SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482904378|ref|YP_007902938.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482904378|ref|YP_007902938.1|
Domain Number 1 Region: 18-172
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 4.08e-104
Family Deoxycytidylate deaminase-like 0.00000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|482904378|ref|YP_007902938.1|
Sequence length 183
Comment tRNA-specific adenosine deaminase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MPPAFITGVTSLSDVELDHEYWMRHALTLAKRAWDEREVPVGAVLVHNHRVIGEGWNRPI
GRHDPTAHAEIMALRQGGLVLQNYRLLDTTLYVTLEPCVMCAGAMVHSRIGRVVFGARDA
KTGAAGSLIDVLHHPGMNHRVEIIEGVLRDECATLLSDFFRMRRQEIKALKKADRAEGAG
PAV
Download sequence
Identical sequences A0A0F6B4Y8 A0A0H3NED6 A0A0M0QUY1 A0A0M2IXB3 A0A265B9E3 A0A2C6FLH4 A0A2D3AEV0 A0A2D3TT58 A0A2H9YE30 A0A2I6P193 A0A2J5WA88 C0PYI0 E8XHE6 G5LCU6 Q57LE3
gi|378700468|ref|YP_005182425.1| gi|526221076|ref|YP_008266810.1| gi|550901991|ref|YP_008671083.1| 3ocq_A gi|378451316|ref|YP_005238675.1| gi|525829433|ref|YP_008252536.1| gi|62181133|ref|YP_217550.1| gi|29140823|ref|NP_804165.1| gi|482904378|ref|YP_007902938.1| gi|525818465|ref|YP_008248483.1| gi|378989948|ref|YP_005253112.1| gi|379701800|ref|YP_005243528.1| gi|549725215|ref|YP_008645405.1| gi|378445984|ref|YP_005233616.1| 209261.t0289 220341.STY2814 321314.SC2563 476213.SPC_1081 99287.STM2568 gi|383497255|ref|YP_005397944.1| gi|525837378|ref|YP_008254186.1| gi|16765888|ref|NP_461503.1| gi|224582890|ref|YP_002636688.1| AE006468|CDS_2714543-2713992 AE014613|CDS_326219-326770 AE017220|CDS_2735005-2734454 AL513382|CDS_2678630-2678079 CP000857|CDS_1120945-1121496 CP001363|CDS_2766096-2765545 FN424405|CDS_2738923-2738372 NP_457097.1.84458 NP_461503.1.58477 WP_001134566.1.100002 WP_001134566.1.100008 WP_001134566.1.100010 WP_001134566.1.100036 WP_001134566.1.100079 WP_001134566.1.100165 WP_001134566.1.100196 WP_001134566.1.100234 WP_001134566.1.100284 WP_001134566.1.100313 WP_001134566.1.100314 WP_001134566.1.100321 WP_001134566.1.100354 WP_001134566.1.100376 WP_001134566.1.100413 WP_001134566.1.100421 WP_001134566.1.100424 WP_001134566.1.100436 WP_001134566.1.100446 WP_001134566.1.100450 WP_001134566.1.100472 WP_001134566.1.100484 WP_001134566.1.100488 WP_001134566.1.100521 WP_001134566.1.100584 WP_001134566.1.100592 WP_001134566.1.100597 WP_001134566.1.100610 WP_001134566.1.100650 WP_001134566.1.100730 WP_001134566.1.100732 WP_001134566.1.100733 WP_001134566.1.100739 WP_001134566.1.10076 WP_001134566.1.100764 WP_001134566.1.100781 WP_001134566.1.100793 WP_001134566.1.100799 WP_001134566.1.100869 WP_001134566.1.100871 WP_001134566.1.100882 WP_001134566.1.100941 WP_001134566.1.100953 WP_001134566.1.101007 WP_001134566.1.101011 WP_001134566.1.101020 WP_001134566.1.101074 WP_001134566.1.101078 WP_001134566.1.10108 WP_001134566.1.101091 WP_001134566.1.101123 WP_001134566.1.101180 WP_001134566.1.101226 WP_001134566.1.10124 WP_001134566.1.101259 WP_001134566.1.101271 WP_001134566.1.101284 WP_001134566.1.101291 WP_001134566.1.1013 WP_001134566.1.101312 WP_001134566.1.101322 WP_001134566.1.101353 WP_001134566.1.101374 WP_001134566.1.101386 WP_001134566.1.101404 WP_001134566.1.101420 WP_001134566.1.101520 WP_001134566.1.101589 WP_001134566.1.101616 WP_001134566.1.101707 WP_001134566.1.101734 WP_001134566.1.101740 WP_001134566.1.101741 WP_001134566.1.101878 WP_001134566.1.101890 WP_001134566.1.101941 WP_001134566.1.101953 WP_001134566.1.102050 WP_001134566.1.102087 WP_001134566.1.10220 WP_001134566.1.10231 WP_001134566.1.10237 WP_001134566.1.10266 WP_001134566.1.10338 WP_001134566.1.1038 WP_001134566.1.104 WP_001134566.1.10401 WP_001134566.1.10428 WP_001134566.1.10429 WP_001134566.1.10439 WP_001134566.1.10459 WP_001134566.1.10463 WP_001134566.1.10475 WP_001134566.1.10511 WP_001134566.1.10514 WP_001134566.1.10530 WP_001134566.1.10532 WP_001134566.1.10547 WP_001134566.1.10566 WP_001134566.1.10568 WP_001134566.1.10595 WP_001134566.1.10642 WP_001134566.1.10654 WP_001134566.1.10677 WP_001134566.1.10678 WP_001134566.1.10753 WP_001134566.1.10857 WP_001134566.1.10873 WP_001134566.1.10926 WP_001134566.1.10936 WP_001134566.1.10992 WP_001134566.1.11012 WP_001134566.1.11024 WP_001134566.1.11031 WP_001134566.1.11055 WP_001134566.1.11098 WP_001134566.1.1110 WP_001134566.1.11126 WP_001134566.1.11142 WP_001134566.1.11156 WP_001134566.1.11168 WP_001134566.1.11190 WP_001134566.1.11239 WP_001134566.1.11253 WP_001134566.1.11254 WP_001134566.1.11295 WP_001134566.1.11304 WP_001134566.1.11314 WP_001134566.1.11362 WP_001134566.1.11385 WP_001134566.1.11405 WP_001134566.1.1142 WP_001134566.1.11426 WP_001134566.1.11429 WP_001134566.1.11455 WP_001134566.1.11458 WP_001134566.1.11518 WP_001134566.1.11532 WP_001134566.1.11543 WP_001134566.1.11544 WP_001134566.1.11557 WP_001134566.1.11567 WP_001134566.1.11588 WP_001134566.1.11638 WP_001134566.1.11677 WP_001134566.1.11687 WP_001134566.1.11735 WP_001134566.1.11763 WP_001134566.1.11772 WP_001134566.1.11834 WP_001134566.1.11875 WP_001134566.1.11883 WP_001134566.1.11897 WP_001134566.1.11908 WP_001134566.1.11914 WP_001134566.1.12017 WP_001134566.1.12040 WP_001134566.1.12061 WP_001134566.1.1207 WP_001134566.1.12114 WP_001134566.1.12141 WP_001134566.1.12160 WP_001134566.1.12172 WP_001134566.1.12192 WP_001134566.1.1224 WP_001134566.1.12280 WP_001134566.1.12351 WP_001134566.1.12364 WP_001134566.1.12370 WP_001134566.1.12397 WP_001134566.1.12398 WP_001134566.1.12441 WP_001134566.1.12456 WP_001134566.1.12546 WP_001134566.1.12581 WP_001134566.1.12620 WP_001134566.1.1264 WP_001134566.1.12648 WP_001134566.1.12683 WP_001134566.1.12726 WP_001134566.1.12727 WP_001134566.1.12728 WP_001134566.1.12741 WP_001134566.1.12834 WP_001134566.1.12879 WP_001134566.1.12936 WP_001134566.1.12995 WP_001134566.1.13027 WP_001134566.1.13106 WP_001134566.1.13108 WP_001134566.1.13130 WP_001134566.1.13161 WP_001134566.1.13207 WP_001134566.1.1321 WP_001134566.1.13268 WP_001134566.1.13291 WP_001134566.1.133 WP_001134566.1.13314 WP_001134566.1.13338 WP_001134566.1.13342 WP_001134566.1.13352 WP_001134566.1.13406 WP_001134566.1.13414 WP_001134566.1.13440 WP_001134566.1.13443 WP_001134566.1.13476 WP_001134566.1.13488 WP_001134566.1.13509 WP_001134566.1.13599 WP_001134566.1.13661 WP_001134566.1.13669 WP_001134566.1.13686 WP_001134566.1.1372 WP_001134566.1.13732 WP_001134566.1.13741 WP_001134566.1.13819 WP_001134566.1.1382 WP_001134566.1.1387 WP_001134566.1.13908 WP_001134566.1.13932 WP_001134566.1.13968 WP_001134566.1.1397 WP_001134566.1.13972 WP_001134566.1.140 WP_001134566.1.14001 WP_001134566.1.1401 WP_001134566.1.1408 WP_001134566.1.14089 WP_001134566.1.14099 WP_001134566.1.14111 WP_001134566.1.14120 WP_001134566.1.14123 WP_001134566.1.14150 WP_001134566.1.14151 WP_001134566.1.14191 WP_001134566.1.14197 WP_001134566.1.14239 WP_001134566.1.14280 WP_001134566.1.14320 WP_001134566.1.14333 WP_001134566.1.14379 WP_001134566.1.14399 WP_001134566.1.14406 WP_001134566.1.14410 WP_001134566.1.14436 WP_001134566.1.14444 WP_001134566.1.14458 WP_001134566.1.14466 WP_001134566.1.14467 WP_001134566.1.14474 WP_001134566.1.14500 WP_001134566.1.14505 WP_001134566.1.14524 WP_001134566.1.14526 WP_001134566.1.14550 WP_001134566.1.14554 WP_001134566.1.14575 WP_001134566.1.14618 WP_001134566.1.14701 WP_001134566.1.14703 WP_001134566.1.14706 WP_001134566.1.14719 WP_001134566.1.14725 WP_001134566.1.1473 WP_001134566.1.14765 WP_001134566.1.14789 WP_001134566.1.14810 WP_001134566.1.14852 WP_001134566.1.14877 WP_001134566.1.1489 WP_001134566.1.14894 WP_001134566.1.14930 WP_001134566.1.14932 WP_001134566.1.14947 WP_001134566.1.14948 WP_001134566.1.15046 WP_001134566.1.15055 WP_001134566.1.15079 WP_001134566.1.15102 WP_001134566.1.15124 WP_001134566.1.15184 WP_001134566.1.15223 WP_001134566.1.15226 WP_001134566.1.15244 WP_001134566.1.15265 WP_001134566.1.15316 WP_001134566.1.15362 WP_001134566.1.15369 WP_001134566.1.1540 WP_001134566.1.15415 WP_001134566.1.15423 WP_001134566.1.15433 WP_001134566.1.15439 WP_001134566.1.15468 WP_001134566.1.15487 WP_001134566.1.15508 WP_001134566.1.15535 WP_001134566.1.15581 WP_001134566.1.15597 WP_001134566.1.15612 WP_001134566.1.15637 WP_001134566.1.15644 WP_001134566.1.15710 WP_001134566.1.15717 WP_001134566.1.15784 WP_001134566.1.158 WP_001134566.1.15830 WP_001134566.1.15862 WP_001134566.1.15881 WP_001134566.1.15905 WP_001134566.1.15909 WP_001134566.1.15910 WP_001134566.1.15912 WP_001134566.1.15970 WP_001134566.1.15986 WP_001134566.1.16004 WP_001134566.1.16006 WP_001134566.1.16046 WP_001134566.1.16047 WP_001134566.1.16051 WP_001134566.1.16058 WP_001134566.1.16062 WP_001134566.1.16063 WP_001134566.1.16103 WP_001134566.1.16150 WP_001134566.1.16155 WP_001134566.1.16166 WP_001134566.1.16172 WP_001134566.1.16226 WP_001134566.1.16233 WP_001134566.1.1626 WP_001134566.1.16264 WP_001134566.1.16273 WP_001134566.1.16284 WP_001134566.1.16328 WP_001134566.1.16331 WP_001134566.1.16344 WP_001134566.1.1635 WP_001134566.1.16361 WP_001134566.1.16452 WP_001134566.1.16461 WP_001134566.1.16462 WP_001134566.1.16465 WP_001134566.1.16468 WP_001134566.1.16522 WP_001134566.1.16525 WP_001134566.1.16588 WP_001134566.1.16614 WP_001134566.1.16650 WP_001134566.1.16658 WP_001134566.1.16666 WP_001134566.1.16673 WP_001134566.1.16686 WP_001134566.1.16691 WP_001134566.1.16732 WP_001134566.1.16735 WP_001134566.1.1674 WP_001134566.1.16767 WP_001134566.1.16781 WP_001134566.1.16786 WP_001134566.1.16858 WP_001134566.1.16873 WP_001134566.1.16879 WP_001134566.1.1689 WP_001134566.1.16893 WP_001134566.1.16896 WP_001134566.1.16903 WP_001134566.1.16905 WP_001134566.1.16916 WP_001134566.1.16944 WP_001134566.1.16948 WP_001134566.1.16965 WP_001134566.1.1700 WP_001134566.1.17049 WP_001134566.1.17058 WP_001134566.1.17078 WP_001134566.1.17093 WP_001134566.1.17098 WP_001134566.1.17202 WP_001134566.1.17219 WP_001134566.1.1722 WP_001134566.1.17302 WP_001134566.1.17307 WP_001134566.1.17308 WP_001134566.1.17368 WP_001134566.1.1737 WP_001134566.1.174 WP_001134566.1.17405 WP_001134566.1.17406 WP_001134566.1.17447 WP_001134566.1.17480 WP_001134566.1.17513 WP_001134566.1.17543 WP_001134566.1.17546 WP_001134566.1.17563 WP_001134566.1.17578 WP_001134566.1.17622 WP_001134566.1.17659 WP_001134566.1.17667 WP_001134566.1.17686 WP_001134566.1.17693 WP_001134566.1.17702 WP_001134566.1.17705 WP_001134566.1.17741 