WP_000919178.1.77983 WP_000919178.1.77989 WP_000919178.1.78 WP_000919178.1.78016 WP_000919178.1.7802 WP_000919178.1.78026 WP_000919178.1.78033 WP_000919178.1.78035 WP_000919178.1.78048 WP_000919178.1.78051 WP_000919178.1.78053 WP_000919178.1.78076 WP_000919178.1.78096 WP_000919178.1.78100 WP_000919178.1.78107 WP_000919178.1.78110 WP_000919178.1.78120 WP_000919178.1.7814 WP_000919178.1.78166 WP_000919178.1.78168 WP_000919178.1.78170 WP_000919178.1.78180 WP_000919178.1.78192 WP_000919178.1.78195 WP_000919178.1.78201 WP_000919178.1.78259 WP_000919178.1.78291 WP_000919178.1.78301 WP_000919178.1.78309 WP_000919178.1.78320 WP_000919178.1.78339 WP_000919178.1.78352 WP_000919178.1.78366 WP_000919178.1.78382 WP_000919178.1.78383 WP_000919178.1.78388 WP_000919178.1.78407 WP_000919178.1.78410 WP_000919178.1.78443 WP_000919178.1.78495 WP_000919178.1.78496 WP_000919178.1.78501 WP_000919178.1.78502 WP_000919178.1.78602 WP_000919178.1.78603 WP_000919178.1.7861 WP_000919178.1.78618 WP_000919178.1.7862 WP_000919178.1.78626 WP_000919178.1.78632 WP_000919178.1.78658 WP_000919178.1.78661 WP_000919178.1.78673 WP_000919178.1.78674 WP_000919178.1.78676 WP_000919178.1.78697 WP_000919178.1.78734 WP_000919178.1.78735 WP_000919178.1.78738 WP_000919178.1.78761 WP_000919178.1.7877 WP_000919178.1.78771 WP_000919178.1.78789 WP_000919178.1.78802 WP_000919178.1.78815 WP_000919178.1.78830 WP_000919178.1.78835 WP_000919178.1.78838 WP_000919178.1.78862 WP_000919178.1.78871 WP_000919178.1.78874 WP_000919178.1.78877 WP_000919178.1.78881 WP_000919178.1.78896 WP_000919178.1.789 WP_000919178.1.7891 WP_000919178.1.78913 WP_000919178.1.78918 WP_000919178.1.7893 WP_000919178.1.78930 WP_000919178.1.78951 WP_000919178.1.78959 WP_000919178.1.78993 WP_000919178.1.79011 WP_000919178.1.79012 WP_000919178.1.79069 WP_000919178.1.79074 WP_000919178.1.79081 WP_000919178.1.79098 WP_000919178.1.79099 WP_000919178.1.79140 WP_000919178.1.79151 WP_000919178.1.79155 WP_000919178.1.79164 WP_000919178.1.79167 WP_000919178.1.79189 WP_000919178.1.79203 WP_000919178.1.79204 WP_000919178.1.79235 WP_000919178.1.79280 WP_000919178.1.79289 WP_000919178.1.79297 WP_000919178.1.79335 WP_000919178.1.79370 WP_000919178.1.79397 WP_000919178.1.794 WP_000919178.1.79427 WP_000919178.1.79456 WP_000919178.1.79462 WP_000919178.1.79466 WP_000919178.1.79468 WP_000919178.1.79472 WP_000919178.1.79490 WP_000919178.1.79495 WP_000919178.1.79529 WP_000919178.1.79531 WP_000919178.1.79532 WP_000919178.1.79547 WP_000919178.1.79570 WP_000919178.1.79580 WP_000919178.1.79586 WP_000919178.1.7964 WP_000919178.1.79645 WP_000919178.1.79654 WP_000919178.1.79659 WP_000919178.1.79668 WP_000919178.1.7970 WP_000919178.1.79708 WP_000919178.1.7972 WP_000919178.1.79722 WP_000919178.1.79738 WP_000919178.1.79757 WP_000919178.1.79772 WP_000919178.1.7979 WP_000919178.1.7982 WP_000919178.1.79832 WP_000919178.1.79845 WP_000919178.1.79867 WP_000919178.1.79880 WP_000919178.1.79892 WP_000919178.1.7991 WP_000919178.1.79910 WP_000919178.1.79914 WP_000919178.1.79916 WP_000919178.1.79929 WP_000919178.1.79934 WP_000919178.1.7994 WP_000919178.1.79942 WP_000919178.1.79945 WP_000919178.1.79951 WP_000919178.1.79974 WP_000919178.1.79977 WP_000919178.1.79996 WP_000919178.1.80045 WP_000919178.1.80065 WP_000919178.1.80077 WP_000919178.1.80103 WP_000919178.1.80137 WP_000919178.1.80149 WP_000919178.1.80182 WP_000919178.1.80229 WP_000919178.1.80236 WP_000919178.1.80249 WP_000919178.1.80250 WP_000919178.1.80254 WP_000919178.1.80273 WP_000919178.1.80282 WP_000919178.1.80296 WP_000919178.1.80307 WP_000919178.1.80333 WP_000919178.1.80354 WP_000919178.1.80366 WP_000919178.1.80368 WP_000919178.1.80380 WP_000919178.1.80386 WP_000919178.1.80400 WP_000919178.1.80441 WP_000919178.1.80443 WP_000919178.1.80448 WP_000919178.1.80462 WP_000919178.1.80473 WP_000919178.1.80479 WP_000919178.1.80480 WP_000919178.1.8049 WP_000919178.1.80492 WP_000919178.1.80529 WP_000919178.1.80542 WP_000919178.1.80569 WP_000919178.1.80586 WP_000919178.1.80609 WP_000919178.1.80629 WP_000919178.1.80638 WP_000919178.1.80651 WP_000919178.1.80664 WP_000919178.1.80696 WP_000919178.1.80707 WP_000919178.1.80725 WP_000919178.1.80757 WP_000919178.1.80760 WP_000919178.1.80780 WP_000919178.1.80819 WP_000919178.1.80827 WP_000919178.1.80831 WP_000919178.1.80840 WP_000919178.1.80850 WP_000919178.1.80857 WP_000919178.1.80868 WP_000919178.1.80874 