SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482904483|ref|YP_007903043.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482904483|ref|YP_007903043.1|
Domain Number 1 Region: 4-362
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.05e-114
Family GABA-aminotransferase-like 0.0000000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|482904483|ref|YP_007903043.1|
Sequence length 362
Comment 3-phosphoserine/phosphohydroxythreonine aminotransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MAQVFNFSSGPAMLPAEVLKLAQQELCDWHGLGTSVMEISHRGKEFIQVAEEAEQDFRDL
LNIPSNYKVLFCHGGGRGQFAGVPLNLLGDKTTADYVDAGYWAASAIKEAKKYCAPQIID
AKITVDGKRAVKPMREWQLSDNAAYLHYCPNETIDGIAIDETPDFGPEVVVTADFSSTIL
SAPLDVSRYGVIYAGAQKNIGPAGLTLVIVREDLLGKAHESCPSILDYTVLNDNDSMFNT
PPTFAWYLSGLVFKWLKAQGGVAAMHKINQQKAELLYGVIDNSDFYRNDVAQANRSRMNV
PFQLADNTLDKVFLEESFAAGLHALKGHRVVGGMRASIYNAMPIEGVKALTDFMIDFERR
HG
Download sequence
Identical sequences A0A0D6GT32 A0A0F6AZC5 A0A0F7DI87 A0A0H3NJP4 A0A0R9MA87 A0A0U1GQC1 A0A0W3Y4W2 A0A2D3AN73 A0A2H9YBJ2 B4T141 E8XCT3 G5NAX8 P55900
gi|16764337|ref|NP_459952.1| gi|379700143|ref|YP_005241871.1| gi|194443322|ref|YP_002040175.1| ABAO01000046|CDS_27471-28559 ABFH02000002|CDS_1087473-1086385 AE006468|CDS_1061475-1062563 CP001113|CDS_1021954-1023042 CP001363|CDS_1019834-1020922 FN424405|CDS_1057413-1058501 IDP00945 gi|526219737|ref|YP_008265175.1| NP_459952.1.58477 WP_000079584.1.100010 WP_000079584.1.100115 WP_000079584.1.100234 WP_000079584.1.100376 WP_000079584.1.100424 WP_000079584.1.100436 WP_000079584.1.100484 WP_000079584.1.100488 WP_000079584.1.100502 WP_000079584.1.100521 WP_000079584.1.100597 WP_000079584.1.100650 WP_000079584.1.100711 WP_000079584.1.10076 WP_000079584.1.100781 WP_000079584.1.100793 WP_000079584.1.100869 WP_000079584.1.100870 WP_000079584.1.100871 WP_000079584.1.100882 WP_000079584.1.101007 WP_000079584.1.101020 WP_000079584.1.101074 WP_000079584.1.101078 WP_000079584.1.101180 WP_000079584.1.101185 WP_000079584.1.101259 WP_000079584.1.101284 WP_000079584.1.101291 WP_000079584.1.101353 WP_000079584.1.101386 WP_000079584.1.101404 WP_000079584.1.101420 WP_000079584.1.101589 WP_000079584.1.101707 WP_000079584.1.101734 WP_000079584.1.101878 WP_000079584.1.101953 WP_000079584.1.10220 WP_000079584.1.10266 WP_000079584.1.10429 WP_000079584.1.10439 WP_000079584.1.10465 WP_000079584.1.10568 WP_000079584.1.10675 WP_000079584.1.10678 WP_000079584.1.10753 WP_000079584.1.10992 WP_000079584.1.11024 WP_000079584.1.11031 WP_000079584.1.11098 WP_000079584.1.11168 WP_000079584.1.11190 WP_000079584.1.11295 WP_000079584.1.11362 WP_000079584.1.11455 WP_000079584.1.11458 WP_000079584.1.11518 WP_000079584.1.11532 WP_000079584.1.11543 WP_000079584.1.11763 WP_000079584.1.11772 WP_000079584.1.11897 WP_000079584.1.12114 WP_000079584.1.12244 WP_000079584.1.12351 WP_000079584.1.12370 WP_000079584.1.1239 WP_000079584.1.12546 WP_000079584.1.12584 WP_000079584.1.1264 WP_000079584.1.12718 WP_000079584.1.12728 WP_000079584.1.12879 WP_000079584.1.12936 WP_000079584.1.12995 WP_000079584.1.13027 WP_000079584.1.13106 WP_000079584.1.13130 WP_000079584.1.1326 