WP_001134566.1.17743 WP_001134566.1.17755 WP_001134566.1.17758 WP_001134566.1.17840 WP_001134566.1.17865 WP_001134566.1.17891 WP_001134566.1.17956 WP_001134566.1.1798 WP_001134566.1.18005 WP_001134566.1.1801 WP_001134566.1.18019 WP_001134566.1.18021 WP_001134566.1.1807 WP_001134566.1.18099 WP_001134566.1.18111 WP_001134566.1.18122 WP_001134566.1.18124 WP_001134566.1.18144 WP_001134566.1.18163 WP_001134566.1.18173 WP_001134566.1.1818 WP_001134566.1.18254 WP_001134566.1.18265 WP_001134566.1.18267 WP_001134566.1.18270 WP_001134566.1.18280 WP_001134566.1.18328 WP_001134566.1.18358 WP_001134566.1.18370 WP_001134566.1.18406 WP_001134566.1.18468 WP_001134566.1.18474 WP_001134566.1.18513 WP_001134566.1.18607 WP_001134566.1.18610 WP_001134566.1.18678 WP_001134566.1.18705 WP_001134566.1.18715 WP_001134566.1.18722 WP_001134566.1.18766 WP_001134566.1.18776 WP_001134566.1.1880 WP_001134566.1.18822 WP_001134566.1.1885 WP_001134566.1.18860 WP_001134566.1.18881 WP_001134566.1.18922 WP_001134566.1.18940 WP_001134566.1.18949 WP_001134566.1.18959 WP_001134566.1.19001 WP_001134566.1.19006 WP_001134566.1.19044 WP_001134566.1.19053 WP_001134566.1.19055 WP_001134566.1.19084 WP_001134566.1.19187 WP_001134566.1.19228 WP_001134566.1.19240 WP_001134566.1.19273 WP_001134566.1.19288 WP_001134566.1.19300 WP_001134566.1.19320 WP_001134566.1.19422 WP_001134566.1.19454 WP_001134566.1.19456 WP_001134566.1.19458 WP_001134566.1.19460 WP_001134566.1.19461 WP_001134566.1.19496 WP_001134566.1.19535 WP_001134566.1.19538 WP_001134566.1.19588 WP_001134566.1.19589 WP_001134566.1.19614 WP_001134566.1.19616 WP_001134566.1.19660 WP_001134566.1.19663 WP_001134566.1.19686 WP_001134566.1.19702 WP_001134566.1.19706 WP_001134566.1.19724 WP_001134566.1.19749 WP_001134566.1.19784 WP_001134566.1.19793 WP_001134566.1.19794 WP_001134566.1.19802 WP_001134566.1.19809 WP_001134566.1.19823 WP_001134566.1.19867 WP_001134566.1.1992 WP_001134566.1.19975 WP_001134566.1.1998 WP_001134566.1.19999 WP_001134566.1.20 WP_001134566.1.2010 WP_001134566.1.20119 WP_001134566.1.20212 WP_001134566.1.20254 WP_001134566.1.20255 WP_001134566.1.20266 WP_001134566.1.20271 WP_001134566.1.20296 WP_001134566.1.20339 WP_001134566.1.20362 WP_001134566.1.20376 WP_001134566.1.20418 WP_001134566.1.20419 WP_001134566.1.20443 WP_001134566.1.20446 WP_001134566.1.20465 WP_001134566.1.20492 WP_001134566.1.20503 WP_001134566.1.20525 WP_001134566.1.2053 WP_001134566.1.2054 WP_001134566.1.20553 WP_001134566.1.20573 WP_001134566.1.20614 WP_001134566.1.20626 WP_001134566.1.20635 WP_001134566.1.20646 WP_001134566.1.20718 WP_001134566.1.2073 WP_001134566.1.20740 WP_001134566.1.20789 WP_001134566.1.20828 WP_001134566.1.2087 WP_001134566.1.20883 WP_001134566.1.20886 WP_001134566.1.20908 WP_001134566.1.20947 WP_001134566.1.20953 WP_001134566.1.2101 WP_001134566.1.21010 WP_001134566.1.21049 WP_001134566.1.2106 WP_001134566.1.21062 WP_001134566.1.21086 WP_001134566.1.21136 WP_001134566.1.21144 WP_001134566.1.21146 WP_001134566.1.21162 WP_001134566.1.21165 WP_001134566.1.21184 WP_001134566.1.21185 WP_001134566.1.21245 WP_001134566.1.21246 WP_001134566.1.21269 WP_001134566.1.21351 WP_001134566.1.21366 WP_001134566.1.21400 WP_001134566.1.21492 WP_001134566.1.21497 WP_001134566.1.21499 WP_001134566.1.21603 WP_001134566.1.2166 WP_001134566.1.21674 WP_001134566.1.21750 WP_001134566.1.21751 WP_001134566.1.21757 WP_001134566.1.21792 WP_001134566.1.21825 WP_001134566.1.21946 WP_001134566.1.21991 WP_001134566.1.22024 WP_001134566.1.2205 WP_001134566.1.22062 WP_001134566.1.22064 WP_001134566.1.22067 WP_001134566.1.22118 WP_001134566.1.22126 WP_001134566.1.2216 WP_001134566.1.22208 WP_001134566.1.2221 WP_001134566.1.22235 WP_001134566.1.2227 WP_001134566.1.22270 WP_001134566.1.22315 WP_001134566.1.2235 WP_001134566.1.22373 WP_001134566.1.22379 WP_001134566.1.22427 WP_001134566.1.22453 WP_001134566.1.2246 WP_001134566.1.22476 WP_001134566.1.22485 WP_001134566.1.22514 WP_001134566.1.22575 WP_001134566.1.22582 WP_001134566.1.22604 WP_001134566.1.22614 WP_001134566.1.22620 WP_001134566.1.22652 WP_001134566.1.22683 WP_001134566.1.22692 WP_001134566.1.22758 WP_001134566.1.2284 WP_001134566.1.22870 WP_001134566.1.22895 WP_001134566.1.22926 WP_001134566.1.22943 WP_001134566.1.22967 WP_001134566.1.22979 WP_001134566.1.23010 WP_001134566.1.23040 WP_001134566.1.23058 WP_001134566.1.23102 WP_001134566.1.23114 WP_001134566.1.2314 WP_001134566.1.23169 WP_001134566.1.23192 WP_001134566.1.23218 WP_001134566.1.23259 WP_001134566.1.23309 WP_001134566.1.2331 WP_001134566.1.2332 WP_001134566.1.23340 WP_001134566.1.2336 WP_001134566.1.23365 WP_001134566.1.23379 WP_001134566.1.23412 WP_001134566.1.23426 WP_001134566.1.23460 WP_001134566.1.23472 WP_001134566.1.23482 WP_001134566.1.23485 WP_001134566.1.23492 WP_001134566.1.23509 WP_001134566.1.23513 WP_001134566.1.23515 WP_001134566.1.23548 WP_001134566.1.23571 WP_001134566.1.23587 WP_001134566.1.23604 WP_001134566.1.23621 WP_001134566.1.23629 WP_001134566.1.23634 WP_001134566.1.2364 WP_001134566.1.23670 WP_001134566.1.23679 WP_001134566.1.23728 WP_001134566.1.2375 WP_001134566.1.23783 WP_001134566.1.23786 WP_001134566.1.23787 WP_001134566.1.23801 WP_001134566.1.23932 WP_001134566.1.23959 WP_001134566.1.24017 WP_001134566.1.24028 WP_001134566.1.24061 WP_001134566.1.24082 WP_001134566.1.24083 WP_001134566.1.24117 WP_001134566.1.24125 WP_001134566.1.24138 WP_001134566.1.24153 WP_001134566.1.24158 WP_001134566.1.24206 WP_001134566.1.24291 WP_001134566.1.24308 WP_001134566.1.24322 WP_001134566.1.24355 WP_001134566.1.24375 WP_001134566.1.24400 WP_001134566.1.24420 WP_001134566.1.24444 WP_001134566.1.24567 WP_001134566.1.24578 WP_001134566.1.24619 WP_001134566.1.24643 WP_001134566.1.24688 WP_001134566.1.24716 WP_001134566.1.24737 WP_001134566.1.24779 WP_001134566.1.2481 WP_001134566.1.24832 WP_001134566.1.24873 WP_001134566.1.24964 WP_001134566.1.25008 WP_001134566.1.25015 WP_001134566.1.25017 WP_001134566.1.25032 WP_001134566.1.25036 WP_001134566.1.25041 WP_001134566.1.25053 WP_001134566.1.25072 WP_001134566.1.25119 WP_001134566.1.25140 WP_001134566.1.25185 WP_001134566.1.25196 WP_001134566.1.25210 WP_001134566.1.25219 WP_001134566.1.25304 WP_001134566.1.25374 WP_001134566.1.25405 WP_001134566.1.25454 WP_001134566.1.25475 WP_001134566.1.25490 WP_001134566.1.25493 WP_001134566.1.25498 WP_001134566.1.25508 WP_001134566.1.25512 WP_001134566.1.2554 WP_001134566.1.25603 WP_001134566.1.2562 WP_001134566.1.25666 WP_001134566.1.25668 WP_001134566.1.25690 WP_001134566.1.2570 WP_001134566.1.25740 WP_001134566.1.25793 WP_001134566.1.25807 WP_001134566.1.25814 WP_001134566.1.25821 WP_001134566.1.25833 WP_001134566.1.25835 WP_001134566.1.25882 WP_001134566.1.25911 WP_001134566.1.25962 WP_001134566.1.25963 WP_001134566.1.25988 WP_001134566.1.26001 WP_001134566.1.26027 WP_001134566.1.26093 WP_001134566.1.26107 WP_001134566.1.26129 WP_001134566.1.2615 WP_001134566.1.26217 WP_001134566.1.26224 WP_001134566.1.26230 WP_001134566.1.26232 WP_001134566.1.26269 WP_001134566.1.26272 WP_001134566.1.26282 WP_001134566.1.26286 WP_001134566.1.26288 WP_001134566.1.26311 WP_001134566.1.26319 WP_001134566.1.26363 WP_001134566.1.26394 WP_001134566.1.26429 WP_001134566.1.26440 WP_001134566.1.26491 WP_001134566.1.26493 WP_001134566.1.2654 WP_001134566.1.26551 WP_001134566.1.26554 WP_001134566.1.26567 WP_001134566.1.26636 WP_001134566.1.26646 WP_001134566.1.26689 WP_001134566.1.26709 WP_001134566.1.26741 WP_001134566.1.2679 WP_001134566.1.26856 WP_001134566.1.26908 WP_001134566.1.26919 WP_001134566.1.2692 WP_001134566.1.26928 WP_001134566.1.26980 WP_001134566.1.270 WP_001134566.1.27008 WP_001134566.1.27010 WP_001134566.1.27027 WP_001134566.1.27070 WP_001134566.1.27077 WP_001134566.1.27084 WP_001134566.1.27086 WP_001134566.1.27087 WP_001134566.1.27111 WP_001134566.1.27115 WP_001134566.1.2713 WP_001134566.1.2717 WP_001134566.1.27173 WP_001134566.1.27206 WP_001134566.1.27223 WP_001134566.1.27228 WP_001134566.1.27255 WP_001134566.1.27282 WP_001134566.1.27285 WP_001134566.1.27309 WP_001134566.1.27329 WP_001134566.1.27361 WP_001134566.1.27419 WP_001134566.1.27423 WP_001134566.1.27522 WP_001134566.1.27523 WP_001134566.1.27544 WP_001134566.1.27561 WP_001134566.1.27565 WP_001134566.1.27595 WP_001134566.1.27598 WP_001134566.1.2763 WP_001134566.1.27665 WP_001134566.1.27706 WP_001134566.1.27707 WP_001134566.1.27755 WP_001134566.1.27761 WP_001134566.1.2777 WP_001134566.1.27775 WP_001134566.1.27785 WP_001134566.1.27857 WP_001134566.1.27900 WP_001134566.1.27928 WP_001134566.1.27945 WP_001134566.1.27977 WP_001134566.1.27997 WP_001134566.1.28004 WP_001134566.1.28032 WP_001134566.1.2809 WP_001134566.1.28094 WP_001134566.1.28155 WP_001134566.1.28198 WP_001134566.1.28229 WP_001134566.1.28267 WP_001134566.1.28301 WP_001134566.1.28302 WP_001134566.1.2835 WP_001134566.1.28370 WP_001134566.1.28384 WP_001134566.1.28386 WP_001134566.1.28395 WP_001134566.1.284 WP_001134566.1.2845 WP_001134566.1.28479 WP_001134566.1.28538 WP_001134566.1.28575 WP_001134566.1.28625 WP_001134566.1.28627 WP_001134566.1.28655 WP_001134566.1.28692 WP_001134566.1.28694 WP_001134566.1.2873 WP_001134566.1.2879 WP_001134566.1.2890 WP_001134566.1.28917 WP_001134566.1.28938 WP_001134566.1.28946 WP_001134566.1.28962 WP_001134566.1.29006 WP_001134566.1.29010 WP_001134566.1.29023 WP_001134566.1.29042 WP_001134566.1.2905 WP_001134566.1.2907 WP_001134566.1.29081 WP_001134566.1.29089 WP_001134566.1.2910 WP_001134566.1.29113 WP_001134566.1.29153 WP_001134566.1.29190 WP_001134566.1.29203 WP_001134566.1.29237 WP_001134566.1.29248 WP_001134566.1.29288 WP_001134566.1.29389 WP_001134566.1.29439 WP_001134566.1.2946 WP_001134566.1.29462 WP_001134566.1.29509 WP_001134566.1.29563 WP_001134566.1.29588 WP_001134566.1.29601 WP_001134566.1.29606 WP_001134566.1.29615 WP_001134566.1.29619 WP_001134566.1.29704 WP_001134566.1.29727 WP_001134566.1.29743 WP_001134566.1.29775 WP_001134566.1.29782 WP_001134566.1.29827 WP_001134566.1.29833 WP_001134566.1.29851 WP_001134566.1.29865 WP_001134566.1.29886 WP_001134566.1.29919 WP_001134566.1.29924 WP_001134566.1.2994 WP_001134566.1.29964 WP_001134566.1.29969 WP_001134566.1.29983 WP_001134566.1.29990 WP_001134566.1.30006 WP_001134566.1.30009 WP_001134566.1.30013 WP_001134566.1.3002 WP_001134566.1.30022 WP_001134566.1.30027 WP_001134566.1.30034 