WP_000919178.1.80876 WP_000919178.1.80881 WP_000919178.1.80913 WP_000919178.1.80927 WP_000919178.1.80939 WP_000919178.1.8096 WP_000919178.1.80973 WP_000919178.1.80984 WP_000919178.1.81037 WP_000919178.1.81041 WP_000919178.1.8106 WP_000919178.1.81062 WP_000919178.1.81067 WP_000919178.1.81069 WP_000919178.1.81084 WP_000919178.1.81107 WP_000919178.1.81109 WP_000919178.1.81110 WP_000919178.1.81131 WP_000919178.1.81149 WP_000919178.1.81175 WP_000919178.1.81187 WP_000919178.1.8119 WP_000919178.1.81193 WP_000919178.1.81197 WP_000919178.1.81225 WP_000919178.1.81231 WP_000919178.1.81262 WP_000919178.1.81268 WP_000919178.1.81269 WP_000919178.1.8127 WP_000919178.1.81271 WP_000919178.1.81275 WP_000919178.1.8130 WP_000919178.1.81302 WP_000919178.1.8131 WP_000919178.1.81333 WP_000919178.1.8134 WP_000919178.1.81342 WP_000919178.1.81354 WP_000919178.1.81364 WP_000919178.1.81388 WP_000919178.1.81404 WP_000919178.1.81409 WP_000919178.1.81410 WP_000919178.1.81425 WP_000919178.1.81455 WP_000919178.1.81472 WP_000919178.1.81494 WP_000919178.1.81504 WP_000919178.1.81528 WP_000919178.1.81548 WP_000919178.1.81557 WP_000919178.1.81568 WP_000919178.1.81667 WP_000919178.1.81668 WP_000919178.1.81676 WP_000919178.1.8168 WP_000919178.1.81681 WP_000919178.1.8170 WP_000919178.1.81735 WP_000919178.1.81736 WP_000919178.1.81746 WP_000919178.1.81750 WP_000919178.1.81760 WP_000919178.1.81763 WP_000919178.1.81768 WP_000919178.1.81785 WP_000919178.1.81795 WP_000919178.1.81798 WP_000919178.1.81855 WP_000919178.1.81902 WP_000919178.1.81921 WP_000919178.1.81931 WP_000919178.1.81936 WP_000919178.1.81941 WP_000919178.1.81949 WP_000919178.1.8196 WP_000919178.1.81965 WP_000919178.1.81974 WP_000919178.1.81977 WP_000919178.1.81995 WP_000919178.1.82037 WP_000919178.1.82070 WP_000919178.1.82076 WP_000919178.1.82099 WP_000919178.1.82131 WP_000919178.1.82141 WP_000919178.1.82144 WP_000919178.1.82156 WP_000919178.1.8218 WP_000919178.1.82180 WP_000919178.1.82192 WP_000919178.1.82201 WP_000919178.1.82214 WP_000919178.1.82225 WP_000919178.1.82232 WP_000919178.1.82258 WP_000919178.1.82269 WP_000919178.1.82337 WP_000919178.1.82347 WP_000919178.1.82352 WP_000919178.1.8236 WP_000919178.1.82369 WP_000919178.1.82395 WP_000919178.1.8240 WP_000919178.1.82401 WP_000919178.1.82408 WP_000919178.1.82416 WP_000919178.1.8242 WP_000919178.1.82420 WP_000919178.1.82434 WP_000919178.1.82456 WP_000919178.1.82464 WP_000919178.1.82465 WP_000919178.1.8247 WP_000919178.1.82473 WP_000919178.1.82474 WP_000919178.1.82479 WP_000919178.1.82503 WP_000919178.1.82515 WP_000919178.1.82529 WP_000919178.1.82553 WP_000919178.1.82569 WP_000919178.1.82570 WP_000919178.1.82584 WP_000919178.1.82636 WP_000919178.1.82637 WP_000919178.1.82646 WP_000919178.1.82648 WP_000919178.1.82670 WP_000919178.1.82676 WP_000919178.1.82692 WP_000919178.1.82731 WP_000919178.1.82761 WP_000919178.1.82763 WP_000919178.1.82812 WP_000919178.1.8282 WP_000919178.1.82841 WP_000919178.1.82843 WP_000919178.1.82850 WP_000919178.1.82867 WP_000919178.1.82872 WP_000919178.1.82886 WP_000919178.1.82895 WP_000919178.1.82899 WP_000919178.1.82908 WP_000919178.1.82937 WP_000919178.1.8294 WP_000919178.1.82944 WP_000919178.1.82946 WP_000919178.1.82956 WP_000919178.1.82959 WP_000919178.1.82964 WP_000919178.1.82992 WP_000919178.1.83005 WP_000919178.1.83006 WP_000919178.1.83007 WP_000919178.1.8304 WP_000919178.1.83061 WP_000919178.1.83092 WP_000919178.1.83139 WP_000919178.1.83163 WP_000919178.1.83180 WP_000919178.1.83204 WP_000919178.1.8322 WP_000919178.1.83221 WP_000919178.1.83229 WP_000919178.1.83235 WP_000919178.1.83247 WP_000919178.1.83252 WP_000919178.1.83258 WP_000919178.1.83280 WP_000919178.1.83290 WP_000919178.1.83301 WP_000919178.1.83305 WP_000919178.1.83331 WP_000919178.1.83333 WP_000919178.1.83354 WP_000919178.1.83356 WP_000919178.1.83360 WP_000919178.1.83365 WP_000919178.1.83378 WP_000919178.1.83382 WP_000919178.1.83388 WP_000919178.1.83407 WP_000919178.1.83413 WP_000919178.1.83491 WP_000919178.1.83510 WP_000919178.1.83516 WP_000919178.1.83523 WP_000919178.1.8354 WP_000919178.1.83558 WP_000919178.1.83572 WP_000919178.1.83598 WP_000919178.1.83650 WP_000919178.1.83651 WP_000919178.1.83657 WP_000919178.1.83677 WP_000919178.1.83710 WP_000919178.1.83721 WP_000919178.1.83739 WP_000919178.1.8375 WP_000919178.1.83759 WP_000919178.1.83760 WP_000919178.1.83806 WP_000919178.1.83854 WP_000919178.1.83923 