WP_000079584.1.13414 WP_000079584.1.13488 WP_000079584.1.13509 WP_000079584.1.13669 WP_000079584.1.13741 WP_000079584.1.1387 WP_000079584.1.13908 WP_000079584.1.13932 WP_000079584.1.13968 WP_000079584.1.14001 WP_000079584.1.14151 WP_000079584.1.14212 WP_000079584.1.14239 WP_000079584.1.14286 WP_000079584.1.14320 WP_000079584.1.14379 WP_000079584.1.14406 WP_000079584.1.14410 WP_000079584.1.14466 WP_000079584.1.14516 WP_000079584.1.14524 WP_000079584.1.14554 WP_000079584.1.14725 WP_000079584.1.14852 WP_000079584.1.1489 WP_000079584.1.14932 WP_000079584.1.15055 WP_000079584.1.15124 WP_000079584.1.15223 WP_000079584.1.15226 WP_000079584.1.15316 WP_000079584.1.15369 WP_000079584.1.1540 WP_000079584.1.15483 WP_000079584.1.15508 WP_000079584.1.15625 WP_000079584.1.15708 WP_000079584.1.15784 WP_000079584.1.15830 WP_000079584.1.16062 WP_000079584.1.16063 WP_000079584.1.16103 WP_000079584.1.16226 WP_000079584.1.16233 WP_000079584.1.16284 WP_000079584.1.16328 WP_000079584.1.16331 WP_000079584.1.1635 WP_000079584.1.16468 WP_000079584.1.16614 WP_000079584.1.16650 WP_000079584.1.16686 WP_000079584.1.16691 WP_000079584.1.16732 WP_000079584.1.16735 WP_000079584.1.16786 WP_000079584.1.16819 WP_000079584.1.16858 WP_000079584.1.16896 WP_000079584.1.16941 WP_000079584.1.16944 WP_000079584.1.16965 WP_000079584.1.1700 WP_000079584.1.17285 WP_000079584.1.17307 WP_000079584.1.1737 WP_000079584.1.17390 WP_000079584.1.174 WP_000079584.1.17439 WP_000079584.1.17447 WP_000079584.1.17480 WP_000079584.1.17546 WP_000079584.1.17560 WP_000079584.1.17702 WP_000079584.1.17705 WP_000079584.1.17901 WP_000079584.1.17991 WP_000079584.1.18019 WP_000079584.1.18111 WP_000079584.1.18163 WP_000079584.1.18265 WP_000079584.1.18267 WP_000079584.1.18281 WP_000079584.1.18468 WP_000079584.1.18607 WP_000079584.1.18692 WP_000079584.1.18705 WP_000079584.1.18715 WP_000079584.1.18776 WP_000079584.1.18822 WP_000079584.1.18881 WP_000079584.1.18940 WP_000079584.1.18949 WP_000079584.1.1897 WP_000079584.1.19053 WP_000079584.1.19320 WP_000079584.1.19458 WP_000079584.1.19460 WP_000079584.1.19461 WP_000079584.1.19614 WP_000079584.1.19702 WP_000079584.1.19706 WP_000079584.1.19723 WP_000079584.1.19724 WP_000079584.1.19749 WP_000079584.1.19784 WP_000079584.1.19802 WP_000079584.1.19809 WP_000079584.1.19867 WP_000079584.1.1998 WP_000079584.1.20 WP_000079584.1.20034 WP_000079584.1.2010 WP_000079584.1.20212 WP_000079584.1.20266 WP_000079584.1.20271 WP_000079584.1.20362 WP_000079584.1.20391 WP_000079584.1.20418 WP_000079584.1.20425 WP_000079584.1.20443 WP_000079584.1.20525 WP_000079584.1.2054 WP_000079584.1.20553 WP_000079584.1.20626 WP_000079584.1.20631 WP_000079584.1.20646 WP_000079584.1.20695 WP_000079584.1.20721 WP_000079584.1.20886 WP_000079584.1.20908 WP_000079584.1.21049 WP_000079584.1.21146 WP_000079584.1.21245 WP_000079584.1.21246 WP_000079584.1.21269 WP_000079584.1.21309 WP_000079584.1.21326 WP_000079584.1.21400 WP_000079584.1.21497 WP_000079584.1.21499 WP_000079584.1.21603 WP_000079584.1.21751 WP_000079584.1.21757 WP_000079584.1.21792 WP_000079584.1.22024 WP_000079584.1.22030 WP_000079584.1.2205 