WP_001134566.1.30049 WP_001134566.1.30058 WP_001134566.1.30086 WP_001134566.1.30172 WP_001134566.1.30180 WP_001134566.1.30185 WP_001134566.1.30202 WP_001134566.1.30246 WP_001134566.1.30354 WP_001134566.1.30356 WP_001134566.1.30357 WP_001134566.1.30362 WP_001134566.1.3042 WP_001134566.1.30421 WP_001134566.1.30437 WP_001134566.1.30440 WP_001134566.1.30448 WP_001134566.1.30469 WP_001134566.1.30489 WP_001134566.1.30505 WP_001134566.1.30507 WP_001134566.1.30517 WP_001134566.1.30535 WP_001134566.1.30542 WP_001134566.1.30544 WP_001134566.1.30547 WP_001134566.1.30556 WP_001134566.1.30572 WP_001134566.1.30585 WP_001134566.1.30618 WP_001134566.1.30664 WP_001134566.1.30688 WP_001134566.1.30794 WP_001134566.1.3080 WP_001134566.1.30806 WP_001134566.1.30833 WP_001134566.1.30835 WP_001134566.1.30967 WP_001134566.1.30972 WP_001134566.1.31 WP_001134566.1.31046 WP_001134566.1.31066 WP_001134566.1.31078 WP_001134566.1.31092 WP_001134566.1.31122 WP_001134566.1.3113 WP_001134566.1.31139 WP_001134566.1.31145 WP_001134566.1.31182 WP_001134566.1.31185 WP_001134566.1.3119 WP_001134566.1.31190 WP_001134566.1.31195 WP_001134566.1.31196 WP_001134566.1.31205 WP_001134566.1.3121 WP_001134566.1.31223 WP_001134566.1.31251 WP_001134566.1.3127 WP_001134566.1.31281 WP_001134566.1.31303 WP_001134566.1.3131 WP_001134566.1.31352 WP_001134566.1.31362 WP_001134566.1.31389 WP_001134566.1.31413 WP_001134566.1.31446 WP_001134566.1.31451 WP_001134566.1.31504 WP_001134566.1.31515 WP_001134566.1.31533 WP_001134566.1.31578 WP_001134566.1.31658 WP_001134566.1.31725 WP_001134566.1.31782 WP_001134566.1.31799 WP_001134566.1.31836 WP_001134566.1.31940 WP_001134566.1.31951 WP_001134566.1.31967 WP_001134566.1.31972 WP_001134566.1.32041 WP_001134566.1.32042 WP_001134566.1.3207 WP_001134566.1.32189 WP_001134566.1.32192 WP_001134566.1.32202 WP_001134566.1.32206 WP_001134566.1.32260 WP_001134566.1.32263 WP_001134566.1.32293 WP_001134566.1.32299 WP_001134566.1.32422 WP_001134566.1.32425 WP_001134566.1.32434 WP_001134566.1.32438 WP_001134566.1.32458 WP_001134566.1.32460 WP_001134566.1.32493 WP_001134566.1.32515 WP_001134566.1.32529 WP_001134566.1.32563 WP_001134566.1.32578 WP_001134566.1.32617 WP_001134566.1.32660 WP_001134566.1.3270 WP_001134566.1.32702 WP_001134566.1.32714 WP_001134566.1.32725 WP_001134566.1.32750 WP_001134566.1.32786 WP_001134566.1.32804 WP_001134566.1.32838 WP_001134566.1.32848 WP_001134566.1.32868 WP_001134566.1.3290 WP_001134566.1.32900 WP_001134566.1.32907 WP_001134566.1.32940 WP_001134566.1.32941 WP_001134566.1.3296 WP_001134566.1.32966 WP_001134566.1.32985 WP_001134566.1.33030 WP_001134566.1.3305 WP_001134566.1.33051 WP_001134566.1.33065 WP_001134566.1.33122 WP_001134566.1.33127 WP_001134566.1.33143 WP_001134566.1.3315 WP_001134566.1.33160 WP_001134566.1.33208 WP_001134566.1.33214 WP_001134566.1.33247 WP_001134566.1.33248 WP_001134566.1.33261 WP_001134566.1.33280 WP_001134566.1.33283 WP_001134566.1.333 WP_001134566.1.33313 WP_001134566.1.33339 WP_001134566.1.33382 WP_001134566.1.33392 WP_001134566.1.33490 WP_001134566.1.33492 WP_001134566.1.33499 WP_001134566.1.33501 WP_001134566.1.33529 WP_001134566.1.33553 WP_001134566.1.33580 WP_001134566.1.33592 WP_001134566.1.33659 WP_001134566.1.33689 WP_001134566.1.3370 WP_001134566.1.33730 WP_001134566.1.33741 WP_001134566.1.33840 WP_001134566.1.33894 WP_001134566.1.3392 WP_001134566.1.33926 WP_001134566.1.3394 WP_001134566.1.33957 WP_001134566.1.33969 WP_001134566.1.34001 WP_001134566.1.34043 WP_001134566.1.34059 WP_001134566.1.34075 WP_001134566.1.34118 WP_001134566.1.34211 WP_001134566.1.34214 WP_001134566.1.34234 WP_001134566.1.34257 WP_001134566.1.34259 WP_001134566.1.34279 WP_001134566.1.34284 WP_001134566.1.34319 WP_001134566.1.34330 WP_001134566.1.34376 WP_001134566.1.34382 WP_001134566.1.34417 WP_001134566.1.34453 WP_001134566.1.34484 WP_001134566.1.34496 WP_001134566.1.34517 WP_001134566.1.34530 WP_001134566.1.34610 WP_001134566.1.34665 WP_001134566.1.34694 WP_001134566.1.34751 WP_001134566.1.3476 WP_001134566.1.34808 WP_001134566.1.34824 WP_001134566.1.34834 WP_001134566.1.34856 WP_001134566.1.3489 WP_001134566.1.34932 WP_001134566.1.34962 WP_001134566.1.34975 WP_001134566.1.35001 WP_001134566.1.35040 WP_001134566.1.35045 WP_001134566.1.35074 WP_001134566.1.35129 WP_001134566.1.35175 WP_001134566.1.35184 WP_001134566.1.35193 WP_001134566.1.35240 WP_001134566.1.35274 WP_001134566.1.35404 WP_001134566.1.35408 WP_001134566.1.35425 WP_001134566.1.35446 WP_001134566.1.35460 WP_001134566.1.35463 WP_001134566.1.35503 WP_001134566.1.35509 WP_001134566.1.35532 WP_001134566.1.35560 WP_001134566.1.3557 WP_001134566.1.35590 WP_001134566.1.35628 WP_001134566.1.35648 WP_001134566.1.3566 WP_001134566.1.3570 WP_001134566.1.35712 WP_001134566.1.35713 WP_001134566.1.35736 WP_001134566.1.35791 WP_001134566.1.35795 WP_001134566.1.35870 WP_001134566.1.35892 WP_001134566.1.35916 WP_001134566.1.35938 WP_001134566.1.35940 WP_001134566.1.35966 WP_001134566.1.36000 WP_001134566.1.36003 WP_001134566.1.3601 WP_001134566.1.36017 WP_001134566.1.36034 WP_001134566.1.36036 WP_001134566.1.36069 WP_001134566.1.36232 WP_001134566.1.36291 WP_001134566.1.36298 WP_001134566.1.36308 WP_001134566.1.36323 WP_001134566.1.36343 WP_001134566.1.36460 WP_001134566.1.3649 WP_001134566.1.36495 WP_001134566.1.36526 WP_001134566.1.36547 WP_001134566.1.36567 WP_001134566.1.36579 WP_001134566.1.36609 WP_001134566.1.36617 WP_001134566.1.36618 WP_001134566.1.36643 WP_001134566.1.36663 WP_001134566.1.36690 WP_001134566.1.3670 WP_001134566.1.36701 WP_001134566.1.36705 WP_001134566.1.36725 WP_001134566.1.36779 WP_001134566.1.36798 WP_001134566.1.36802 WP_001134566.1.36821 WP_001134566.1.36853 WP_001134566.1.36918 WP_001134566.1.36931 WP_001134566.1.36948 WP_001134566.1.36950 WP_001134566.1.37013 WP_001134566.1.37014 WP_001134566.1.37073 WP_001134566.1.37111 WP_001134566.1.37112 WP_001134566.1.37133 WP_001134566.1.37176 WP_001134566.1.37190 WP_001134566.1.37199 WP_001134566.1.37200 WP_001134566.1.37256 WP_001134566.1.37258 WP_001134566.1.37293 WP_001134566.1.37303 WP_001134566.1.37370 WP_001134566.1.37376 WP_001134566.1.3744 WP_001134566.1.37498 WP_001134566.1.37504 WP_001134566.1.37513 WP_001134566.1.37584 WP_001134566.1.37590 WP_001134566.1.37593 WP_001134566.1.37600 WP_001134566.1.37610 WP_001134566.1.37613 WP_001134566.1.37618 WP_001134566.1.37659 WP_001134566.1.37662 WP_001134566.1.37675 WP_001134566.1.37691 WP_001134566.1.37761 WP_001134566.1.37775 WP_001134566.1.37777 WP_001134566.1.378 WP_001134566.1.37848 WP_001134566.1.379 WP_001134566.1.37911 WP_001134566.1.37941 WP_001134566.1.37968 WP_001134566.1.37978 WP_001134566.1.37985 WP_001134566.1.38061 WP_001134566.1.38064 WP_001134566.1.38108 WP_001134566.1.38125 WP_001134566.1.38145 WP_001134566.1.3816 WP_001134566.1.38207 WP_001134566.1.38261 WP_001134566.1.38266 WP_001134566.1.38273 WP_001134566.1.383 WP_001134566.1.38310 WP_001134566.1.3834 WP_001134566.1.38341 WP_001134566.1.38351 WP_001134566.1.3838 WP_001134566.1.38381 WP_001134566.1.38393 WP_001134566.1.38408 WP_001134566.1.38440 WP_001134566.1.3848 WP_001134566.1.38486 WP_001134566.1.38515 WP_001134566.1.38569 WP_001134566.1.38595 WP_001134566.1.3860 WP_001134566.1.38613 WP_001134566.1.38642 WP_001134566.1.38673 WP_001134566.1.38693 WP_001134566.1.38734 WP_001134566.1.38773 WP_001134566.1.38781 WP_001134566.1.38877 WP_001134566.1.38882 WP_001134566.1.38913 WP_001134566.1.38983 WP_001134566.1.38996 WP_001134566.1.39003 WP_001134566.1.39056 WP_001134566.1.3907 WP_001134566.1.39105 WP_001134566.1.39113 WP_001134566.1.39136 WP_001134566.1.3914 WP_001134566.1.39147 WP_001134566.1.39161 WP_001134566.1.39197 WP_001134566.1.39210 WP_001134566.1.39229 WP_001134566.1.39235 WP_001134566.1.39265 WP_001134566.1.3931 WP_001134566.1.39385 WP_001134566.1.39405 WP_001134566.1.39420 WP_001134566.1.39435 WP_001134566.1.39449 WP_001134566.1.39466 WP_001134566.1.39471 WP_001134566.1.39502 WP_001134566.1.39512 WP_001134566.1.39530 WP_001134566.1.39576 WP_001134566.1.39584 WP_001134566.1.39619 WP_001134566.1.39620 WP_001134566.1.39624 WP_001134566.1.39629 WP_001134566.1.39659 WP_001134566.1.39667 WP_001134566.1.39722 WP_001134566.1.39723 WP_001134566.1.39724 WP_001134566.1.39763 WP_001134566.1.39775 WP_001134566.1.39862 WP_001134566.1.39879 WP_001134566.1.39890 WP_001134566.1.39921 WP_001134566.1.39923 WP_001134566.1.39941 WP_001134566.1.39945 WP_001134566.1.39947 WP_001134566.1.40017 WP_001134566.1.40072 WP_001134566.1.40073 WP_001134566.1.40095 WP_001134566.1.40097 WP_001134566.1.401 WP_001134566.1.4011 WP_001134566.1.40111 WP_001134566.1.40155 WP_001134566.1.40160 WP_001134566.1.40167 WP_001134566.1.40171 WP_001134566.1.40208 WP_001134566.1.40240 WP_001134566.1.40257 WP_001134566.1.40279 WP_001134566.1.40292 WP_001134566.1.40305 WP_001134566.1.40311 WP_001134566.1.40341 WP_001134566.1.40361 WP_001134566.1.40380 WP_001134566.1.40395 WP_001134566.1.4042 WP_001134566.1.40465 WP_001134566.1.40467 WP_001134566.1.40496 WP_001134566.1.40517 WP_001134566.1.40528 WP_001134566.1.40648 WP_001134566.1.40698 WP_001134566.1.40710 WP_001134566.1.4075 WP_001134566.1.40750 WP_001134566.1.40763 WP_001134566.1.40854 WP_001134566.1.4087 WP_001134566.1.40877 WP_001134566.1.4089 WP_001134566.1.40924 WP_001134566.1.40932 WP_001134566.1.40946 WP_001134566.1.40979 WP_001134566.1.40996 WP_001134566.1.41004 WP_001134566.1.41017 WP_001134566.1.41018 WP_001134566.1.4106 WP_001134566.1.41070 WP_001134566.1.41074 WP_001134566.1.41075 WP_001134566.1.41086 WP_001134566.1.41091 WP_001134566.1.41097 WP_001134566.1.41132 WP_001134566.1.41176 WP_001134566.1.41225 WP_001134566.1.41226 WP_001134566.1.41251 WP_001134566.1.41258 WP_001134566.1.41279 WP_001134566.1.41305 WP_001134566.1.41310 WP_001134566.1.41321 WP_001134566.1.41333 WP_001134566.1.41335 WP_001134566.1.4136 WP_001134566.1.41375 WP_001134566.1.41415 WP_001134566.1.41440 WP_001134566.1.41459 WP_001134566.1.41498 WP_001134566.1.41516 WP_001134566.1.41519 WP_001134566.1.41524 WP_001134566.1.41554 WP_001134566.1.41572 WP_001134566.1.41591 WP_001134566.1.41631 WP_001134566.1.41658 WP_001134566.1.41659 WP_001134566.1.41662 WP_001134566.1.41708 WP_001134566.1.41716 WP_001134566.1.41724 WP_001134566.1.41746 WP_001134566.1.41761 WP_001134566.1.4178 WP_001134566.1.41824 WP_001134566.1.41825 