WP_000919178.1.83979 WP_000919178.1.8399 WP_000919178.1.83994 WP_000919178.1.83995 WP_000919178.1.84 WP_000919178.1.84000 WP_000919178.1.84001 WP_000919178.1.84011 WP_000919178.1.84031 WP_000919178.1.8406 WP_000919178.1.84075 WP_000919178.1.84076 WP_000919178.1.84077 WP_000919178.1.84083 WP_000919178.1.84086 WP_000919178.1.84100 WP_000919178.1.84103 WP_000919178.1.84106 WP_000919178.1.84110 WP_000919178.1.84127 WP_000919178.1.84150 WP_000919178.1.84154 WP_000919178.1.84168 WP_000919178.1.84179 WP_000919178.1.84198 WP_000919178.1.84205 WP_000919178.1.84209 WP_000919178.1.84229 WP_000919178.1.84230 WP_000919178.1.8425 WP_000919178.1.84252 WP_000919178.1.84283 WP_000919178.1.84291 WP_000919178.1.84300 WP_000919178.1.8431 WP_000919178.1.84345 WP_000919178.1.84355 WP_000919178.1.84359 WP_000919178.1.84369 WP_000919178.1.84373 WP_000919178.1.84392 WP_000919178.1.84401 WP_000919178.1.8441 WP_000919178.1.84435 WP_000919178.1.84459 WP_000919178.1.84461 WP_000919178.1.84475 WP_000919178.1.84497 WP_000919178.1.84515 WP_000919178.1.84532 WP_000919178.1.84554 WP_000919178.1.84567 WP_000919178.1.84572 WP_000919178.1.84598 WP_000919178.1.84631 WP_000919178.1.84644 WP_000919178.1.84659 WP_000919178.1.84693 WP_000919178.1.84711 WP_000919178.1.84721 WP_000919178.1.84727 WP_000919178.1.84744 WP_000919178.1.84745 WP_000919178.1.84773 WP_000919178.1.84814 WP_000919178.1.84872 WP_000919178.1.84876 WP_000919178.1.84879 WP_000919178.1.84899 WP_000919178.1.849 WP_000919178.1.84945 WP_000919178.1.84967 WP_000919178.1.8497 WP_000919178.1.84983 WP_000919178.1.850 WP_000919178.1.85004 WP_000919178.1.85014 WP_000919178.1.8502 WP_000919178.1.85031 WP_000919178.1.85039 WP_000919178.1.85040 WP_000919178.1.85079 WP_000919178.1.85094 WP_000919178.1.85120 WP_000919178.1.85126 WP_000919178.1.85147 WP_000919178.1.85153 WP_000919178.1.85178 WP_000919178.1.85180 WP_000919178.1.85190 WP_000919178.1.85192 WP_000919178.1.85217 WP_000919178.1.8526 WP_000919178.1.85271 WP_000919178.1.85273 WP_000919178.1.85301 WP_000919178.1.8533 WP_000919178.1.85338 WP_000919178.1.85339 WP_000919178.1.8537 WP_000919178.1.85408 WP_000919178.1.85433 WP_000919178.1.8545 WP_000919178.1.85456 WP_000919178.1.85469 WP_000919178.1.85481 WP_000919178.1.85483 WP_000919178.1.85511 WP_000919178.1.85512 WP_000919178.1.8552 WP_000919178.1.85541 WP_000919178.1.8556 WP_000919178.1.8557 WP_000919178.1.85606 WP_000919178.1.85615 WP_000919178.1.85617 WP_000919178.1.85635 WP_000919178.1.85646 WP_000919178.1.85654 WP_000919178.1.85663 WP_000919178.1.85665 WP_000919178.1.85669 WP_000919178.1.85671 WP_000919178.1.85672 WP_000919178.1.85675 WP_000919178.1.85688 WP_000919178.1.85703 WP_000919178.1.85723 WP_000919178.1.85728 WP_000919178.1.85742 WP_000919178.1.85746 WP_000919178.1.85759 WP_000919178.1.85777 WP_000919178.1.85780 WP_000919178.1.85784 WP_000919178.1.85811 WP_000919178.1.85854 WP_000919178.1.85855 WP_000919178.1.85864 WP_000919178.1.85886 WP_000919178.1.859 WP_000919178.1.85900 WP_000919178.1.85904 WP_000919178.1.8591 WP_000919178.1.85917 WP_000919178.1.8594 WP_000919178.1.85943 WP_000919178.1.85976 WP_000919178.1.85977 WP_000919178.1.85982 WP_000919178.1.860 WP_000919178.1.86007 WP_000919178.1.86010 WP_000919178.1.86017 WP_000919178.1.86043 WP_000919178.1.8605 WP_000919178.1.86084 WP_000919178.1.86092 WP_000919178.1.8610 WP_000919178.1.86120 WP_000919178.1.86126 WP_000919178.1.86138 WP_000919178.1.8614 WP_000919178.1.86156 WP_000919178.1.86157 WP_000919178.1.86159 WP_000919178.1.8616 WP_000919178.1.86173 WP_000919178.1.86206 WP_000919178.1.86224 WP_000919178.1.86240 WP_000919178.1.86259 WP_000919178.1.86284 WP_000919178.1.86285 WP_000919178.1.86306 WP_000919178.1.86310 WP_000919178.1.86316 WP_000919178.1.86323 WP_000919178.1.86342 WP_000919178.1.86347 WP_000919178.1.86356 WP_000919178.1.86380 WP_000919178.1.86389 WP_000919178.1.8640 WP_000919178.1.8642 WP_000919178.1.86426 WP_000919178.1.86450 WP_000919178.1.86453 WP_000919178.1.86466 WP_000919178.1.86469 WP_000919178.1.8647 WP_000919178.1.86489 WP_000919178.1.86514 WP_000919178.1.86530 WP_000919178.1.86580 WP_000919178.1.86588 WP_000919178.1.86593 WP_000919178.1.86610 WP_000919178.1.86634 WP_000919178.1.86656 WP_000919178.1.86661 WP_000919178.1.86663 WP_000919178.1.86699 WP_000919178.1.8671 WP_000919178.1.8672 WP_000919178.1.86744 WP_000919178.1.86770 WP_000919178.1.8678 