WP_000079584.1.22062 WP_000079584.1.22067 WP_000079584.1.22169 WP_000079584.1.2221 WP_000079584.1.2224 WP_000079584.1.2235 WP_000079584.1.22379 WP_000079584.1.22427 WP_000079584.1.2246 WP_000079584.1.22485 WP_000079584.1.22514 WP_000079584.1.22575 WP_000079584.1.22620 WP_000079584.1.22870 WP_000079584.1.22979 WP_000079584.1.23102 WP_000079584.1.23114 WP_000079584.1.2314 WP_000079584.1.23155 WP_000079584.1.23192 WP_000079584.1.23246 WP_000079584.1.23259 WP_000079584.1.2342 WP_000079584.1.23460 WP_000079584.1.23466 WP_000079584.1.23472 WP_000079584.1.23482 WP_000079584.1.23634 WP_000079584.1.2364 WP_000079584.1.23643 WP_000079584.1.23685 WP_000079584.1.23736 WP_000079584.1.23932 WP_000079584.1.24017 WP_000079584.1.24206 WP_000079584.1.24259 WP_000079584.1.24308 WP_000079584.1.24325 WP_000079584.1.24578 WP_000079584.1.2467 WP_000079584.1.24737 WP_000079584.1.24779 WP_000079584.1.25008 WP_000079584.1.25015 WP_000079584.1.25405 WP_000079584.1.25454 WP_000079584.1.25493 WP_000079584.1.25498 WP_000079584.1.2554 WP_000079584.1.25668 WP_000079584.1.25690 WP_000079584.1.2570 WP_000079584.1.25740 WP_000079584.1.25793 WP_000079584.1.25814 WP_000079584.1.25988 WP_000079584.1.26030 WP_000079584.1.26269 WP_000079584.1.26282 WP_000079584.1.26311 WP_000079584.1.26319 WP_000079584.1.2634 WP_000079584.1.26363 WP_000079584.1.26426 WP_000079584.1.26429 WP_000079584.1.26440 WP_000079584.1.26493 WP_000079584.1.26551 WP_000079584.1.26567 WP_000079584.1.26576 WP_000079584.1.26582 WP_000079584.1.2660 WP_000079584.1.26924 WP_000079584.1.27010 WP_000079584.1.27173 WP_000079584.1.27206 WP_000079584.1.27279 WP_000079584.1.27419 WP_000079584.1.27423 WP_000079584.1.27556 WP_000079584.1.27561 WP_000079584.1.2763 WP_000079584.1.27665 WP_000079584.1.27679 WP_000079584.1.27707 WP_000079584.1.27761 WP_000079584.1.2777 WP_000079584.1.27857 WP_000079584.1.27977 WP_000079584.1.28094 WP_000079584.1.28170 WP_000079584.1.28302 WP_000079584.1.2835 WP_000079584.1.28538 WP_000079584.1.28575 WP_000079584.1.28612 WP_000079584.1.28625 WP_000079584.1.28655 WP_000079584.1.28694 WP_000079584.1.2879 WP_000079584.1.2890 WP_000079584.1.28938 WP_000079584.1.28946 WP_000079584.1.29006 WP_000079584.1.29010 WP_000079584.1.2910 WP_000079584.1.29530 WP_000079584.1.29588 WP_000079584.1.29601 WP_000079584.1.29606 WP_000079584.1.29615 WP_000079584.1.29619 WP_000079584.1.29682 WP_000079584.1.29704 WP_000079584.1.29768 WP_000079584.1.29775 WP_000079584.1.29924 WP_000079584.1.29969 WP_000079584.1.30006 WP_000079584.1.30027 WP_000079584.1.30180 WP_000079584.1.30469 WP_000079584.1.30505 WP_000079584.1.30507 WP_000079584.1.30535 WP_000079584.1.30547 WP_000079584.1.30573 WP_000079584.1.3076 WP_000079584.1.30794 WP_000079584.1.30833 WP_000079584.1.30835 WP_000079584.1.30909 WP_000079584.1.30972 WP_000079584.1.31 WP_000079584.1.31107 WP_000079584.1.3113 WP_000079584.1.31185 WP_000079584.1.3119 WP_000079584.1.31190 WP_000079584.1.31195 WP_000079584.1.31196 WP_000079584.1.31210 WP_000079584.1.31281 WP_000079584.1.31362 WP_000079584.1.31476 WP_000079584.1.31504 WP_000079584.1.31515 WP_000079584.1.31578 