WP_001134566.1.41836 WP_001134566.1.41862 WP_001134566.1.41882 WP_001134566.1.41894 WP_001134566.1.41919 WP_001134566.1.41929 WP_001134566.1.41931 WP_001134566.1.4194 WP_001134566.1.41979 WP_001134566.1.41985 WP_001134566.1.42069 WP_001134566.1.42081 WP_001134566.1.42090 WP_001134566.1.42104 WP_001134566.1.42111 WP_001134566.1.42156 WP_001134566.1.42187 WP_001134566.1.42200 WP_001134566.1.42219 WP_001134566.1.4222 WP_001134566.1.42243 WP_001134566.1.42248 WP_001134566.1.42257 WP_001134566.1.42261 WP_001134566.1.42320 WP_001134566.1.42342 WP_001134566.1.42349 WP_001134566.1.42364 WP_001134566.1.42371 WP_001134566.1.42379 WP_001134566.1.42391 WP_001134566.1.42399 WP_001134566.1.42422 WP_001134566.1.42444 WP_001134566.1.42539 WP_001134566.1.42603 WP_001134566.1.42605 WP_001134566.1.42650 WP_001134566.1.4267 WP_001134566.1.42676 WP_001134566.1.42685 WP_001134566.1.42701 WP_001134566.1.42707 WP_001134566.1.4276 WP_001134566.1.42767 WP_001134566.1.42805 WP_001134566.1.42815 WP_001134566.1.42859 WP_001134566.1.42864 WP_001134566.1.4288 WP_001134566.1.4289 WP_001134566.1.42923 WP_001134566.1.4298 WP_001134566.1.43008 WP_001134566.1.43016 WP_001134566.1.43018 WP_001134566.1.43019 WP_001134566.1.43041 WP_001134566.1.43065 WP_001134566.1.43068 WP_001134566.1.43069 WP_001134566.1.43077 WP_001134566.1.43086 WP_001134566.1.43128 WP_001134566.1.43141 WP_001134566.1.43157 WP_001134566.1.43160 WP_001134566.1.43161 WP_001134566.1.43190 WP_001134566.1.43198 WP_001134566.1.43244 WP_001134566.1.4326 WP_001134566.1.43290 WP_001134566.1.43292 WP_001134566.1.43307 WP_001134566.1.43312 WP_001134566.1.43334 WP_001134566.1.43339 WP_001134566.1.43371 WP_001134566.1.43437 WP_001134566.1.43438 WP_001134566.1.43476 WP_001134566.1.43513 WP_001134566.1.43522 WP_001134566.1.43613 WP_001134566.1.43633 WP_001134566.1.43637 WP_001134566.1.43651 WP_001134566.1.43668 WP_001134566.1.43710 WP_001134566.1.43722 WP_001134566.1.43778 WP_001134566.1.43782 WP_001134566.1.43801 WP_001134566.1.43812 WP_001134566.1.43878 WP_001134566.1.43886 WP_001134566.1.43888 WP_001134566.1.43919 WP_001134566.1.43951 WP_001134566.1.43974 WP_001134566.1.44005 WP_001134566.1.4404 WP_001134566.1.44043 WP_001134566.1.44049 WP_001134566.1.44099 WP_001134566.1.44101 WP_001134566.1.44121 WP_001134566.1.44160 WP_001134566.1.44180 WP_001134566.1.44196 WP_001134566.1.44248 WP_001134566.1.44262 WP_001134566.1.44268 WP_001134566.1.4427 WP_001134566.1.44291 WP_001134566.1.44296 WP_001134566.1.44300 WP_001134566.1.44310 WP_001134566.1.44343 WP_001134566.1.44351 WP_001134566.1.44360 WP_001134566.1.44386 WP_001134566.1.44416 WP_001134566.1.44431 WP_001134566.1.44433 WP_001134566.1.44437 WP_001134566.1.44438 WP_001134566.1.44443 WP_001134566.1.44479 WP_001134566.1.44546 WP_001134566.1.44607 WP_001134566.1.44633 WP_001134566.1.44640 WP_001134566.1.4467 WP_001134566.1.44678 WP_001134566.1.4468 WP_001134566.1.44747 WP_001134566.1.44762 WP_001134566.1.44791 WP_001134566.1.44815 WP_001134566.1.44828 WP_001134566.1.44833 WP_001134566.1.4485 WP_001134566.1.44877 WP_001134566.1.44879 WP_001134566.1.44917 WP_001134566.1.44927 WP_001134566.1.44933 WP_001134566.1.44943 WP_001134566.1.44950 WP_001134566.1.4501 WP_001134566.1.45067 WP_001134566.1.45072 WP_001134566.1.45074 WP_001134566.1.45079 WP_001134566.1.45093 WP_001134566.1.45098 WP_001134566.1.45136 WP_001134566.1.45138 WP_001134566.1.45145 WP_001134566.1.45177 WP_001134566.1.45241 WP_001134566.1.45259 WP_001134566.1.45349 WP_001134566.1.45351 WP_001134566.1.45365 WP_001134566.1.45434 WP_001134566.1.45435 WP_001134566.1.45522 WP_001134566.1.45523 WP_001134566.1.45535 WP_001134566.1.45550 WP_001134566.1.45582 WP_001134566.1.45585 WP_001134566.1.45596 WP_001134566.1.45622 WP_001134566.1.45648 WP_001134566.1.45660 WP_001134566.1.45690 WP_001134566.1.458 WP_001134566.1.45829 WP_001134566.1.45848 WP_001134566.1.45871 WP_001134566.1.46011 WP_001134566.1.46030 WP_001134566.1.46069 WP_001134566.1.46077 WP_001134566.1.46091 WP_001134566.1.46124 WP_001134566.1.46169 WP_001134566.1.46173 WP_001134566.1.46174 WP_001134566.1.46187 WP_001134566.1.46203 WP_001134566.1.46225 WP_001134566.1.46241 WP_001134566.1.46278 WP_001134566.1.46303 WP_001134566.1.46307 WP_001134566.1.46322 WP_001134566.1.46355 WP_001134566.1.464 WP_001134566.1.46406 WP_001134566.1.46434 WP_001134566.1.46444 WP_001134566.1.46454 WP_001134566.1.46461 WP_001134566.1.46504 WP_001134566.1.46505 WP_001134566.1.46551 WP_001134566.1.46559 WP_001134566.1.46595 WP_001134566.1.46675 WP_001134566.1.46701 WP_001134566.1.4671 WP_001134566.1.46730 WP_001134566.1.46732 WP_001134566.1.46781 WP_001134566.1.46816 WP_001134566.1.46842 WP_001134566.1.4690 WP_001134566.1.46920 WP_001134566.1.46945 WP_001134566.1.47008 WP_001134566.1.47036 WP_001134566.1.47037 WP_001134566.1.47042 WP_001134566.1.47057 WP_001134566.1.47059 WP_001134566.1.47067 WP_001134566.1.47085 WP_001134566.1.47123 WP_001134566.1.47214 WP_001134566.1.47215 WP_001134566.1.47245 WP_001134566.1.47257 WP_001134566.1.47429 WP_001134566.1.47448 WP_001134566.1.4747 WP_001134566.1.47472 WP_001134566.1.47478 WP_001134566.1.47523 WP_001134566.1.47531 WP_001134566.1.47532 WP_001134566.1.47579 WP_001134566.1.47605 WP_001134566.1.47621 WP_001134566.1.47630 WP_001134566.1.4769 WP_001134566.1.47714 WP_001134566.1.4774 WP_001134566.1.47756 WP_001134566.1.47799 WP_001134566.1.4781 WP_001134566.1.47849 WP_001134566.1.47886 WP_001134566.1.47898 WP_001134566.1.47928 WP_001134566.1.48019 WP_001134566.1.48100 WP_001134566.1.48114 WP_001134566.1.48139 WP_001134566.1.48190 WP_001134566.1.48242 WP_001134566.1.48244 WP_001134566.1.48253 WP_001134566.1.48292 WP_001134566.1.483 WP_001134566.1.48324 WP_001134566.1.48367 WP_001134566.1.48377 WP_001134566.1.48399 WP_001134566.1.48426 WP_001134566.1.48430 WP_001134566.1.48436 WP_001134566.1.48455 WP_001134566.1.48493 WP_001134566.1.4853 WP_001134566.1.48586 WP_001134566.1.4859 WP_001134566.1.48591 WP_001134566.1.48610 WP_001134566.1.48631 WP_001134566.1.48651 WP_001134566.1.48663 WP_001134566.1.48690 WP_001134566.1.48734 WP_001134566.1.48756 WP_001134566.1.48778 WP_001134566.1.48788 WP_001134566.1.48849 WP_001134566.1.4885 WP_001134566.1.48876 WP_001134566.1.48894 WP_001134566.1.48896 WP_001134566.1.48919 WP_001134566.1.48955 WP_001134566.1.48963 WP_001134566.1.48973 WP_001134566.1.49004 WP_001134566.1.49084 WP_001134566.1.49106 WP_001134566.1.49113 WP_001134566.1.49117 WP_001134566.1.49121 WP_001134566.1.4914 WP_001134566.1.49140 WP_001134566.1.49153 WP_001134566.1.49155 WP_001134566.1.49166 WP_001134566.1.49175 WP_001134566.1.49204 WP_001134566.1.49239 WP_001134566.1.49256 WP_001134566.1.49276 WP_001134566.1.49290 WP_001134566.1.49340 WP_001134566.1.49355 WP_001134566.1.49366 WP_001134566.1.49429 WP_001134566.1.49434 WP_001134566.1.49450 WP_001134566.1.49490 WP_001134566.1.495 WP_001134566.1.49515 WP_001134566.1.49545 WP_001134566.1.49572 WP_001134566.1.49595 WP_001134566.1.49626 WP_001134566.1.49630 WP_001134566.1.49686 WP_001134566.1.49703 WP_001134566.1.49769 WP_001134566.1.4979 WP_001134566.1.49803 WP_001134566.1.49805 WP_001134566.1.49827 WP_001134566.1.49846 WP_001134566.1.4991 WP_001134566.1.49929 WP_001134566.1.49947 WP_001134566.1.49959 WP_001134566.1.49997 WP_001134566.1.50003 WP_001134566.1.50014 WP_001134566.1.50030 WP_001134566.1.50043 WP_001134566.1.50080 WP_001134566.1.5009 WP_001134566.1.50103 WP_001134566.1.50158 WP_001134566.1.50161 WP_001134566.1.50211 WP_001134566.1.50239 WP_001134566.1.50247 WP_001134566.1.50285 WP_001134566.1.50308 WP_001134566.1.50309 WP_001134566.1.50374 WP_001134566.1.50376 WP_001134566.1.50387 WP_001134566.1.50389 WP_001134566.1.50404 WP_001134566.1.50406 WP_001134566.1.50468 WP_001134566.1.50497 WP_001134566.1.5051 WP_001134566.1.50566 WP_001134566.1.50570 WP_001134566.1.50626 WP_001134566.1.50676 WP_001134566.1.50726 WP_001134566.1.50771 WP_001134566.1.50777 WP_001134566.1.50804 WP_001134566.1.50808 WP_001134566.1.50875 WP_001134566.1.5088 WP_001134566.1.50885 WP_001134566.1.509 WP_001134566.1.50908 WP_001134566.1.50918 WP_001134566.1.50929 WP_001134566.1.50941 WP_001134566.1.50970 WP_001134566.1.50999 WP_001134566.1.51014 WP_001134566.1.51022 WP_001134566.1.51025 WP_001134566.1.51040 WP_001134566.1.51048 WP_001134566.1.51066 WP_001134566.1.51100 WP_001134566.1.51134 WP_001134566.1.51179 WP_001134566.1.51182 WP_001134566.1.51186 WP_001134566.1.51224 WP_001134566.1.51227 WP_001134566.1.5127 WP_001134566.1.51305 WP_001134566.1.51308 WP_001134566.1.51315 WP_001134566.1.5136 WP_001134566.1.5138 WP_001134566.1.51414 WP_001134566.1.51474 WP_001134566.1.51487 WP_001134566.1.51488 WP_001134566.1.51514 WP_001134566.1.51519 WP_001134566.1.51598 WP_001134566.1.51613 WP_001134566.1.51634 WP_001134566.1.51649 WP_001134566.1.51686 WP_001134566.1.51700 WP_001134566.1.51724 WP_001134566.1.51734 WP_001134566.1.51756 WP_001134566.1.51831 WP_001134566.1.51838 WP_001134566.1.51863 WP_001134566.1.51888 WP_001134566.1.51911 WP_001134566.1.51932 WP_001134566.1.51935 WP_001134566.1.51989 WP_001134566.1.52057 WP_001134566.1.52114 WP_001134566.1.52121 WP_001134566.1.52123 WP_001134566.1.52129 WP_001134566.1.52156 WP_001134566.1.5216 WP_001134566.1.52161 WP_001134566.1.52170 WP_001134566.1.52191 WP_001134566.1.52202 WP_001134566.1.52209 WP_001134566.1.52336 WP_001134566.1.52339 WP_001134566.1.52346 WP_001134566.1.52353 WP_001134566.1.52361 WP_001134566.1.52446 WP_001134566.1.52469 WP_001134566.1.52528 WP_001134566.1.52571 WP_001134566.1.526 WP_001134566.1.52637 WP_001134566.1.52647 WP_001134566.1.52653 WP_001134566.1.52656 WP_001134566.1.52692 WP_001134566.1.52738 WP_001134566.1.52742 WP_001134566.1.52743 WP_001134566.1.52748 WP_001134566.1.52773 WP_001134566.1.52795 WP_001134566.1.52807 WP_001134566.1.52857 WP_001134566.1.52866 WP_001134566.1.52887 WP_001134566.1.52898 WP_001134566.1.52915 WP_001134566.1.52949 WP_001134566.1.52985 WP_001134566.1.53141 WP_001134566.1.53151 WP_001134566.1.53154 WP_001134566.1.53159 WP_001134566.1.5316 WP_001134566.1.53190 WP_001134566.1.53210 WP_001134566.1.53233 WP_001134566.1.53272 WP_001134566.1.53307 WP_001134566.1.53321 WP_001134566.1.53368 WP_001134566.1.53375 WP_001134566.1.53406 WP_001134566.1.53450 WP_001134566.1.53454 WP_001134566.1.53466 WP_001134566.1.5349 WP_001134566.1.53529 WP_001134566.1.53534 WP_001134566.1.53540 