WP_000919178.1.86794 WP_000919178.1.86800 WP_000919178.1.86807 WP_000919178.1.86810 WP_000919178.1.86811 WP_000919178.1.86815 WP_000919178.1.8684 WP_000919178.1.86859 WP_000919178.1.86860 WP_000919178.1.86895 WP_000919178.1.86902 WP_000919178.1.86906 WP_000919178.1.8691 WP_000919178.1.86915 WP_000919178.1.86921 WP_000919178.1.86945 WP_000919178.1.86982 WP_000919178.1.86989 WP_000919178.1.87034 WP_000919178.1.87038 WP_000919178.1.87041 WP_000919178.1.87051 WP_000919178.1.87095 WP_000919178.1.87136 WP_000919178.1.87143 WP_000919178.1.87155 WP_000919178.1.87187 WP_000919178.1.87219 WP_000919178.1.8722 WP_000919178.1.87220 WP_000919178.1.87258 WP_000919178.1.87265 WP_000919178.1.87276 WP_000919178.1.87282 WP_000919178.1.87283 WP_000919178.1.87293 WP_000919178.1.87323 WP_000919178.1.87346 WP_000919178.1.8736 WP_000919178.1.87365 WP_000919178.1.87370 WP_000919178.1.87376 WP_000919178.1.87420 WP_000919178.1.87460 WP_000919178.1.87484 WP_000919178.1.87493 WP_000919178.1.87500 WP_000919178.1.87528 WP_000919178.1.87552 WP_000919178.1.87560 WP_000919178.1.87583 WP_000919178.1.87584 WP_000919178.1.8760 WP_000919178.1.87600 WP_000919178.1.87609 WP_000919178.1.87612 WP_000919178.1.87615 WP_000919178.1.87618 WP_000919178.1.87626 WP_000919178.1.87651 WP_000919178.1.87653 WP_000919178.1.87659 WP_000919178.1.8767 WP_000919178.1.87687 WP_000919178.1.87698 WP_000919178.1.87706 WP_000919178.1.87712 WP_000919178.1.87739 WP_000919178.1.87741 WP_000919178.1.87742 WP_000919178.1.87760 WP_000919178.1.87779 WP_000919178.1.87813 WP_000919178.1.87852 WP_000919178.1.87875 WP_000919178.1.87891 WP_000919178.1.87905 WP_000919178.1.8792 WP_000919178.1.87933 WP_000919178.1.87936 WP_000919178.1.87945 WP_000919178.1.87949 WP_000919178.1.87999 WP_000919178.1.8800 WP_000919178.1.88014 WP_000919178.1.88019 WP_000919178.1.88025 WP_000919178.1.88026 WP_000919178.1.8805 WP_000919178.1.88052 WP_000919178.1.8806 WP_000919178.1.88073 WP_000919178.1.8809 WP_000919178.1.88092 WP_000919178.1.881 WP_000919178.1.88136 WP_000919178.1.88145 WP_000919178.1.88174 WP_000919178.1.88185 WP_000919178.1.88199 WP_000919178.1.88214 WP_000919178.1.88222 WP_000919178.1.88244 WP_000919178.1.88275 WP_000919178.1.88291 WP_000919178.1.88293 WP_000919178.1.88299 WP_000919178.1.88303 WP_000919178.1.88313 WP_000919178.1.88356 WP_000919178.1.88359 WP_000919178.1.8837 WP_000919178.1.88393 WP_000919178.1.88407 WP_000919178.1.88414 WP_000919178.1.88423 WP_000919178.1.88444 WP_000919178.1.88446 WP_000919178.1.88458 WP_000919178.1.88474 WP_000919178.1.88483 WP_000919178.1.8849 WP_000919178.1.88501 WP_000919178.1.88508 WP_000919178.1.88538 WP_000919178.1.88547 WP_000919178.1.88597 WP_000919178.1.886 WP_000919178.1.88609 WP_000919178.1.88620 WP_000919178.1.88624 WP_000919178.1.88647 WP_000919178.1.88648 WP_000919178.1.88651 WP_000919178.1.88675 WP_000919178.1.88683 WP_000919178.1.88692 WP_000919178.1.88698 WP_000919178.1.88703 WP_000919178.1.88707 WP_000919178.1.88727 WP_000919178.1.88731 WP_000919178.1.88762 WP_000919178.1.88772 WP_000919178.1.88792 WP_000919178.1.88817 WP_000919178.1.88845 WP_000919178.1.88850 WP_000919178.1.88854 WP_000919178.1.8889 WP_000919178.1.88892 WP_000919178.1.88894 WP_000919178.1.88902 WP_000919178.1.8891 WP_000919178.1.88942 WP_000919178.1.88957 WP_000919178.1.88966 WP_000919178.1.88967 WP_000919178.1.88968 WP_000919178.1.88970 WP_000919178.1.88981 WP_000919178.1.88982 WP_000919178.1.88995 WP_000919178.1.88998 WP_000919178.1.89008 WP_000919178.1.89054 WP_000919178.1.89116 WP_000919178.1.89120 WP_000919178.1.89138 WP_000919178.1.89174 WP_000919178.1.89177 WP_000919178.1.89182 WP_000919178.1.89188 WP_000919178.1.89215 WP_000919178.1.89221 WP_000919178.1.89291 WP_000919178.1.89298 WP_000919178.1.89304 WP_000919178.1.89308 WP_000919178.1.89314 WP_000919178.1.89328 WP_000919178.1.89332 WP_000919178.1.89343 WP_000919178.1.89354 WP_000919178.1.89362 WP_000919178.1.89395 WP_000919178.1.8940 WP_000919178.1.89408 WP_000919178.1.89425 WP_000919178.1.89449 WP_000919178.1.89462 WP_000919178.1.8947 WP_000919178.1.89503 WP_000919178.1.89512 WP_000919178.1.89527 WP_000919178.1.89570 WP_000919178.1.8958 WP_000919178.1.89580 WP_000919178.1.89591 WP_000919178.1.89604 WP_000919178.1.89606 WP_000919178.1.8961 WP_000919178.1.89612 WP_000919178.1.89622 WP_000919178.1.89632 WP_000919178.1.89634 WP_000919178.1.89647 WP_000919178.1.89659 