WP_000079584.1.31658 WP_000079584.1.31762 WP_000079584.1.31940 WP_000079584.1.31967 WP_000079584.1.31972 WP_000079584.1.32192 WP_000079584.1.32206 WP_000079584.1.32277 WP_000079584.1.32438 WP_000079584.1.32515 WP_000079584.1.32660 WP_000079584.1.32702 WP_000079584.1.32714 WP_000079584.1.32747 WP_000079584.1.32786 WP_000079584.1.32804 WP_000079584.1.32907 WP_000079584.1.33030 WP_000079584.1.33078 WP_000079584.1.33127 WP_000079584.1.33143 WP_000079584.1.33248 WP_000079584.1.33261 WP_000079584.1.333 WP_000079584.1.33492 WP_000079584.1.33553 WP_000079584.1.33592 WP_000079584.1.33609 WP_000079584.1.33894 WP_000079584.1.34043 WP_000079584.1.34075 WP_000079584.1.34257 WP_000079584.1.34279 WP_000079584.1.34319 WP_000079584.1.34453 WP_000079584.1.34610 WP_000079584.1.34667 WP_000079584.1.3476 WP_000079584.1.34856 WP_000079584.1.34975 WP_000079584.1.35045 WP_000079584.1.35129 WP_000079584.1.35184 WP_000079584.1.35404 WP_000079584.1.35408 WP_000079584.1.35425 WP_000079584.1.35446 WP_000079584.1.35460 WP_000079584.1.35463 WP_000079584.1.35503 WP_000079584.1.35509 WP_000079584.1.3556 WP_000079584.1.35590 WP_000079584.1.35940 WP_000079584.1.36003 WP_000079584.1.3601 WP_000079584.1.36157 WP_000079584.1.36609 WP_000079584.1.36690 WP_000079584.1.3670 WP_000079584.1.36705 WP_000079584.1.36918 WP_000079584.1.36931 WP_000079584.1.37073 WP_000079584.1.37111 WP_000079584.1.37112 WP_000079584.1.37256 WP_000079584.1.37293 WP_000079584.1.37370 WP_000079584.1.37376 WP_000079584.1.3744 WP_000079584.1.37498 WP_000079584.1.37504 WP_000079584.1.37558 WP_000079584.1.37618 WP_000079584.1.37968 WP_000079584.1.37978 WP_000079584.1.38001 WP_000079584.1.38125 WP_000079584.1.38145 WP_000079584.1.38199 WP_000079584.1.383 WP_000079584.1.38408 WP_000079584.1.3848 WP_000079584.1.38613 WP_000079584.1.38673 WP_000079584.1.38693 WP_000079584.1.38882 WP_000079584.1.38913 WP_000079584.1.38942 WP_000079584.1.39003 WP_000079584.1.39136 WP_000079584.1.39197 WP_000079584.1.39229 WP_000079584.1.39385 WP_000079584.1.39405 WP_000079584.1.39420 WP_000079584.1.39449 WP_000079584.1.39512 WP_000079584.1.39553 WP_000079584.1.39629 WP_000079584.1.39763 WP_000079584.1.39862 WP_000079584.1.39921 WP_000079584.1.39923 WP_000079584.1.40017 WP_000079584.1.40072 WP_000079584.1.40073 WP_000079584.1.4011 WP_000079584.1.40208 WP_000079584.1.40240 WP_000079584.1.40254 WP_000079584.1.40257 WP_000079584.1.40292 WP_000079584.1.40305 WP_000079584.1.40311 WP_000079584.1.40374 WP_000079584.1.40380 WP_000079584.1.40395 WP_000079584.1.40465 WP_000079584.1.40710 WP_000079584.1.4075 WP_000079584.1.4087 WP_000079584.1.40877 WP_000079584.1.41017 WP_000079584.1.41086 WP_000079584.1.41091 WP_000079584.1.41226 WP_000079584.1.41279 WP_000079584.1.41516 WP_000079584.1.41554 WP_000079584.1.41572 WP_000079584.1.41591 WP_000079584.1.41662 WP_000079584.1.41708 WP_000079584.1.41761 WP_000079584.1.41882 WP_000079584.1.41979 WP_000079584.1.41985 WP_000079584.1.42104 WP_000079584.1.42320 WP_000079584.1.42342 WP_000079584.1.42422 WP_000079584.1.4276 WP_000079584.1.42797 WP_000079584.1.42829 WP_000079584.1.42864 WP_000079584.1.4288 