WP_001134566.1.53543 WP_001134566.1.53555 WP_001134566.1.53559 WP_001134566.1.5356 WP_001134566.1.53571 WP_001134566.1.5358 WP_001134566.1.53692 WP_001134566.1.53694 WP_001134566.1.53723 WP_001134566.1.5374 WP_001134566.1.53750 WP_001134566.1.53757 WP_001134566.1.53790 WP_001134566.1.53800 WP_001134566.1.53812 WP_001134566.1.53815 WP_001134566.1.53839 WP_001134566.1.53892 WP_001134566.1.53898 WP_001134566.1.53902 WP_001134566.1.53905 WP_001134566.1.53958 WP_001134566.1.53981 WP_001134566.1.53984 WP_001134566.1.54033 WP_001134566.1.54075 WP_001134566.1.54085 WP_001134566.1.54132 WP_001134566.1.54170 WP_001134566.1.54175 WP_001134566.1.54196 WP_001134566.1.54203 WP_001134566.1.54209 WP_001134566.1.54259 WP_001134566.1.54271 WP_001134566.1.54274 WP_001134566.1.5430 WP_001134566.1.54319 WP_001134566.1.54324 WP_001134566.1.54364 WP_001134566.1.54371 WP_001134566.1.54400 WP_001134566.1.54431 WP_001134566.1.54442 WP_001134566.1.54482 WP_001134566.1.54526 WP_001134566.1.54589 WP_001134566.1.54644 WP_001134566.1.54662 WP_001134566.1.54667 WP_001134566.1.54678 WP_001134566.1.54681 WP_001134566.1.54694 WP_001134566.1.54722 WP_001134566.1.54748 WP_001134566.1.54749 WP_001134566.1.54764 WP_001134566.1.5481 WP_001134566.1.54827 WP_001134566.1.54865 WP_001134566.1.54935 WP_001134566.1.54979 WP_001134566.1.55008 WP_001134566.1.55010 WP_001134566.1.55034 WP_001134566.1.55152 WP_001134566.1.55156 WP_001134566.1.55163 WP_001134566.1.55165 WP_001134566.1.55215 WP_001134566.1.55223 WP_001134566.1.5523 WP_001134566.1.5527 WP_001134566.1.55285 WP_001134566.1.55290 WP_001134566.1.55310 WP_001134566.1.55317 WP_001134566.1.55325 WP_001134566.1.55379 WP_001134566.1.5539 WP_001134566.1.55418 WP_001134566.1.55430 WP_001134566.1.55468 WP_001134566.1.55475 WP_001134566.1.55477 WP_001134566.1.55496 WP_001134566.1.55506 WP_001134566.1.5552 WP_001134566.1.55528 WP_001134566.1.55545 WP_001134566.1.5555 WP_001134566.1.5560 WP_001134566.1.55604 WP_001134566.1.55639 WP_001134566.1.55647 WP_001134566.1.55699 WP_001134566.1.55706 WP_001134566.1.55718 WP_001134566.1.55743 WP_001134566.1.55768 WP_001134566.1.55780 WP_001134566.1.55782 WP_001134566.1.55796 WP_001134566.1.55967 WP_001134566.1.55973 WP_001134566.1.55995 WP_001134566.1.56002 WP_001134566.1.56012 WP_001134566.1.56105 WP_001134566.1.56144 WP_001134566.1.56172 WP_001134566.1.5621 WP_001134566.1.56222 WP_001134566.1.56226 WP_001134566.1.56238 WP_001134566.1.56244 WP_001134566.1.56247 WP_001134566.1.56286 WP_001134566.1.56304 WP_001134566.1.56305 WP_001134566.1.56311 WP_001134566.1.5633 WP_001134566.1.56396 WP_001134566.1.56414 WP_001134566.1.56419 WP_001134566.1.56423 WP_001134566.1.56438 WP_001134566.1.56514 WP_001134566.1.56535 WP_001134566.1.56559 WP_001134566.1.56560 WP_001134566.1.56585 WP_001134566.1.56601 WP_001134566.1.56614 WP_001134566.1.56640 WP_001134566.1.56651 WP_001134566.1.56660 WP_001134566.1.56671 WP_001134566.1.56682 WP_001134566.1.56724 WP_001134566.1.56824 WP_001134566.1.56825 WP_001134566.1.56875 WP_001134566.1.56877 WP_001134566.1.56887 WP_001134566.1.56889 WP_001134566.1.56905 WP_001134566.1.56981 WP_001134566.1.57101 WP_001134566.1.57125 WP_001134566.1.57137 WP_001134566.1.57147 WP_001134566.1.57168 WP_001134566.1.57179 WP_001134566.1.57186 WP_001134566.1.57187 WP_001134566.1.57233 WP_001134566.1.57342 WP_001134566.1.57356 WP_001134566.1.57377 WP_001134566.1.57418 WP_001134566.1.57433 WP_001134566.1.57515 WP_001134566.1.57529 WP_001134566.1.57576 WP_001134566.1.57601 WP_001134566.1.57607 WP_001134566.1.57684 WP_001134566.1.57699 WP_001134566.1.57735 WP_001134566.1.5774 WP_001134566.1.57763 WP_001134566.1.57785 WP_001134566.1.57800 WP_001134566.1.57862 WP_001134566.1.57873 WP_001134566.1.57890 WP_001134566.1.57891 WP_001134566.1.57902 WP_001134566.1.57965 WP_001134566.1.57972 WP_001134566.1.57978 WP_001134566.1.58008 WP_001134566.1.5801 WP_001134566.1.58041 WP_001134566.1.58044 WP_001134566.1.58081 WP_001134566.1.5809 WP_001134566.1.58132 WP_001134566.1.58144 WP_001134566.1.58173 WP_001134566.1.58191 WP_001134566.1.58194 WP_001134566.1.58252 WP_001134566.1.58261 WP_001134566.1.58274 WP_001134566.1.58282 WP_001134566.1.58324 WP_001134566.1.58326 WP_001134566.1.58358 WP_001134566.1.5836 WP_001134566.1.58407 WP_001134566.1.58418 WP_001134566.1.58485 WP_001134566.1.58537 WP_001134566.1.58548 WP_001134566.1.58564 WP_001134566.1.58568 WP_001134566.1.5858 WP_001134566.1.58583 WP_001134566.1.58652 WP_001134566.1.58662 WP_001134566.1.58663 WP_001134566.1.58669 WP_001134566.1.58724 WP_001134566.1.58744 WP_001134566.1.58745 WP_001134566.1.5875 WP_001134566.1.58796 WP_001134566.1.58803 WP_001134566.1.58807 WP_001134566.1.58836 WP_001134566.1.58847 WP_001134566.1.5886 WP_001134566.1.58883 WP_001134566.1.58898 WP_001134566.1.58949 WP_001134566.1.58963 WP_001134566.1.58970 WP_001134566.1.58974 WP_001134566.1.59020 WP_001134566.1.59043 WP_001134566.1.59056 WP_001134566.1.59061 WP_001134566.1.59064 WP_001134566.1.59094 WP_001134566.1.59125 WP_001134566.1.59136 WP_001134566.1.59224 WP_001134566.1.59282 WP_001134566.1.59294 WP_001134566.1.59299 WP_001134566.1.59313 WP_001134566.1.59321 WP_001134566.1.59375 WP_001134566.1.59420 WP_001134566.1.59458 WP_001134566.1.5949 WP_001134566.1.59490 WP_001134566.1.59501 WP_001134566.1.59508 WP_001134566.1.59510 WP_001134566.1.59684 WP_001134566.1.5969 WP_001134566.1.59694 WP_001134566.1.59751 WP_001134566.1.59771 WP_001134566.1.5979 WP_001134566.1.59827 WP_001134566.1.59829 WP_001134566.1.59847 WP_001134566.1.59863 WP_001134566.1.59953 WP_001134566.1.59969 WP_001134566.1.59994 WP_001134566.1.60008 WP_001134566.1.60015 WP_001134566.1.60021 WP_001134566.1.60045 WP_001134566.1.60052 WP_001134566.1.60069 WP_001134566.1.60076 WP_001134566.1.60114 WP_001134566.1.60140 WP_001134566.1.60154 WP_001134566.1.60155 WP_001134566.1.60168 WP_001134566.1.60192 WP_001134566.1.60199 WP_001134566.1.60212 WP_001134566.1.60253 WP_001134566.1.60285 WP_001134566.1.60322 WP_001134566.1.60324 WP_001134566.1.60356 WP_001134566.1.60370 WP_001134566.1.60379 WP_001134566.1.6038 WP_001134566.1.60380 WP_001134566.1.6041 WP_001134566.1.60424 WP_001134566.1.60464 WP_001134566.1.60481 WP_001134566.1.60486 WP_001134566.1.605 WP_001134566.1.60545 WP_001134566.1.60561 WP_001134566.1.6058 WP_001134566.1.60584 WP_001134566.1.6060 WP_001134566.1.60643 WP_001134566.1.60676 WP_001134566.1.60708 WP_001134566.1.60725 WP_001134566.1.60772 WP_001134566.1.60783 WP_001134566.1.60792 WP_001134566.1.60794 WP_001134566.1.60807 WP_001134566.1.60874 WP_001134566.1.60882 WP_001134566.1.60889 WP_001134566.1.60941 WP_001134566.1.60950 WP_001134566.1.6104 WP_001134566.1.61044 WP_001134566.1.61076 WP_001134566.1.61078 WP_001134566.1.61123 WP_001134566.1.6114 WP_001134566.1.61147 WP_001134566.1.61168 WP_001134566.1.61210 WP_001134566.1.61232 WP_001134566.1.6129 WP_001134566.1.61296 WP_001134566.1.61345 WP_001134566.1.61357 WP_001134566.1.61417 WP_001134566.1.61497 WP_001134566.1.61511 WP_001134566.1.61519 WP_001134566.1.61539 WP_001134566.1.61542 WP_001134566.1.61553 WP_001134566.1.61574 WP_001134566.1.61649 WP_001134566.1.61652 WP_001134566.1.61662 WP_001134566.1.61697 WP_001134566.1.61712 WP_001134566.1.61714 WP_001134566.1.61730 WP_001134566.1.61809 WP_001134566.1.61857 WP_001134566.1.61877 WP_001134566.1.61918 WP_001134566.1.61920 WP_001134566.1.61952 WP_001134566.1.62007 WP_001134566.1.62020 WP_001134566.1.62025 WP_001134566.1.6209 WP_001134566.1.6210 WP_001134566.1.62124 WP_001134566.1.62199 WP_001134566.1.62204 WP_001134566.1.62223 WP_001134566.1.62257 WP_001134566.1.62302 WP_001134566.1.62304 WP_001134566.1.62314 WP_001134566.1.62323 WP_001134566.1.62333 WP_001134566.1.62338 WP_001134566.1.62364 WP_001134566.1.62374 WP_001134566.1.62380 WP_001134566.1.62403 WP_001134566.1.62411 WP_001134566.1.62436 WP_001134566.1.62475 WP_001134566.1.6253 WP_001134566.1.62536 WP_001134566.1.62640 WP_001134566.1.62686 WP_001134566.1.62751 WP_001134566.1.62825 WP_001134566.1.62853 WP_001134566.1.62903 WP_001134566.1.62910 WP_001134566.1.62913 WP_001134566.1.62932 WP_001134566.1.62955 WP_001134566.1.62960 WP_001134566.1.63016 WP_001134566.1.63025 WP_001134566.1.63069 WP_001134566.1.63087 WP_001134566.1.63169 WP_001134566.1.63181 WP_001134566.1.63203 WP_001134566.1.63243 WP_001134566.1.63250 WP_001134566.1.63256 WP_001134566.1.63290 WP_001134566.1.63297 WP_001134566.1.63382 WP_001134566.1.63422 WP_001134566.1.63432 WP_001134566.1.63448 WP_001134566.1.63461 WP_001134566.1.63479 WP_001134566.1.63514 WP_001134566.1.63577 WP_001134566.1.63583 WP_001134566.1.63592 WP_001134566.1.63663 WP_001134566.1.63664 WP_001134566.1.63677 WP_001134566.1.63718 WP_001134566.1.63731 WP_001134566.1.63736 WP_001134566.1.6375 WP_001134566.1.63757 WP_001134566.1.63781 WP_001134566.1.63797 WP_001134566.1.63816 WP_001134566.1.63831 WP_001134566.1.63834 WP_001134566.1.6389 WP_001134566.1.63901 WP_001134566.1.63955 WP_001134566.1.63963 WP_001134566.1.64018 WP_001134566.1.64032 WP_001134566.1.64046 WP_001134566.1.64072 WP_001134566.1.64087 WP_001134566.1.6415 WP_001134566.1.64208 WP_001134566.1.64217 WP_001134566.1.6423 WP_001134566.1.64244 WP_001134566.1.64266 WP_001134566.1.64293 WP_001134566.1.64332 WP_001134566.1.6437 WP_001134566.1.64376 WP_001134566.1.64387 WP_001134566.1.644 WP_001134566.1.64403 WP_001134566.1.64471 WP_001134566.1.64501 WP_001134566.1.64538 WP_001134566.1.64632 WP_001134566.1.64645 WP_001134566.1.64648 WP_001134566.1.64649 WP_001134566.1.64654 WP_001134566.1.64662 WP_001134566.1.64663 WP_001134566.1.64667 WP_001134566.1.64674 WP_001134566.1.64702 WP_001134566.1.64709 WP_001134566.1.64710 WP_001134566.1.64744 WP_001134566.1.64757 WP_001134566.1.64763 WP_001134566.1.64781 WP_001134566.1.64817 WP_001134566.1.64831 WP_001134566.1.64847 WP_001134566.1.6487 WP_001134566.1.6489 WP_001134566.1.64891 WP_001134566.1.64894 WP_001134566.1.64974 WP_001134566.1.65018 WP_001134566.1.65028 WP_001134566.1.65054 WP_001134566.1.65075 WP_001134566.1.6514 WP_001134566.1.65163 WP_001134566.1.65168 WP_001134566.1.65171 WP_001134566.1.65172 WP_001134566.1.65185 WP_001134566.1.65191 WP_001134566.1.65200 WP_001134566.1.65211 WP_001134566.1.65218 WP_001134566.1.65226 WP_001134566.1.65238 WP_001134566.1.65248 WP_001134566.1.65249 WP_001134566.1.65266 WP_001134566.1.65269 WP_001134566.1.6535 WP_001134566.1.65395 WP_001134566.1.65459 