WP_000919178.1.89668 WP_000919178.1.89680 WP_000919178.1.89706 WP_000919178.1.89713 WP_000919178.1.89733 WP_000919178.1.89746 WP_000919178.1.89764 WP_000919178.1.89777 WP_000919178.1.89789 WP_000919178.1.89796 WP_000919178.1.89804 WP_000919178.1.89815 WP_000919178.1.89817 WP_000919178.1.89832 WP_000919178.1.89845 WP_000919178.1.89870 WP_000919178.1.89888 WP_000919178.1.89902 WP_000919178.1.89911 WP_000919178.1.89940 WP_000919178.1.8995 WP_000919178.1.89952 WP_000919178.1.8996 WP_000919178.1.89975 WP_000919178.1.90007 WP_000919178.1.9002 WP_000919178.1.9003 WP_000919178.1.90033 WP_000919178.1.90084 WP_000919178.1.90097 WP_000919178.1.90108 WP_000919178.1.9011 WP_000919178.1.90193 WP_000919178.1.90196 WP_000919178.1.90211 WP_000919178.1.90220 WP_000919178.1.90240 WP_000919178.1.90252 WP_000919178.1.90274 WP_000919178.1.90280 WP_000919178.1.90293 WP_000919178.1.90311 WP_000919178.1.90330 WP_000919178.1.90338 WP_000919178.1.90348 WP_000919178.1.90363 WP_000919178.1.90365 WP_000919178.1.90409 WP_000919178.1.90417 WP_000919178.1.90421 WP_000919178.1.90428 WP_000919178.1.90440 WP_000919178.1.90453 WP_000919178.1.90458 WP_000919178.1.90472 WP_000919178.1.90489 WP_000919178.1.90513 WP_000919178.1.90522 WP_000919178.1.90540 WP_000919178.1.90557 WP_000919178.1.90563 WP_000919178.1.90582 WP_000919178.1.90585 WP_000919178.1.90620 WP_000919178.1.9064 WP_000919178.1.90641 WP_000919178.1.90686 WP_000919178.1.90701 WP_000919178.1.90713 WP_000919178.1.90734 WP_000919178.1.90748 WP_000919178.1.90759 WP_000919178.1.90792 WP_000919178.1.90794 WP_000919178.1.90796 WP_000919178.1.90811 WP_000919178.1.90814 WP_000919178.1.90859 WP_000919178.1.90866 WP_000919178.1.90876 WP_000919178.1.9089 WP_000919178.1.9091 WP_000919178.1.9093 WP_000919178.1.90959 WP_000919178.1.90973 WP_000919178.1.90983 WP_000919178.1.91003 WP_000919178.1.91023 WP_000919178.1.91042 WP_000919178.1.91049 WP_000919178.1.91056 WP_000919178.1.91067 WP_000919178.1.91069 WP_000919178.1.91107 WP_000919178.1.91156 WP_000919178.1.91164 WP_000919178.1.91179 WP_000919178.1.91189 WP_000919178.1.91205 WP_000919178.1.91215 WP_000919178.1.91239 WP_000919178.1.91278 WP_000919178.1.91282 WP_000919178.1.91291 WP_000919178.1.9131 WP_000919178.1.91312 WP_000919178.1.91313 WP_000919178.1.91331 WP_000919178.1.91334 WP_000919178.1.9135 WP_000919178.1.9137 WP_000919178.1.91372 WP_000919178.1.91405 WP_000919178.1.91424 WP_000919178.1.91453 WP_000919178.1.91459 WP_000919178.1.91470 WP_000919178.1.91473 WP_000919178.1.91474 WP_000919178.1.91493 WP_000919178.1.91505 WP_000919178.1.91506 WP_000919178.1.91512 WP_000919178.1.91524 WP_000919178.1.91528 WP_000919178.1.91557 WP_000919178.1.91564 WP_000919178.1.91579 WP_000919178.1.91580 WP_000919178.1.91597 WP_000919178.1.91625 WP_000919178.1.91628 WP_000919178.1.91655 WP_000919178.1.9166 WP_000919178.1.91702 WP_000919178.1.91715 WP_000919178.1.91724 WP_000919178.1.91736 WP_000919178.1.91742 WP_000919178.1.91772 WP_000919178.1.91776 WP_000919178.1.91788 WP_000919178.1.91795 WP_000919178.1.91806 WP_000919178.1.91864 WP_000919178.1.9187 WP_000919178.1.91870 WP_000919178.1.91880 WP_000919178.1.91898 WP_000919178.1.91903 WP_000919178.1.91904 WP_000919178.1.91914 WP_000919178.1.91974 WP_000919178.1.91984 WP_000919178.1.92013 WP_000919178.1.92018 WP_000919178.1.92039 WP_000919178.1.92044 WP_000919178.1.92047 WP_000919178.1.92060 WP_000919178.1.92067 WP_000919178.1.92068 WP_000919178.1.92082 WP_000919178.1.92087 WP_000919178.1.92093 WP_000919178.1.92098 WP_000919178.1.92099 WP_000919178.1.92108 WP_000919178.1.92122 WP_000919178.1.92129 WP_000919178.1.92149 WP_000919178.1.92156 WP_000919178.1.92165 WP_000919178.1.92171 WP_000919178.1.92172 WP_000919178.1.92183 WP_000919178.1.92208 WP_000919178.1.92213 WP_000919178.1.9222 WP_000919178.1.92240 WP_000919178.1.92243 WP_000919178.1.92268 WP_000919178.1.92270 WP_000919178.1.92299 WP_000919178.1.92310 WP_000919178.1.92318 WP_000919178.1.92327 WP_000919178.1.92375 WP_000919178.1.92394 WP_000919178.1.92399 WP_000919178.1.92408 WP_000919178.1.92411 WP_000919178.1.92439 WP_000919178.1.92443 WP_000919178.1.92452 WP_000919178.1.92470 WP_000919178.1.92477 WP_000919178.1.92482 WP_000919178.1.92529 WP_000919178.1.9253 WP_000919178.1.92531 WP_000919178.1.92545 WP_000919178.1.92557 WP_000919178.1.92562 WP_000919178.1.92570 WP_000919178.1.92575 WP_000919178.1.92588 WP_000919178.1.926 