WP_000079584.1.42887 WP_000079584.1.42957 WP_000079584.1.43018 WP_000079584.1.43041 WP_000079584.1.43086 WP_000079584.1.43160 WP_000079584.1.43244 WP_000079584.1.43312 WP_000079584.1.43334 WP_000079584.1.43437 WP_000079584.1.43476 WP_000079584.1.43522 WP_000079584.1.43613 WP_000079584.1.43668 WP_000079584.1.43875 WP_000079584.1.43886 WP_000079584.1.44005 WP_000079584.1.44043 WP_000079584.1.4405 WP_000079584.1.44099 WP_000079584.1.44121 WP_000079584.1.44291 WP_000079584.1.44310 WP_000079584.1.44386 WP_000079584.1.44438 WP_000079584.1.44440 WP_000079584.1.44479 WP_000079584.1.44640 WP_000079584.1.4467 WP_000079584.1.44747 WP_000079584.1.44781 WP_000079584.1.4485 WP_000079584.1.44877 WP_000079584.1.44927 WP_000079584.1.45067 WP_000079584.1.45074 WP_000079584.1.45079 WP_000079584.1.45098 WP_000079584.1.45177 WP_000079584.1.45184 WP_000079584.1.45259 WP_000079584.1.45349 WP_000079584.1.45365 WP_000079584.1.45550 WP_000079584.1.45585 WP_000079584.1.45660 WP_000079584.1.45690 WP_000079584.1.458 WP_000079584.1.46011 WP_000079584.1.46028 WP_000079584.1.46069 WP_000079584.1.46091 WP_000079584.1.46112 WP_000079584.1.46173 WP_000079584.1.46174 WP_000079584.1.46187 WP_000079584.1.46250 WP_000079584.1.46286 WP_000079584.1.46303 WP_000079584.1.46322 WP_000079584.1.46345 WP_000079584.1.46574 WP_000079584.1.46595 WP_000079584.1.46666 WP_000079584.1.46675 WP_000079584.1.46689 WP_000079584.1.46730 WP_000079584.1.46803 WP_000079584.1.46961 WP_000079584.1.47057 WP_000079584.1.47214 WP_000079584.1.47429 WP_000079584.1.47448 WP_000079584.1.4747 WP_000079584.1.47472 WP_000079584.1.47478 WP_000079584.1.47587 WP_000079584.1.47621 WP_000079584.1.47649 WP_000079584.1.47714 WP_000079584.1.47799 WP_000079584.1.47814 WP_000079584.1.48132 WP_000079584.1.48209 WP_000079584.1.48242 WP_000079584.1.48253 WP_000079584.1.483 WP_000079584.1.48367 WP_000079584.1.48377 WP_000079584.1.4853 WP_000079584.1.48570 WP_000079584.1.48788 WP_000079584.1.4885 WP_000079584.1.48876 WP_000079584.1.48886 WP_000079584.1.48894 WP_000079584.1.48919 WP_000079584.1.48985 WP_000079584.1.49084 WP_000079584.1.49102 WP_000079584.1.49155 WP_000079584.1.49204 WP_000079584.1.49226 WP_000079584.1.49239 WP_000079584.1.49256 WP_000079584.1.49290 WP_000079584.1.49304 WP_000079584.1.49340 WP_000079584.1.49366 WP_000079584.1.49472 WP_000079584.1.49490 WP_000079584.1.49515 WP_000079584.1.49550 WP_000079584.1.49572 WP_000079584.1.49590 WP_000079584.1.4979 WP_000079584.1.49803 WP_000079584.1.49805 WP_000079584.1.49929 WP_000079584.1.49931 WP_000079584.1.50007 WP_000079584.1.50080 WP_000079584.1.5009 WP_000079584.1.50161 WP_000079584.1.50211 WP_000079584.1.50376 WP_000079584.1.50389 WP_000079584.1.50469 WP_000079584.1.50517 WP_000079584.1.50563 WP_000079584.1.50576 WP_000079584.1.50676 WP_000079584.1.50804 WP_000079584.1.50808 WP_000079584.1.5088 WP_000079584.1.50908 WP_000079584.1.50941 WP_000079584.1.51014 WP_000079584.1.51022 WP_000079584.1.51162 WP_000079584.1.51179 WP_000079584.1.51182 WP_000079584.1.51186 WP_000079584.1.51487 WP_000079584.1.51488 WP_000079584.1.51555 WP_000079584.1.51611 WP_000079584.1.51634 