WP_001134566.1.65463 WP_001134566.1.65474 WP_001134566.1.65487 WP_001134566.1.6549 WP_001134566.1.65499 WP_001134566.1.65508 WP_001134566.1.6554 WP_001134566.1.65633 WP_001134566.1.6565 WP_001134566.1.65650 WP_001134566.1.65696 WP_001134566.1.65697 WP_001134566.1.65699 WP_001134566.1.6572 WP_001134566.1.65737 WP_001134566.1.6575 WP_001134566.1.65755 WP_001134566.1.65782 WP_001134566.1.65795 WP_001134566.1.65812 WP_001134566.1.65846 WP_001134566.1.65863 WP_001134566.1.65876 WP_001134566.1.65940 WP_001134566.1.65956 WP_001134566.1.65985 WP_001134566.1.66021 WP_001134566.1.66031 WP_001134566.1.66049 WP_001134566.1.66052 WP_001134566.1.66064 WP_001134566.1.66109 WP_001134566.1.66129 WP_001134566.1.66145 WP_001134566.1.66183 WP_001134566.1.6620 WP_001134566.1.66216 WP_001134566.1.66234 WP_001134566.1.66235 WP_001134566.1.66270 WP_001134566.1.66273 WP_001134566.1.6630 WP_001134566.1.66314 WP_001134566.1.66324 WP_001134566.1.66330 WP_001134566.1.6634 WP_001134566.1.66358 WP_001134566.1.66361 WP_001134566.1.66362 WP_001134566.1.66365 WP_001134566.1.6638 WP_001134566.1.6640 WP_001134566.1.66480 WP_001134566.1.66506 WP_001134566.1.66630 WP_001134566.1.66665 WP_001134566.1.66678 WP_001134566.1.66681 WP_001134566.1.66684 WP_001134566.1.66698 WP_001134566.1.66755 WP_001134566.1.66759 WP_001134566.1.6680 WP_001134566.1.66801 WP_001134566.1.66834 WP_001134566.1.66860 WP_001134566.1.66901 WP_001134566.1.66953 WP_001134566.1.66955 WP_001134566.1.66962 WP_001134566.1.66981 WP_001134566.1.67024 WP_001134566.1.67037 WP_001134566.1.67042 WP_001134566.1.67045 WP_001134566.1.67100 WP_001134566.1.67101 WP_001134566.1.67143 WP_001134566.1.67181 WP_001134566.1.67201 WP_001134566.1.67211 WP_001134566.1.67235 WP_001134566.1.67237 WP_001134566.1.67268 WP_001134566.1.67336 WP_001134566.1.67339 WP_001134566.1.67347 WP_001134566.1.67387 WP_001134566.1.6739 WP_001134566.1.67394 WP_001134566.1.67397 WP_001134566.1.67403 WP_001134566.1.67430 WP_001134566.1.67442 WP_001134566.1.67465 WP_001134566.1.67539 WP_001134566.1.67552 WP_001134566.1.67556 WP_001134566.1.67576 WP_001134566.1.67604 WP_001134566.1.67619 WP_001134566.1.67625 WP_001134566.1.67627 WP_001134566.1.67641 WP_001134566.1.67657 WP_001134566.1.67673 WP_001134566.1.67682 WP_001134566.1.67700 WP_001134566.1.67718 WP_001134566.1.67729 WP_001134566.1.67774 WP_001134566.1.67820 WP_001134566.1.67829 WP_001134566.1.67887 WP_001134566.1.67905 WP_001134566.1.67910 WP_001134566.1.67924 WP_001134566.1.67954 WP_001134566.1.68 WP_001134566.1.68043 WP_001134566.1.68073 WP_001134566.1.68105 WP_001134566.1.68113 WP_001134566.1.68131 WP_001134566.1.68182 WP_001134566.1.6819 WP_001134566.1.68201 WP_001134566.1.68206 WP_001134566.1.6827 WP_001134566.1.68275 WP_001134566.1.68285 WP_001134566.1.6833 WP_001134566.1.68359 WP_001134566.1.68401 WP_001134566.1.68420 WP_001134566.1.68477 WP_001134566.1.6849 WP_001134566.1.68514 WP_001134566.1.68547 WP_001134566.1.68564 WP_001134566.1.6857 WP_001134566.1.68589 WP_001134566.1.68591 WP_001134566.1.68655 WP_001134566.1.68656 WP_001134566.1.68658 WP_001134566.1.68688 WP_001134566.1.68742 WP_001134566.1.6875 WP_001134566.1.68770 WP_001134566.1.68778 WP_001134566.1.68787 WP_001134566.1.68809 WP_001134566.1.68818 WP_001134566.1.6882 WP_001134566.1.68894 WP_001134566.1.68914 WP_001134566.1.68928 WP_001134566.1.68966 WP_001134566.1.68975 WP_001134566.1.68999 WP_001134566.1.69001 WP_001134566.1.69006 WP_001134566.1.69029 WP_001134566.1.6904 WP_001134566.1.69053 WP_001134566.1.6907 WP_001134566.1.6913 WP_001134566.1.69146 WP_001134566.1.69151 WP_001134566.1.69170 WP_001134566.1.69210 WP_001134566.1.69255 WP_001134566.1.69270 WP_001134566.1.69282 WP_001134566.1.69320 WP_001134566.1.69359 WP_001134566.1.69371 WP_001134566.1.69376 WP_001134566.1.69396 WP_001134566.1.69397 WP_001134566.1.69465 WP_001134566.1.69466 WP_001134566.1.6954 WP_001134566.1.69564 WP_001134566.1.69611 WP_001134566.1.69642 WP_001134566.1.69644 WP_001134566.1.69656 WP_001134566.1.69657 WP_001134566.1.69690 WP_001134566.1.69704 WP_001134566.1.69754 WP_001134566.1.69758 WP_001134566.1.69785 WP_001134566.1.69787 WP_001134566.1.69807 WP_001134566.1.69923 WP_001134566.1.69948 WP_001134566.1.69953 WP_001134566.1.69977 WP_001134566.1.70010 WP_001134566.1.70028 WP_001134566.1.70049 WP_001134566.1.70058 WP_001134566.1.70061 WP_001134566.1.7016 WP_001134566.1.70205 WP_001134566.1.7021 WP_001134566.1.70240 WP_001134566.1.70241 WP_001134566.1.70249 WP_001134566.1.70261 WP_001134566.1.70269 WP_001134566.1.70289 WP_001134566.1.70314 WP_001134566.1.7033 WP_001134566.1.70427 WP_001134566.1.70433 WP_001134566.1.70447 WP_001134566.1.70485 WP_001134566.1.70545 WP_001134566.1.70623 WP_001134566.1.70643 WP_001134566.1.70644 WP_001134566.1.70671 WP_001134566.1.70679 WP_001134566.1.70683 WP_001134566.1.70708 WP_001134566.1.70717 WP_001134566.1.70731 WP_001134566.1.70772 WP_001134566.1.70792 WP_001134566.1.70845 WP_001134566.1.70846 WP_001134566.1.70883 WP_001134566.1.70922 WP_001134566.1.70948 WP_001134566.1.70959 WP_001134566.1.70981 WP_001134566.1.70995 WP_001134566.1.71023 WP_001134566.1.71039 WP_001134566.1.71057 WP_001134566.1.71081 WP_001134566.1.71116 WP_001134566.1.71117 WP_001134566.1.71146 WP_001134566.1.71165 WP_001134566.1.71186 WP_001134566.1.71188 WP_001134566.1.71202 WP_001134566.1.71243 WP_001134566.1.71306 WP_001134566.1.71337 WP_001134566.1.71363 WP_001134566.1.71368 WP_001134566.1.71378 WP_001134566.1.71401 WP_001134566.1.71407 WP_001134566.1.71418 WP_001134566.1.71455 WP_001134566.1.71456 WP_001134566.1.71487 WP_001134566.1.71523 WP_001134566.1.71542 WP_001134566.1.71566 WP_001134566.1.71636 WP_001134566.1.71640 WP_001134566.1.71651 WP_001134566.1.71653 WP_001134566.1.71702 WP_001134566.1.71716 WP_001134566.1.71750 WP_001134566.1.71798 WP_001134566.1.71845 WP_001134566.1.71872 WP_001134566.1.71881 WP_001134566.1.71908 WP_001134566.1.71929 WP_001134566.1.71950 WP_001134566.1.71952 WP_001134566.1.71954 WP_001134566.1.71973 WP_001134566.1.71985 WP_001134566.1.72003 WP_001134566.1.72073 WP_001134566.1.72105 WP_001134566.1.72119 WP_001134566.1.72203 WP_001134566.1.72220 WP_001134566.1.72234 WP_001134566.1.72269 WP_001134566.1.72281 WP_001134566.1.72350 WP_001134566.1.72376 WP_001134566.1.72382 WP_001134566.1.72383 WP_001134566.1.72403 WP_001134566.1.72461 WP_001134566.1.72527 WP_001134566.1.7255 WP_001134566.1.72594 WP_001134566.1.72629 WP_001134566.1.72631 WP_001134566.1.72638 WP_001134566.1.72667 WP_001134566.1.72674 WP_001134566.1.72724 WP_001134566.1.72728 WP_001134566.1.72789 WP_001134566.1.72827 WP_001134566.1.72828 WP_001134566.1.72850 WP_001134566.1.72871 WP_001134566.1.72896 WP_001134566.1.72897 WP_001134566.1.72968 WP_001134566.1.72969 WP_001134566.1.72975 WP_001134566.1.72987 WP_001134566.1.73052 WP_001134566.1.7311 WP_001134566.1.73114 WP_001134566.1.73125 WP_001134566.1.7315 WP_001134566.1.73164 WP_001134566.1.73177 WP_001134566.1.73180 WP_001134566.1.73200 WP_001134566.1.73258 WP_001134566.1.73285 WP_001134566.1.7332 WP_001134566.1.7333 WP_001134566.1.7334 WP_001134566.1.73352 WP_001134566.1.73377 WP_001134566.1.73389 WP_001134566.1.73425 WP_001134566.1.73461 WP_001134566.1.73481 WP_001134566.1.73488 WP_001134566.1.73504 WP_001134566.1.7353 WP_001134566.1.73535 WP_001134566.1.73544 WP_001134566.1.7356 WP_001134566.1.73581 WP_001134566.1.73596 WP_001134566.1.73598 WP_001134566.1.7361 WP_001134566.1.73617 WP_001134566.1.73648 WP_001134566.1.73669 WP_001134566.1.73753 WP_001134566.1.73758 WP_001134566.1.73768 WP_001134566.1.73794 WP_001134566.1.73804 WP_001134566.1.73847 WP_001134566.1.73849 WP_001134566.1.7387 WP_001134566.1.73901 WP_001134566.1.73924 WP_001134566.1.7394 WP_001134566.1.73948 WP_001134566.1.73956 WP_001134566.1.73999 WP_001134566.1.74024 WP_001134566.1.74029 WP_001134566.1.74030 WP_001134566.1.74038 WP_001134566.1.74043 WP_001134566.1.74058 WP_001134566.1.74070 WP_001134566.1.74077 WP_001134566.1.74117 WP_001134566.1.74135 WP_001134566.1.74181 WP_001134566.1.74191 WP_001134566.1.74214 WP_001134566.1.74241 WP_001134566.1.74285 WP_001134566.1.7430 WP_001134566.1.74317 WP_001134566.1.7433 WP_001134566.1.74379 WP_001134566.1.74410 WP_001134566.1.74414 WP_001134566.1.74415 WP_001134566.1.74422 WP_001134566.1.74466 WP_001134566.1.74481 WP_001134566.1.745 WP_001134566.1.74529 WP_001134566.1.74545 WP_001134566.1.74616 WP_001134566.1.74621 WP_001134566.1.74644 WP_001134566.1.74647 WP_001134566.1.74677 WP_001134566.1.74699 WP_001134566.1.74702 WP_001134566.1.74745 WP_001134566.1.74831 WP_001134566.1.74894 WP_001134566.1.7491 WP_001134566.1.74929 WP_001134566.1.74939 WP_001134566.1.74973 WP_001134566.1.74992 WP_001134566.1.7507 WP_001134566.1.75089 WP_001134566.1.75116 WP_001134566.1.75129 WP_001134566.1.75187 WP_001134566.1.75237 WP_001134566.1.75273 WP_001134566.1.75288 WP_001134566.1.75296 WP_001134566.1.75334 WP_001134566.1.75362 WP_001134566.1.75385 WP_001134566.1.75392 WP_001134566.1.75413 WP_001134566.1.75433 WP_001134566.1.75532 WP_001134566.1.75565 WP_001134566.1.75593 WP_001134566.1.75610 WP_001134566.1.75633 WP_001134566.1.75718 WP_001134566.1.75745 WP_001134566.1.75760 WP_001134566.1.75764 WP_001134566.1.75837 WP_001134566.1.75844 WP_001134566.1.75874 WP_001134566.1.75884 WP_001134566.1.75886 WP_001134566.1.75898 WP_001134566.1.75945 WP_001134566.1.75957 WP_001134566.1.76020 WP_001134566.1.76024 WP_001134566.1.76081 WP_001134566.1.76116 WP_001134566.1.76122 WP_001134566.1.76162 WP_001134566.1.76252 WP_001134566.1.76256 WP_001134566.1.76301 WP_001134566.1.76327 WP_001134566.1.76339 WP_001134566.1.76366 WP_001134566.1.76417 WP_001134566.1.76445 WP_001134566.1.7646 WP_001134566.1.76510 WP_001134566.1.76558 WP_001134566.1.76572 WP_001134566.1.7660 WP_001134566.1.76641 WP_001134566.1.76651 WP_001134566.1.76653 WP_001134566.1.76673 WP_001134566.1.76706 WP_001134566.1.7672 WP_001134566.1.76721 WP_001134566.1.76724 WP_001134566.1.76738 WP_001134566.1.76756 WP_001134566.1.76760 WP_001134566.1.76788 WP_001134566.1.76854 WP_001134566.1.76866 WP_001134566.1.76875 WP_001134566.1.76880 WP_001134566.1.76899 WP_001134566.1.76916 WP_001134566.1.76932 WP_001134566.1.76973 WP_001134566.1.76988 WP_001134566.1.77016 WP_001134566.1.77017 WP_001134566.1.77038 WP_001134566.1.77047 WP_001134566.1.77080 WP_001134566.1.77087 WP_001134566.1.77090 WP_001134566.1.77111 