WP_000919178.1.92628 WP_000919178.1.92633 WP_000919178.1.92646 WP_000919178.1.92649 WP_000919178.1.92659 WP_000919178.1.92669 WP_000919178.1.92671 WP_000919178.1.92676 WP_000919178.1.92705 WP_000919178.1.9271 WP_000919178.1.92729 WP_000919178.1.92734 WP_000919178.1.92738 WP_000919178.1.92754 WP_000919178.1.92758 WP_000919178.1.92786 WP_000919178.1.92806 WP_000919178.1.92810 WP_000919178.1.92823 WP_000919178.1.92827 WP_000919178.1.92832 WP_000919178.1.92842 WP_000919178.1.92875 WP_000919178.1.92879 WP_000919178.1.92883 WP_000919178.1.92890 WP_000919178.1.92893 WP_000919178.1.92895 WP_000919178.1.92926 WP_000919178.1.92929 WP_000919178.1.92936 WP_000919178.1.92939 WP_000919178.1.92947 WP_000919178.1.92975 WP_000919178.1.92987 WP_000919178.1.92988 WP_000919178.1.93007 WP_000919178.1.93022 WP_000919178.1.93061 WP_000919178.1.93076 WP_000919178.1.93086 WP_000919178.1.93101 WP_000919178.1.93103 WP_000919178.1.93105 WP_000919178.1.93111 WP_000919178.1.93118 WP_000919178.1.93121 WP_000919178.1.93136 WP_000919178.1.93155 WP_000919178.1.93168 WP_000919178.1.93184 WP_000919178.1.93215 WP_000919178.1.93221 WP_000919178.1.93223 WP_000919178.1.93239 WP_000919178.1.93275 WP_000919178.1.93302 WP_000919178.1.93350 WP_000919178.1.9336 WP_000919178.1.93365 WP_000919178.1.93376 WP_000919178.1.93387 WP_000919178.1.93410 WP_000919178.1.93469 WP_000919178.1.93511 WP_000919178.1.93512 WP_000919178.1.93524 WP_000919178.1.93543 WP_000919178.1.93577 WP_000919178.1.93596 WP_000919178.1.93604 WP_000919178.1.93635 WP_000919178.1.93650 WP_000919178.1.93656 WP_000919178.1.93657 WP_000919178.1.93662 WP_000919178.1.93671 WP_000919178.1.93691 WP_000919178.1.937 WP_000919178.1.93705 WP_000919178.1.9374 WP_000919178.1.93741 WP_000919178.1.9375 WP_000919178.1.93754 WP_000919178.1.93761 WP_000919178.1.93780 WP_000919178.1.9380 WP_000919178.1.93803 WP_000919178.1.93804 WP_000919178.1.93809 WP_000919178.1.93828 WP_000919178.1.93837 WP_000919178.1.93842 WP_000919178.1.93843 WP_000919178.1.93875 WP_000919178.1.9389 WP_000919178.1.93909 WP_000919178.1.93919 WP_000919178.1.93937 WP_000919178.1.93938 WP_000919178.1.93956 WP_000919178.1.93984 WP_000919178.1.93986 WP_000919178.1.9399 WP_000919178.1.93994 WP_000919178.1.94017 WP_000919178.1.94039 WP_000919178.1.94056 WP_000919178.1.94064 WP_000919178.1.94070 WP_000919178.1.94071 WP_000919178.1.94072 WP_000919178.1.94079 WP_000919178.1.94097 WP_000919178.1.94107 WP_000919178.1.94132 WP_000919178.1.94142 WP_000919178.1.94162 WP_000919178.1.94167 WP_000919178.1.94168 WP_000919178.1.94181 WP_000919178.1.94198 WP_000919178.1.94215 WP_000919178.1.94303 WP_000919178.1.9432 WP_000919178.1.94352 WP_000919178.1.94354 WP_000919178.1.94365 WP_000919178.1.94379 WP_000919178.1.94380 WP_000919178.1.94383 WP_000919178.1.94390 WP_000919178.1.9440 WP_000919178.1.94412 WP_000919178.1.94415 WP_000919178.1.94458 WP_000919178.1.94473 WP_000919178.1.94492 WP_000919178.1.94510 WP_000919178.1.94527 WP_000919178.1.94557 WP_000919178.1.94562 WP_000919178.1.94565 WP_000919178.1.94573 WP_000919178.1.94579 WP_000919178.1.94584 WP_000919178.1.94586 WP_000919178.1.94588 WP_000919178.1.94593 WP_000919178.1.94598 WP_000919178.1.94622 WP_000919178.1.9463 WP_000919178.1.94649 WP_000919178.1.94650 WP_000919178.1.94655 WP_000919178.1.94659 WP_000919178.1.94662 WP_000919178.1.94669 WP_000919178.1.94670 WP_000919178.1.94674 WP_000919178.1.94700 WP_000919178.1.94717 WP_000919178.1.94722 WP_000919178.1.94745 WP_000919178.1.94782 WP_000919178.1.94785 WP_000919178.1.9481 WP_000919178.1.94815 WP_000919178.1.94817 WP_000919178.1.94820 WP_000919178.1.94835 WP_000919178.1.94849 WP_000919178.1.94850 WP_000919178.1.94851 WP_000919178.1.94862 WP_000919178.1.94864 WP_000919178.1.94947 WP_000919178.1.94952 WP_000919178.1.94959 WP_000919178.1.94967 WP_000919178.1.94971 WP_000919178.1.94982 WP_000919178.1.94983 WP_000919178.1.94987 WP_000919178.1.95006 WP_000919178.1.9503 WP_000919178.1.95051 WP_000919178.1.95055 WP_000919178.1.95076 WP_000919178.1.95085 WP_000919178.1.95094 WP_000919178.1.95099 WP_000919178.1.95121 WP_000919178.1.95133 WP_000919178.1.95136 WP_000919178.1.95152 WP_000919178.1.9516 WP_000919178.1.95165 WP_000919178.1.95171 WP_000919178.1.95235 WP_000919178.1.95239 WP_000919178.1.95246 WP_000919178.1.95248 WP_000919178.1.95249 WP_000919178.1.9525 WP_000919178.1.95255 WP_000919178.1.95265 WP_000919178.1.9527 