WP_000079584.1.51649 WP_000079584.1.51686 WP_000079584.1.51756 WP_000079584.1.51888 WP_000079584.1.51911 WP_000079584.1.51932 WP_000079584.1.51989 WP_000079584.1.52121 WP_000079584.1.52156 WP_000079584.1.52346 WP_000079584.1.52353 WP_000079584.1.52356 WP_000079584.1.52361 WP_000079584.1.52438 WP_000079584.1.52653 WP_000079584.1.52656 WP_000079584.1.52743 WP_000079584.1.52857 WP_000079584.1.52898 WP_000079584.1.53190 WP_000079584.1.53406 WP_000079584.1.53466 WP_000079584.1.53529 WP_000079584.1.53543 WP_000079584.1.53694 WP_000079584.1.53757 WP_000079584.1.53812 WP_000079584.1.53935 WP_000079584.1.54033 WP_000079584.1.54061 WP_000079584.1.54075 WP_000079584.1.54082 WP_000079584.1.54196 WP_000079584.1.54209 WP_000079584.1.54271 WP_000079584.1.54274 WP_000079584.1.54319 WP_000079584.1.54364 WP_000079584.1.54400 WP_000079584.1.54569 WP_000079584.1.54644 WP_000079584.1.54662 WP_000079584.1.54722 WP_000079584.1.54749 WP_000079584.1.54764 WP_000079584.1.55008 WP_000079584.1.55152 WP_000079584.1.55156 WP_000079584.1.5517 WP_000079584.1.55223 WP_000079584.1.55285 WP_000079584.1.55290 WP_000079584.1.55475 WP_000079584.1.55647 WP_000079584.1.55743 WP_000079584.1.55768 WP_000079584.1.55782 WP_000079584.1.55796 WP_000079584.1.56002 WP_000079584.1.56012 WP_000079584.1.56105 WP_000079584.1.56238 WP_000079584.1.56247 WP_000079584.1.56286 WP_000079584.1.56304 WP_000079584.1.56393 WP_000079584.1.56414 WP_000079584.1.56438 WP_000079584.1.56560 WP_000079584.1.56601 WP_000079584.1.56614 WP_000079584.1.56671 WP_000079584.1.56682 WP_000079584.1.56853 WP_000079584.1.56875 WP_000079584.1.56877 WP_000079584.1.56893 WP_000079584.1.57149 WP_000079584.1.57168 WP_000079584.1.57187 WP_000079584.1.57357 WP_000079584.1.57377 WP_000079584.1.57418 WP_000079584.1.57433 WP_000079584.1.57510 WP_000079584.1.57515 WP_000079584.1.57529 WP_000079584.1.57576 WP_000079584.1.57601 WP_000079584.1.57607 WP_000079584.1.57763 WP_000079584.1.57781 WP_000079584.1.57862 WP_000079584.1.57890 WP_000079584.1.57891 WP_000079584.1.57978 WP_000079584.1.5801 WP_000079584.1.58040 WP_000079584.1.58041 WP_000079584.1.58249 WP_000079584.1.58301 WP_000079584.1.58418 WP_000079584.1.58548 WP_000079584.1.58564 WP_000079584.1.5858 WP_000079584.1.58662 WP_000079584.1.58669 WP_000079584.1.58698 WP_000079584.1.58745 WP_000079584.1.58803 WP_000079584.1.5886 WP_000079584.1.59094 WP_000079584.1.59224 WP_000079584.1.59236 WP_000079584.1.59321 WP_000079584.1.59336 WP_000079584.1.59375 WP_000079584.1.59381 WP_000079584.1.59439 WP_000079584.1.59458 WP_000079584.1.59490 WP_000079584.1.59508 WP_000079584.1.59641 WP_000079584.1.59684 WP_000079584.1.59694 WP_000079584.1.59771 WP_000079584.1.5979 WP_000079584.1.59830 WP_000079584.1.59928 WP_000079584.1.59953 WP_000079584.1.60008 WP_000079584.1.60021 WP_000079584.1.60069 WP_000079584.1.60140 WP_000079584.1.60155 WP_000079584.1.60285 WP_000079584.1.60379 WP_000079584.1.60464 WP_000079584.1.6052 WP_000079584.1.60746 WP_000079584.1.60838 WP_000079584.1.60874 WP_000079584.1.60919 WP_000079584.1.60941 WP_000079584.1.61078 WP_000079584.1.6114 WP_000079584.1.61201 WP_000079584.1.61232 