WP_001134566.1.7712 WP_001134566.1.77177 WP_001134566.1.77180 WP_001134566.1.77184 WP_001134566.1.77193 WP_001134566.1.77244 WP_001134566.1.77267 WP_001134566.1.77271 WP_001134566.1.77292 WP_001134566.1.77299 WP_001134566.1.77349 WP_001134566.1.77384 WP_001134566.1.77501 WP_001134566.1.77512 WP_001134566.1.77513 WP_001134566.1.77514 WP_001134566.1.77529 WP_001134566.1.77549 WP_001134566.1.77563 WP_001134566.1.77692 WP_001134566.1.77702 WP_001134566.1.77710 WP_001134566.1.77713 WP_001134566.1.7772 WP_001134566.1.77729 WP_001134566.1.7782 WP_001134566.1.77825 WP_001134566.1.77837 WP_001134566.1.77846 WP_001134566.1.77851 WP_001134566.1.77871 WP_001134566.1.77898 WP_001134566.1.77900 WP_001134566.1.77918 WP_001134566.1.77923 WP_001134566.1.77960 WP_001134566.1.77975 WP_001134566.1.78 WP_001134566.1.78035 WP_001134566.1.78048 WP_001134566.1.78076 WP_001134566.1.78096 WP_001134566.1.78100 WP_001134566.1.78107 WP_001134566.1.78110 WP_001134566.1.78120 WP_001134566.1.78166 WP_001134566.1.78192 WP_001134566.1.78195 WP_001134566.1.78245 WP_001134566.1.78291 WP_001134566.1.78309 WP_001134566.1.78320 WP_001134566.1.78372 WP_001134566.1.78382 WP_001134566.1.78383 WP_001134566.1.78388 WP_001134566.1.78407 WP_001134566.1.78410 WP_001134566.1.78602 WP_001134566.1.7861 WP_001134566.1.78618 WP_001134566.1.7862 WP_001134566.1.78626 WP_001134566.1.78661 WP_001134566.1.78673 WP_001134566.1.78674 WP_001134566.1.78676 WP_001134566.1.78735 WP_001134566.1.78761 WP_001134566.1.78802 WP_001134566.1.78830 WP_001134566.1.78838 WP_001134566.1.78862 WP_001134566.1.78871 WP_001134566.1.78874 WP_001134566.1.789 WP_001134566.1.7891 WP_001134566.1.78918 WP_001134566.1.78930 WP_001134566.1.78993 WP_001134566.1.79012 WP_001134566.1.79032 WP_001134566.1.79069 WP_001134566.1.79074 WP_001134566.1.79098 WP_001134566.1.79151 WP_001134566.1.79155 WP_001134566.1.79164 WP_001134566.1.79167 WP_001134566.1.79204 WP_001134566.1.79235 WP_001134566.1.79280 WP_001134566.1.79297 WP_001134566.1.79302 WP_001134566.1.79335 WP_001134566.1.79370 WP_001134566.1.79397 WP_001134566.1.794 WP_001134566.1.79456 WP_001134566.1.79462 WP_001134566.1.79472 WP_001134566.1.79490 WP_001134566.1.79495 WP_001134566.1.79529 WP_001134566.1.79532 WP_001134566.1.79547 WP_001134566.1.79570 WP_001134566.1.7964 WP_001134566.1.79642 WP_001134566.1.79654 WP_001134566.1.79659 WP_001134566.1.79668 WP_001134566.1.7970 WP_001134566.1.79708 WP_001134566.1.79722 WP_001134566.1.79734 WP_001134566.1.79738 WP_001134566.1.79772 WP_001134566.1.7979 WP_001134566.1.79832 WP_001134566.1.79845 WP_001134566.1.79880 WP_001134566.1.79916 WP_001134566.1.7994 WP_001134566.1.79951 WP_001134566.1.79966 WP_001134566.1.79996 WP_001134566.1.80065 WP_001134566.1.80077 WP_001134566.1.80103 WP_001134566.1.80137 WP_001134566.1.80182 WP_001134566.1.80236 WP_001134566.1.80273 WP_001134566.1.80282 WP_001134566.1.80296 WP_001134566.1.80354 WP_001134566.1.80366 WP_001134566.1.80368 WP_001134566.1.80386 WP_001134566.1.80400 WP_001134566.1.80443 WP_001134566.1.80448 WP_001134566.1.80462 WP_001134566.1.8049 WP_001134566.1.80492 WP_001134566.1.80542 WP_001134566.1.80569 WP_001134566.1.80664 WP_001134566.1.80667 WP_001134566.1.80674 WP_001134566.1.80696 WP_001134566.1.80741 WP_001134566.1.80750 WP_001134566.1.80757 WP_001134566.1.80780 WP_001134566.1.80827 WP_001134566.1.80831 WP_001134566.1.80850 WP_001134566.1.80881 WP_001134566.1.80939 WP_001134566.1.8096 WP_001134566.1.80984 WP_001134566.1.81037 WP_001134566.1.81069 WP_001134566.1.81131 WP_001134566.1.81149 WP_001134566.1.81175 WP_001134566.1.81187 WP_001134566.1.8119 WP_001134566.1.81193 WP_001134566.1.81262 WP_001134566.1.81268 WP_001134566.1.81269 WP_001134566.1.81271 WP_001134566.1.81305 WP_001134566.1.8131 WP_001134566.1.81320 WP_001134566.1.81321 WP_001134566.1.81328 WP_001134566.1.81333 WP_001134566.1.81342 WP_001134566.1.81354 WP_001134566.1.81364 WP_001134566.1.81404 WP_001134566.1.81425 WP_001134566.1.81472 WP_001134566.1.81494 WP_001134566.1.81528 WP_001134566.1.81557 WP_001134566.1.81676 WP_001134566.1.81681 WP_001134566.1.8170 WP_001134566.1.81735 WP_001134566.1.81750 WP_001134566.1.81760 WP_001134566.1.81763 WP_001134566.1.81785 WP_001134566.1.81795 WP_001134566.1.81855 WP_001134566.1.81902 WP_001134566.1.81921 WP_001134566.1.81931 WP_001134566.1.81936 WP_001134566.1.81941 WP_001134566.1.81949 WP_001134566.1.81974 WP_001134566.1.82070 WP_001134566.1.82076 WP_001134566.1.82099 WP_001134566.1.82131 WP_001134566.1.82156 WP_001134566.1.8218 WP_001134566.1.82180 WP_001134566.1.82192 WP_001134566.1.82201 WP_001134566.1.82214 WP_001134566.1.82225 WP_001134566.1.82232 WP_001134566.1.82337 WP_001134566.1.82395 WP_001134566.1.8240 WP_001134566.1.82408 WP_001134566.1.82416 WP_001134566.1.8242 WP_001134566.1.82456 WP_001134566.1.82464 WP_001134566.1.82465 WP_001134566.1.82473 WP_001134566.1.82479 WP_001134566.1.82503 WP_001134566.1.82515 WP_001134566.1.82553 WP_001134566.1.82584 WP_001134566.1.82646 WP_001134566.1.82670 WP_001134566.1.82676 WP_001134566.1.82731 WP_001134566.1.82761 WP_001134566.1.82812 WP_001134566.1.8282 WP_001134566.1.82850 WP_001134566.1.82872 WP_001134566.1.82937 WP_001134566.1.8294 WP_001134566.1.82944 WP_001134566.1.82956 WP_001134566.1.82959 WP_001134566.1.82964 WP_001134566.1.83007 WP_001134566.1.8304 WP_001134566.1.83092 WP_001134566.1.83119 WP_001134566.1.83128 WP_001134566.1.83163 WP_001134566.1.83180 WP_001134566.1.83229 WP_001134566.1.83235 WP_001134566.1.83290 WP_001134566.1.83305 WP_001134566.1.83333 WP_001134566.1.83407 WP_001134566.1.83413 WP_001134566.1.83491 WP_001134566.1.83523 WP_001134566.1.8354 WP_001134566.1.83657 WP_001134566.1.83677 WP_001134566.1.83721 WP_001134566.1.8375 WP_001134566.1.83759 WP_001134566.1.83760 WP_001134566.1.83897 WP_001134566.1.83923 WP_001134566.1.83960 WP_001134566.1.83994 WP_001134566.1.83995 WP_001134566.1.84 WP_001134566.1.84001 WP_001134566.1.8406 WP_001134566.1.84076 WP_001134566.1.84077 WP_001134566.1.84100 WP_001134566.1.84103 WP_001134566.1.84110 WP_001134566.1.84127 WP_001134566.1.84150 WP_001134566.1.84230 WP_001134566.1.84252 WP_001134566.1.84283 WP_001134566.1.84291 WP_001134566.1.8431 WP_001134566.1.84345 WP_001134566.1.84369 WP_001134566.1.84373 WP_001134566.1.84392 WP_001134566.1.84397 WP_001134566.1.84401 WP_001134566.1.8441 WP_001134566.1.84435 WP_001134566.1.84459 WP_001134566.1.84532 WP_001134566.1.84554 WP_001134566.1.84567 WP_001134566.1.84631 WP_001134566.1.84644 WP_001134566.1.84659 WP_001134566.1.84683 WP_001134566.1.84727 WP_001134566.1.84744 WP_001134566.1.84773 WP_001134566.1.84899 WP_001134566.1.84945 WP_001134566.1.84967 WP_001134566.1.8497 WP_001134566.1.85004 WP_001134566.1.8502 WP_001134566.1.85039 WP_001134566.1.85040 WP_001134566.1.85120 WP_001134566.1.85134 WP_001134566.1.85153 WP_001134566.1.85178 WP_001134566.1.85180 WP_001134566.1.85190 WP_001134566.1.85192 WP_001134566.1.85273 WP_001134566.1.8533 WP_001134566.1.85338 WP_001134566.1.85339 WP_001134566.1.8537 WP_001134566.1.8545 WP_001134566.1.85456 WP_001134566.1.85469 WP_001134566.1.85481 WP_001134566.1.85483 WP_001134566.1.85511 WP_001134566.1.85512 WP_001134566.1.85541 WP_001134566.1.8556 WP_001134566.1.85568 WP_001134566.1.8557 WP_001134566.1.85606 WP_001134566.1.85615 WP_001134566.1.85617 WP_001134566.1.85635 WP_001134566.1.85646 WP_001134566.1.85663 WP_001134566.1.85665 WP_001134566.1.85669 WP_001134566.1.85671 WP_001134566.1.85672 WP_001134566.1.85688 WP_001134566.1.85703 WP_001134566.1.85728 WP_001134566.1.85746 WP_001134566.1.85777 WP_001134566.1.85780 WP_001134566.1.85811 WP_001134566.1.85886 WP_001134566.1.859 WP_001134566.1.85900 WP_001134566.1.85904 WP_001134566.1.85917 WP_001134566.1.8594 WP_001134566.1.85976 WP_001134566.1.85977 WP_001134566.1.860 WP_001134566.1.86043 WP_001134566.1.8605 WP_001134566.1.86084 WP_001134566.1.8610 WP_001134566.1.8614 WP_001134566.1.86156 WP_001134566.1.86173 WP_001134566.1.86224 WP_001134566.1.86259 WP_001134566.1.86285 WP_001134566.1.86306 WP_001134566.1.86310 WP_001134566.1.86323 WP_001134566.1.86335 WP_001134566.1.86342 WP_001134566.1.86356 WP_001134566.1.8640 WP_001134566.1.8642 WP_001134566.1.86426 WP_001134566.1.86450 WP_001134566.1.86469 WP_001134566.1.86489 WP_001134566.1.86530 WP_001134566.1.86580 WP_001134566.1.86588 WP_001134566.1.86593 WP_001134566.1.86601 WP_001134566.1.86661 WP_001134566.1.86663 WP_001134566.1.8671 WP_001134566.1.8672 WP_001134566.1.86770 WP_001134566.1.8678 WP_001134566.1.86794 WP_001134566.1.86800 WP_001134566.1.86810 WP_001134566.1.86811 WP_001134566.1.86815 WP_001134566.1.8684 WP_001134566.1.86895 WP_001134566.1.86906 WP_001134566.1.86945 WP_001134566.1.86982 WP_001134566.1.86989 WP_001134566.1.87023 WP_001134566.1.87034 WP_001134566.1.87041 WP_001134566.1.87051 WP_001134566.1.87095 WP_001134566.1.87136 WP_001134566.1.87143 WP_001134566.1.87148 WP_001134566.1.87155 WP_001134566.1.87219 WP_001134566.1.87258 WP_001134566.1.87283 WP_001134566.1.87293 WP_001134566.1.87323 WP_001134566.1.8736 WP_001134566.1.87365 WP_001134566.1.87420 WP_001134566.1.87460 WP_001134566.1.87528 WP_001134566.1.87552 WP_001134566.1.87560 WP_001134566.1.8760 WP_001134566.1.87600 WP_001134566.1.87609 WP_001134566.1.87612 WP_001134566.1.87615 WP_001134566.1.87653 WP_001134566.1.87659 WP_001134566.1.87695 WP_001134566.1.87698 WP_001134566.1.87706 WP_001134566.1.87739 WP_001134566.1.87741 WP_001134566.1.87742 WP_001134566.1.87779 WP_001134566.1.87852 WP_001134566.1.87899 WP_001134566.1.8792 WP_001134566.1.87933 WP_001134566.1.87945 WP_001134566.1.87949 WP_001134566.1.88019 WP_001134566.1.88025 WP_001134566.1.88026 WP_001134566.1.8805 WP_001134566.1.8806 WP_001134566.1.88073 WP_001134566.1.8809 WP_001134566.1.88092 WP_001134566.1.881 WP_001134566.1.88145 WP_001134566.1.88199 WP_001134566.1.88291 WP_001134566.1.88293 WP_001134566.1.88299 WP_001134566.1.88313 WP_001134566.1.88359 WP_001134566.1.8837 WP_001134566.1.88393 WP_001134566.1.88407 WP_001134566.1.88414 WP_001134566.1.88444 WP_001134566.1.88446 WP_001134566.1.88458 WP_001134566.1.8849 WP_001134566.1.88501 WP_001134566.1.88538 WP_001134566.1.88547 WP_001134566.1.886 WP_001134566.1.88647 WP_001134566.1.88648 WP_001134566.1.88692 WP_001134566.1.88703 WP_001134566.1.88707 WP_001134566.1.88727 WP_001134566.1.88762 WP_001134566.1.88772 WP_001134566.1.88792 WP_001134566.1.88850 