WP_000919178.1.95277 WP_000919178.1.95282 WP_000919178.1.95298 WP_000919178.1.9530 WP_000919178.1.95320 WP_000919178.1.95338 WP_000919178.1.95388 WP_000919178.1.95404 WP_000919178.1.95412 WP_000919178.1.95434 WP_000919178.1.95447 WP_000919178.1.95456 WP_000919178.1.95465 WP_000919178.1.95530 WP_000919178.1.95546 WP_000919178.1.95547 WP_000919178.1.95558 WP_000919178.1.95579 WP_000919178.1.95590 WP_000919178.1.95607 WP_000919178.1.95623 WP_000919178.1.95625 WP_000919178.1.95630 WP_000919178.1.95641 WP_000919178.1.95656 WP_000919178.1.95670 WP_000919178.1.95675 WP_000919178.1.95701 WP_000919178.1.95703 WP_000919178.1.95716 WP_000919178.1.95729 WP_000919178.1.9574 WP_000919178.1.95744 WP_000919178.1.95757 WP_000919178.1.95776 WP_000919178.1.95803 WP_000919178.1.95805 WP_000919178.1.95826 WP_000919178.1.95840 WP_000919178.1.9586 WP_000919178.1.95866 WP_000919178.1.95884 WP_000919178.1.95890 WP_000919178.1.95901 WP_000919178.1.95906 WP_000919178.1.95911 WP_000919178.1.95939 WP_000919178.1.95940 WP_000919178.1.95963 WP_000919178.1.96025 WP_000919178.1.96042 WP_000919178.1.96044 WP_000919178.1.96045 WP_000919178.1.96054 WP_000919178.1.9609 WP_000919178.1.96094 WP_000919178.1.96107 WP_000919178.1.96127 WP_000919178.1.96139 WP_000919178.1.96141 WP_000919178.1.96144 WP_000919178.1.96162 WP_000919178.1.96172 WP_000919178.1.96188 WP_000919178.1.96190 WP_000919178.1.96206 WP_000919178.1.96211 WP_000919178.1.96212 WP_000919178.1.9624 WP_000919178.1.96260 WP_000919178.1.9628 WP_000919178.1.96317 WP_000919178.1.96319 WP_000919178.1.9633 WP_000919178.1.96335 WP_000919178.1.96340 WP_000919178.1.96343 WP_000919178.1.96348 WP_000919178.1.96349 WP_000919178.1.96359 WP_000919178.1.96380 WP_000919178.1.96429 WP_000919178.1.9644 WP_000919178.1.96469 WP_000919178.1.96490 WP_000919178.1.96497 WP_000919178.1.96500 WP_000919178.1.96521 WP_000919178.1.96533 WP_000919178.1.96537 WP_000919178.1.96539 WP_000919178.1.96552 WP_000919178.1.96555 WP_000919178.1.96563 WP_000919178.1.96584 WP_000919178.1.96588 WP_000919178.1.96590 WP_000919178.1.96600 WP_000919178.1.96610 WP_000919178.1.96625 WP_000919178.1.96635 WP_000919178.1.9664 WP_000919178.1.96640 WP_000919178.1.96642 WP_000919178.1.96662 WP_000919178.1.96675 WP_000919178.1.9670 WP_000919178.1.96731 WP_000919178.1.96732 WP_000919178.1.96735 WP_000919178.1.9674 WP_000919178.1.96750 WP_000919178.1.96758 WP_000919178.1.96771 WP_000919178.1.96792 WP_000919178.1.96798 WP_000919178.1.96801 WP_000919178.1.96803 WP_000919178.1.96810 WP_000919178.1.9686 WP_000919178.1.96876 WP_000919178.1.96890 WP_000919178.1.96917 WP_000919178.1.96925 WP_000919178.1.96938 WP_000919178.1.96946 WP_000919178.1.96957 WP_000919178.1.96978 WP_000919178.1.96993 WP_000919178.1.97015 WP_000919178.1.97026 WP_000919178.1.97028 WP_000919178.1.97079 WP_000919178.1.97089 WP_000919178.1.97103 WP_000919178.1.97143 WP_000919178.1.97145 WP_000919178.1.97154 WP_000919178.1.97184 WP_000919178.1.97190 WP_000919178.1.97224 WP_000919178.1.97260 WP_000919178.1.97287 WP_000919178.1.97291 WP_000919178.1.97297 WP_000919178.1.97318 WP_000919178.1.97322 WP_000919178.1.97328 WP_000919178.1.97337 WP_000919178.1.97368 WP_000919178.1.97369 WP_000919178.1.97386 WP_000919178.1.97413 WP_000919178.1.97422 WP_000919178.1.97441 WP_000919178.1.97477 WP_000919178.1.97480 WP_000919178.1.97497 WP_000919178.1.97505 WP_000919178.1.97534 WP_000919178.1.97547 WP_000919178.1.97594 WP_000919178.1.97597 WP_000919178.1.97599 WP_000919178.1.97606 WP_000919178.1.97613 WP_000919178.1.97615 WP_000919178.1.97620 WP_000919178.1.97626 WP_000919178.1.97628 WP_000919178.1.97640 WP_000919178.1.97646 WP_000919178.1.97648 WP_000919178.1.97656 WP_000919178.1.97690 WP_000919178.1.97691 WP_000919178.1.97693 WP_000919178.1.97704 WP_000919178.1.97725 WP_000919178.1.97726 WP_000919178.1.97727 WP_000919178.1.97732 WP_000919178.1.97736 WP_000919178.1.9774 WP_000919178.1.9775 WP_000919178.1.97768 WP_000919178.1.97772 WP_000919178.1.97800 WP_000919178.1.97819 WP_000919178.1.97840 WP_000919178.1.97846 WP_000919178.1.97873 WP_000919178.1.97907 WP_000919178.1.9793 WP_000919178.1.97938 WP_000919178.1.97981 WP_000919178.1.97983 WP_000919178.1.97986 WP_000919178.1.9799 WP_000919178.1.97991 WP_000919178.1.98006 WP_000919178.1.98019 WP_000919178.1.98022 WP_000919178.1.98036 WP_000919178.1.9805 WP_000919178.1.98080 WP_000919178.1.98086 