WP_000079584.1.61233 WP_000079584.1.6129 WP_000079584.1.61296 WP_000079584.1.61345 WP_000079584.1.61417 WP_000079584.1.61574 WP_000079584.1.6164 WP_000079584.1.61712 WP_000079584.1.61714 WP_000079584.1.61730 WP_000079584.1.61857 WP_000079584.1.61918 WP_000079584.1.61952 WP_000079584.1.62007 WP_000079584.1.62025 WP_000079584.1.6210 WP_000079584.1.62204 WP_000079584.1.62304 WP_000079584.1.62364 WP_000079584.1.62374 WP_000079584.1.62403 WP_000079584.1.62486 WP_000079584.1.6253 WP_000079584.1.62853 WP_000079584.1.62903 WP_000079584.1.62910 WP_000079584.1.62955 WP_000079584.1.63043 WP_000079584.1.63150 WP_000079584.1.63181 WP_000079584.1.63203 WP_000079584.1.63234 WP_000079584.1.63256 WP_000079584.1.63290 WP_000079584.1.63382 WP_000079584.1.63422 WP_000079584.1.63432 WP_000079584.1.63461 WP_000079584.1.63479 WP_000079584.1.63568 WP_000079584.1.63577 WP_000079584.1.63664 WP_000079584.1.63718 WP_000079584.1.6375 WP_000079584.1.63757 WP_000079584.1.63824 WP_000079584.1.63834 WP_000079584.1.63934 WP_000079584.1.63992 WP_000079584.1.64007 WP_000079584.1.64046 WP_000079584.1.64217 WP_000079584.1.6423 WP_000079584.1.64242 WP_000079584.1.64244 WP_000079584.1.64403 WP_000079584.1.64569 WP_000079584.1.64649 WP_000079584.1.64702 WP_000079584.1.64757 WP_000079584.1.64781 WP_000079584.1.64831 WP_000079584.1.6489 WP_000079584.1.64920 WP_000079584.1.65016 WP_000079584.1.65018 WP_000079584.1.65022 WP_000079584.1.65027 WP_000079584.1.65028 WP_000079584.1.65171 WP_000079584.1.65248 WP_000079584.1.6535 WP_000079584.1.65474 WP_000079584.1.65558 WP_000079584.1.6560 WP_000079584.1.65633 WP_000079584.1.6565 WP_000079584.1.65696 WP_000079584.1.6575 WP_000079584.1.65782 WP_000079584.1.65838 WP_000079584.1.66167 WP_000079584.1.6630 WP_000079584.1.66314 WP_000079584.1.66358 WP_000079584.1.66362 WP_000079584.1.6638 WP_000079584.1.6640 WP_000079584.1.66462 WP_000079584.1.66534 WP_000079584.1.66630 WP_000079584.1.66698 WP_000079584.1.6680 WP_000079584.1.66807 WP_000079584.1.66834 WP_000079584.1.66901 WP_000079584.1.66962 WP_000079584.1.67037 WP_000079584.1.67045 WP_000079584.1.67181 WP_000079584.1.67184 WP_000079584.1.67268 WP_000079584.1.67288 WP_000079584.1.67347 WP_000079584.1.67374 WP_000079584.1.67465 WP_000079584.1.67552 WP_000079584.1.67682 WP_000079584.1.67829 WP_000079584.1.67887 WP_000079584.1.67942 WP_000079584.1.68073 WP_000079584.1.68201 WP_000079584.1.68206 WP_000079584.1.6827 WP_000079584.1.68275 WP_000079584.1.6833 WP_000079584.1.6849 WP_000079584.1.68532 WP_000079584.1.68547 WP_000079584.1.68589 WP_000079584.1.68655 WP_000079584.1.68656 WP_000079584.1.6869 WP_000079584.1.68778 WP_000079584.1.68787 WP_000079584.1.68818 WP_000079584.1.68894 WP_000079584.1.68928 WP_000079584.1.68975 WP_000079584.1.69006 WP_000079584.1.69011 WP_000079584.1.6913 WP_000079584.1.69146 WP_000079584.1.69255 WP_000079584.1.69288 WP_000079584.1.69397 WP_000079584.1.69564 WP_000079584.1.69636 WP_000079584.1.69644 WP_000079584.1.69704 WP_000079584.1.7010 WP_000079584.1.7014 WP_000079584.1.7021 WP_000079584.1.70241 WP_000079584.1.70248 WP_000079584.1.70269 WP_000079584.1.70289 