WP_001134566.1.8889 WP_001134566.1.88892 WP_001134566.1.88894 WP_001134566.1.88902 WP_001134566.1.8891 WP_001134566.1.88957 WP_001134566.1.88967 WP_001134566.1.88980 WP_001134566.1.88981 WP_001134566.1.89008 WP_001134566.1.89114 WP_001134566.1.89116 WP_001134566.1.89119 WP_001134566.1.89138 WP_001134566.1.89182 WP_001134566.1.89298 WP_001134566.1.89304 WP_001134566.1.89308 WP_001134566.1.89314 WP_001134566.1.89328 WP_001134566.1.89332 WP_001134566.1.89343 WP_001134566.1.89395 WP_001134566.1.8940 WP_001134566.1.89449 WP_001134566.1.89452 WP_001134566.1.8947 WP_001134566.1.89503 WP_001134566.1.89512 WP_001134566.1.89527 WP_001134566.1.89570 WP_001134566.1.8958 WP_001134566.1.89591 WP_001134566.1.89604 WP_001134566.1.89612 WP_001134566.1.89622 WP_001134566.1.89657 WP_001134566.1.89659 WP_001134566.1.89668 WP_001134566.1.89706 WP_001134566.1.89713 WP_001134566.1.89733 WP_001134566.1.89765 WP_001134566.1.89789 WP_001134566.1.89796 WP_001134566.1.89804 WP_001134566.1.89817 WP_001134566.1.89845 WP_001134566.1.89870 WP_001134566.1.89888 WP_001134566.1.89902 WP_001134566.1.89911 WP_001134566.1.89940 WP_001134566.1.8995 WP_001134566.1.89952 WP_001134566.1.8996 WP_001134566.1.89965 WP_001134566.1.90097 WP_001134566.1.9011 WP_001134566.1.90196 WP_001134566.1.90240 WP_001134566.1.90248 WP_001134566.1.90252 WP_001134566.1.90274 WP_001134566.1.90280 WP_001134566.1.90330 WP_001134566.1.90338 WP_001134566.1.90348 WP_001134566.1.90363 WP_001134566.1.90365 WP_001134566.1.90417 WP_001134566.1.90428 WP_001134566.1.90440 WP_001134566.1.90453 WP_001134566.1.90458 WP_001134566.1.90489 WP_001134566.1.90513 WP_001134566.1.90557 WP_001134566.1.90582 WP_001134566.1.90585 WP_001134566.1.9064 WP_001134566.1.90641 WP_001134566.1.90713 WP_001134566.1.90734 WP_001134566.1.90794 WP_001134566.1.90796 WP_001134566.1.90811 WP_001134566.1.90814 WP_001134566.1.90866 WP_001134566.1.9091 WP_001134566.1.9093 WP_001134566.1.90984 WP_001134566.1.91003 WP_001134566.1.91056 WP_001134566.1.91067 WP_001134566.1.91069 WP_001134566.1.91156 WP_001134566.1.91164 WP_001134566.1.91179 WP_001134566.1.91189 WP_001134566.1.91205 WP_001134566.1.91239 WP_001134566.1.91278 WP_001134566.1.91291 WP_001134566.1.91313 WP_001134566.1.9135 WP_001134566.1.91506 WP_001134566.1.91512 WP_001134566.1.91557 WP_001134566.1.91564 WP_001134566.1.91597 WP_001134566.1.91621 WP_001134566.1.91628 WP_001134566.1.91655 WP_001134566.1.91715 WP_001134566.1.91724 WP_001134566.1.91732 WP_001134566.1.91788 WP_001134566.1.9187 WP_001134566.1.91870 WP_001134566.1.92013 WP_001134566.1.92018 WP_001134566.1.92047 WP_001134566.1.92087 WP_001134566.1.92093 WP_001134566.1.92098 WP_001134566.1.92108 WP_001134566.1.92122 WP_001134566.1.92156 WP_001134566.1.92165 WP_001134566.1.92172 WP_001134566.1.92183 WP_001134566.1.92208 WP_001134566.1.92240 WP_001134566.1.92243 WP_001134566.1.92268 WP_001134566.1.92299 WP_001134566.1.92310 WP_001134566.1.92327 WP_001134566.1.92408 WP_001134566.1.92443 WP_001134566.1.92470 WP_001134566.1.92477 WP_001134566.1.92482 WP_001134566.1.92529 WP_001134566.1.92531 WP_001134566.1.92545 WP_001134566.1.92570 WP_001134566.1.92588 WP_001134566.1.926 WP_001134566.1.92633 WP_001134566.1.92649 WP_001134566.1.92669 WP_001134566.1.92671 WP_001134566.1.92676 WP_001134566.1.92705 WP_001134566.1.9271 WP_001134566.1.92734 WP_001134566.1.92738 WP_001134566.1.92810 WP_001134566.1.92823 WP_001134566.1.92832 WP_001134566.1.92875 WP_001134566.1.92893 WP_001134566.1.92895 WP_001134566.1.92939 WP_001134566.1.92987 WP_001134566.1.93007 WP_001134566.1.93022 WP_001134566.1.93059 WP_001134566.1.93061 WP_001134566.1.93086 WP_001134566.1.93101 WP_001134566.1.93103 WP_001134566.1.93105 WP_001134566.1.93111 WP_001134566.1.93121 WP_001134566.1.93136 WP_001134566.1.93155 WP_001134566.1.93168 WP_001134566.1.93184 WP_001134566.1.93221 WP_001134566.1.93223 WP_001134566.1.93239 WP_001134566.1.93302 WP_001134566.1.93322 WP_001134566.1.93339 WP_001134566.1.9336 WP_001134566.1.93365 WP_001134566.1.93387 WP_001134566.1.93469 WP_001134566.1.93511 WP_001134566.1.93512 WP_001134566.1.93543 WP_001134566.1.93635 WP_001134566.1.93650 WP_001134566.1.93656 WP_001134566.1.93657 WP_001134566.1.93662 WP_001134566.1.937 WP_001134566.1.93705 WP_001134566.1.9374 WP_001134566.1.93741 WP_001134566.1.9375 WP_001134566.1.93754 WP_001134566.1.93761 WP_001134566.1.93780 WP_001134566.1.93804 WP_001134566.1.93828 WP_001134566.1.93842 WP_001134566.1.93843 WP_001134566.1.93875 WP_001134566.1.9389 WP_001134566.1.93909 WP_001134566.1.93919 WP_001134566.1.93937 WP_001134566.1.93938 WP_001134566.1.93984 WP_001134566.1.9399 WP_001134566.1.93994 WP_001134566.1.94017 WP_001134566.1.94064 WP_001134566.1.94072 WP_001134566.1.94079 WP_001134566.1.94097 WP_001134566.1.94107 WP_001134566.1.94142 WP_001134566.1.94162 WP_001134566.1.94168 WP_001134566.1.94198 WP_001134566.1.94215 WP_001134566.1.94303 WP_001134566.1.9432 WP_001134566.1.94354 WP_001134566.1.94365 WP_001134566.1.94380 WP_001134566.1.94390 WP_001134566.1.94412 WP_001134566.1.94415 WP_001134566.1.94458 WP_001134566.1.94492 WP_001134566.1.94510 WP_001134566.1.94527 WP_001134566.1.94565 WP_001134566.1.94573 WP_001134566.1.94579 WP_001134566.1.94584 WP_001134566.1.94586 WP_001134566.1.94593 WP_001134566.1.94622 WP_001134566.1.94650 WP_001134566.1.94655 WP_001134566.1.94659 WP_001134566.1.94662 WP_001134566.1.94674 WP_001134566.1.94700 WP_001134566.1.94745 WP_001134566.1.94782 WP_001134566.1.94796 WP_001134566.1.9481 WP_001134566.1.94815 WP_001134566.1.94820 WP_001134566.1.94850 WP_001134566.1.94851 WP_001134566.1.94864 WP_001134566.1.94947 WP_001134566.1.94952 WP_001134566.1.94959 WP_001134566.1.94967 WP_001134566.1.95006 WP_001134566.1.9503 WP_001134566.1.95051 WP_001134566.1.95055 WP_001134566.1.95076 WP_001134566.1.95085 WP_001134566.1.95099 WP_001134566.1.95121 WP_001134566.1.95165 WP_001134566.1.95171 WP_001134566.1.95235 WP_001134566.1.95239 WP_001134566.1.95246 WP_001134566.1.95248 WP_001134566.1.95249 WP_001134566.1.9525 WP_001134566.1.95255 WP_001134566.1.95265 WP_001134566.1.95277 WP_001134566.1.95282 WP_001134566.1.95289 WP_001134566.1.95338 WP_001134566.1.95388 WP_001134566.1.95412 WP_001134566.1.95530 WP_001134566.1.95546 WP_001134566.1.95547 WP_001134566.1.95590 WP_001134566.1.95625 WP_001134566.1.95630 WP_001134566.1.95670 WP_001134566.1.95675 WP_001134566.1.95691 WP_001134566.1.95703 WP_001134566.1.95716 WP_001134566.1.95744 WP_001134566.1.95776 WP_001134566.1.95840 WP_001134566.1.95884 WP_001134566.1.95890 WP_001134566.1.95906 WP_001134566.1.95911 WP_001134566.1.95939 WP_001134566.1.96004 WP_001134566.1.96025 WP_001134566.1.96044 WP_001134566.1.96054 WP_001134566.1.9609 WP_001134566.1.96094 WP_001134566.1.96127 WP_001134566.1.96139 WP_001134566.1.96144 WP_001134566.1.96162 WP_001134566.1.96172 WP_001134566.1.96188 WP_001134566.1.96211 WP_001134566.1.96212 WP_001134566.1.96260 WP_001134566.1.96317 WP_001134566.1.96319 WP_001134566.1.9633 WP_001134566.1.96343 WP_001134566.1.96359 WP_001134566.1.9644 WP_001134566.1.96469 WP_001134566.1.96500 WP_001134566.1.96539 WP_001134566.1.96552 WP_001134566.1.96555 WP_001134566.1.96563 WP_001134566.1.96610 WP_001134566.1.96625 WP_001134566.1.96635 WP_001134566.1.9664 WP_001134566.1.96675 WP_001134566.1.9670 WP_001134566.1.96732 WP_001134566.1.9674 WP_001134566.1.96750 WP_001134566.1.96771 WP_001134566.1.96792 WP_001134566.1.96801 WP_001134566.1.96803 WP_001134566.1.96810 WP_001134566.1.96902 WP_001134566.1.96925 WP_001134566.1.96938 WP_001134566.1.96946 WP_001134566.1.96957 WP_001134566.1.96978 WP_001134566.1.97015 WP_001134566.1.97026 WP_001134566.1.97028 WP_001134566.1.97043 WP_001134566.1.97047 WP_001134566.1.97079 WP_001134566.1.97109 WP_001134566.1.97143 WP_001134566.1.97145 WP_001134566.1.97154 WP_001134566.1.97184 WP_001134566.1.97190 WP_001134566.1.97287 WP_001134566.1.97291 WP_001134566.1.97297 WP_001134566.1.97318 WP_001134566.1.97369 WP_001134566.1.97422 WP_001134566.1.97441 WP_001134566.1.97477 WP_001134566.1.97487 WP_001134566.1.97497 WP_001134566.1.97505 WP_001134566.1.97594 WP_001134566.1.97597 WP_001134566.1.97599 WP_001134566.1.97606 WP_001134566.1.97613 WP_001134566.1.97615 WP_001134566.1.97620 WP_001134566.1.97631 WP_001134566.1.97640 WP_001134566.1.97646 WP_001134566.1.97690 WP_001134566.1.97725 WP_001134566.1.97726 WP_001134566.1.97727 WP_001134566.1.97732 WP_001134566.1.97736 WP_001134566.1.9775 WP_001134566.1.97819 WP_001134566.1.97840 WP_001134566.1.97846 WP_001134566.1.97938 WP_001134566.1.97986 WP_001134566.1.9799 WP_001134566.1.98006 WP_001134566.1.98019 WP_001134566.1.98022 WP_001134566.1.98036 WP_001134566.1.98080 WP_001134566.1.98086 WP_001134566.1.98110 WP_001134566.1.98124 WP_001134566.1.98146 WP_001134566.1.98158 WP_001134566.1.98170 WP_001134566.1.98219 WP_001134566.1.9826 WP_001134566.1.98263 WP_001134566.1.98402 WP_001134566.1.9841 WP_001134566.1.98418 WP_001134566.1.98446 WP_001134566.1.98448 WP_001134566.1.98457 WP_001134566.1.98495 WP_001134566.1.9850 WP_001134566.1.98502 WP_001134566.1.98513 WP_001134566.1.98531 WP_001134566.1.98551 WP_001134566.1.98577 WP_001134566.1.98607 WP_001134566.1.98627 WP_001134566.1.98634 WP_001134566.1.98676 WP_001134566.1.98677 WP_001134566.1.98731 WP_001134566.1.98760 WP_001134566.1.98762 WP_001134566.1.98763 WP_001134566.1.9877 WP_001134566.1.98801 WP_001134566.1.98818 WP_001134566.1.98843 WP_001134566.1.98947 WP_001134566.1.9898 WP_001134566.1.99040 WP_001134566.1.99098 WP_001134566.1.99163 WP_001134566.1.99184 WP_001134566.1.99267 WP_001134566.1.99276 WP_001134566.1.99335 WP_001134566.1.99350 WP_001134566.1.99360 WP_001134566.1.99363 WP_001134566.1.99369 WP_001134566.1.99388 WP_001134566.1.99397 WP_001134566.1.99426 WP_001134566.1.99463 WP_001134566.1.99483 WP_001134566.1.99546 WP_001134566.1.99561 WP_001134566.1.99579 WP_001134566.1.99595 WP_001134566.1.99626 WP_001134566.1.99646 WP_001134566.1.99657 WP_001134566.1.99660 WP_001134566.1.99671 WP_001134566.1.99676 WP_001134566.1.99712 WP_001134566.1.99725 WP_001134566.1.99747 WP_001134566.1.99764 WP_001134566.1.99813 WP_001134566.1.99824 WP_001134566.1.99829 WP_001134566.1.99837 WP_001134566.1.99841 WP_001134566.1.99858 WP_001134566.1.99889 WP_001134566.1.9992 WP_001134566.1.99958 WP_001134566.1.99996 gi|16761480|ref|NP_457097.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]