WP_000919178.1.98107 WP_000919178.1.98110 WP_000919178.1.98119 WP_000919178.1.98124 WP_000919178.1.98146 WP_000919178.1.98158 WP_000919178.1.98170 WP_000919178.1.98201 WP_000919178.1.98219 WP_000919178.1.98236 WP_000919178.1.98263 WP_000919178.1.98314 WP_000919178.1.98338 WP_000919178.1.98392 WP_000919178.1.98402 WP_000919178.1.9841 WP_000919178.1.98418 WP_000919178.1.98440 WP_000919178.1.98448 WP_000919178.1.98457 WP_000919178.1.98472 WP_000919178.1.98483 WP_000919178.1.98495 WP_000919178.1.9850 WP_000919178.1.98502 WP_000919178.1.98513 WP_000919178.1.98531 WP_000919178.1.98570 WP_000919178.1.98577 WP_000919178.1.98607 WP_000919178.1.98608 WP_000919178.1.98627 WP_000919178.1.9863 WP_000919178.1.98676 WP_000919178.1.98677 WP_000919178.1.98726 WP_000919178.1.98731 WP_000919178.1.98751 WP_000919178.1.98760 WP_000919178.1.98762 WP_000919178.1.98763 WP_000919178.1.9877 WP_000919178.1.98779 WP_000919178.1.98801 WP_000919178.1.98818 WP_000919178.1.98843 WP_000919178.1.9887 WP_000919178.1.98899 WP_000919178.1.98931 WP_000919178.1.9898 WP_000919178.1.9899 WP_000919178.1.99057 WP_000919178.1.99071 WP_000919178.1.99072 WP_000919178.1.99073 WP_000919178.1.99083 WP_000919178.1.99097 WP_000919178.1.99098 WP_000919178.1.99107 WP_000919178.1.99163 WP_000919178.1.99164 WP_000919178.1.99184 WP_000919178.1.9919 WP_000919178.1.99197 WP_000919178.1.99198 WP_000919178.1.99215 WP_000919178.1.99219 WP_000919178.1.99255 WP_000919178.1.99267 WP_000919178.1.99276 WP_000919178.1.99278 WP_000919178.1.99327 WP_000919178.1.99335 WP_000919178.1.99339 WP_000919178.1.99350 WP_000919178.1.99360 WP_000919178.1.99363 WP_000919178.1.99369 WP_000919178.1.99370 WP_000919178.1.99388 WP_000919178.1.99397 WP_000919178.1.99426 WP_000919178.1.99456 WP_000919178.1.99463 WP_000919178.1.99469 WP_000919178.1.99483 WP_000919178.1.99490 WP_000919178.1.99493 WP_000919178.1.99531 WP_000919178.1.9954 WP_000919178.1.99546 WP_000919178.1.99561 WP_000919178.1.99577 WP_000919178.1.99579 WP_000919178.1.99595 WP_000919178.1.99613 WP_000919178.1.99630 WP_000919178.1.99637 WP_000919178.1.99646 WP_000919178.1.99657 WP_000919178.1.99660 WP_000919178.1.99671 WP_000919178.1.99676 WP_000919178.1.99712 WP_000919178.1.99725 WP_000919178.1.99747 WP_000919178.1.99764 WP_000919178.1.99783 WP_000919178.1.99813 WP_000919178.1.99824 WP_000919178.1.99829 WP_000919178.1.99837 WP_000919178.1.99841 WP_000919178.1.99858 WP_000919178.1.99889 WP_000919178.1.9992 WP_000919178.1.99924 WP_000919178.1.99958 WP_000919178.1.99961 WP_000919178.1.99996 gi|378954107|ref|YP_005211594.1| gi|16761468|ref|NP_457085.1| gi|378989935|ref|YP_005253099.1| gi|194445772|ref|YP_002041817.1| gi|378700456|ref|YP_005182413.1| 209261.t0301 220341.STY2802 272994.SPAB_00375 295319.SPA0311 321314.SC2549 423368.SNSL254_A2755 439851.SeD_A2930 454166.SeAg_B2710 454169.SeHA_C2817 550537.SEN2535 550538.SG2592 554290.SSPA0293 99287.STM2555 gi|550901979|ref|YP_008671071.1| gi|563654005|ref|YP_008862081.1| gi|197361502|ref|YP_002141138.1| gi|62181119|ref|YP_217536.1| gi|386592360|ref|YP_006088760.1| gi|528820377|ref|YP_008361580.1| gi|197250880|ref|YP_002147510.1| gi|525829443|ref|YP_008252548.1| gi|549725202|ref|YP_008645392.1| ABAK02000001|CDS_2100632-2099379 ABAM02000001|CDS_3152728-3151475 ABAN01000002|CDS_64434-65687 ABAO01000016|CDS_23683-22430 ABEH02000006|CDS_220872-222125 ABEI01000009|CDS_167481-166228 ABEL01000007|CDS_161458-160205 ABFF01000012|CDS_84589-85842 ABFG01000004|CDS_46226-47479 ABFH02000001|CDS_2443420-2444673 AE006468|CDS_2694934-2693681 AE014613|CDS_345815-347068 AE017220|CDS_2715541-2714288 AL513382|CDS_2659034-2657781 AM933172|CDS_2695697-2694444 AM933173|CDS_2686512-2685259 CP000026|CDS_351730-352983 CP000886|CDS_348209-349462 CP001113|CDS_2694984-2693731 CP001120|CDS_2751622-2750369 CP001138|CDS_2655353-2654100 CP001144|CDS_2822475-2821222 CP001363|CDS_2746487-2745234 FM200053|CDS_351764-353017 FN424405|CDS_2719314-2718061 gi|378985116|ref|YP_005248271.1| gi|56412567|ref|YP_149642.1| gi|525837388|ref|YP_008254198.1| gi|526221066|ref|YP_008266798.1| gi|549480156|ref|YP_008614325.1| gi|537435673|ref|YP_008480050.1| gi|482904366|ref|YP_007902926.1| gi|194450912|ref|YP_002046616.1| gi|207857963|ref|YP_002244614.1| gi|525946513|ref|YP_008307697.1| gi|488652859|ref|YP_007924662.1| gi|378451301|ref|YP_005238660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]