WP_000079584.1.70321 WP_000079584.1.70326 WP_000079584.1.70447 WP_000079584.1.70485 WP_000079584.1.70488 WP_000079584.1.70523 WP_000079584.1.70547 WP_000079584.1.70580 WP_000079584.1.70643 WP_000079584.1.70683 WP_000079584.1.70883 WP_000079584.1.70922 WP_000079584.1.70929 WP_000079584.1.70948 WP_000079584.1.7110 WP_000079584.1.71116 WP_000079584.1.71146 WP_000079584.1.71165 WP_000079584.1.71188 WP_000079584.1.71202 WP_000079584.1.71243 WP_000079584.1.71306 WP_000079584.1.71337 WP_000079584.1.71378 WP_000079584.1.71401 WP_000079584.1.71446 WP_000079584.1.71702 WP_000079584.1.7174 WP_000079584.1.71750 WP_000079584.1.71756 WP_000079584.1.71845 WP_000079584.1.71881 WP_000079584.1.71908 WP_000079584.1.71952 WP_000079584.1.71973 WP_000079584.1.72065 WP_000079584.1.72105 WP_000079584.1.72203 WP_000079584.1.72226 WP_000079584.1.72376 WP_000079584.1.72412 WP_000079584.1.72594 WP_000079584.1.72689 WP_000079584.1.72850 WP_000079584.1.72871 WP_000079584.1.72975 WP_000079584.1.73144 WP_000079584.1.7315 WP_000079584.1.73200 WP_000079584.1.7334 WP_000079584.1.73362 WP_000079584.1.73377 WP_000079584.1.73379 WP_000079584.1.73481 WP_000079584.1.7356 WP_000079584.1.73581 WP_000079584.1.73617 WP_000079584.1.73753 WP_000079584.1.73758 WP_000079584.1.73794 WP_000079584.1.73831 WP_000079584.1.7387 WP_000079584.1.73924 WP_000079584.1.74029 WP_000079584.1.74181 WP_000079584.1.74191 WP_000079584.1.7433 WP_000079584.1.74379 WP_000079584.1.74410 WP_000079584.1.74466 WP_000079584.1.74529 WP_000079584.1.74545 WP_000079584.1.74745 WP_000079584.1.74996 WP_000079584.1.75129 WP_000079584.1.75187 WP_000079584.1.75288 WP_000079584.1.75334 WP_000079584.1.75362 WP_000079584.1.75385 WP_000079584.1.75392 WP_000079584.1.75402 WP_000079584.1.75760 WP_000079584.1.75764 WP_000079584.1.75793 WP_000079584.1.75837 WP_000079584.1.75874 WP_000079584.1.75945 WP_000079584.1.76020 WP_000079584.1.76097 WP_000079584.1.76208 WP_000079584.1.76252 WP_000079584.1.76364 WP_000079584.1.76445 WP_000079584.1.7660 WP_000079584.1.76673 WP_000079584.1.76706 WP_000079584.1.76721 WP_000079584.1.76738 WP_000079584.1.76756 WP_000079584.1.76760 WP_000079584.1.76806 WP_000079584.1.76875 WP_000079584.1.76880 WP_000079584.1.76899 WP_000079584.1.77038 WP_000079584.1.77047 WP_000079584.1.77080 WP_000079584.1.7712 WP_000079584.1.77180 WP_000079584.1.77244 WP_000079584.1.77292 WP_000079584.1.77349 WP_000079584.1.77414 WP_000079584.1.77514 WP_000079584.1.77529 WP_000079584.1.77543 WP_000079584.1.77549 WP_000079584.1.77575 WP_000079584.1.77692 WP_000079584.1.7782 WP_000079584.1.77851 WP_000079584.1.77898 WP_000079584.1.77918 WP_000079584.1.77960 WP_000079584.1.78033 WP_000079584.1.78076 WP_000079584.1.78096 WP_000079584.1.78100 WP_000079584.1.78110 WP_000079584.1.78120 WP_000079584.1.78201 WP_000079584.1.78383 WP_000079584.1.78407 WP_000079584.1.78602 WP_000079584.1.7861 WP_000079584.1.78618 WP_000079584.1.78673 WP_000079584.1.78735 WP_000079584.1.78802 WP_000079584.1.78830 WP_000079584.1.78835 WP_000079584.1.78871 WP_000079584.1.78874 WP_000079584.1.78918 WP_000079584.1.78930 WP_000079584.1.79151 WP_000079584.1.79167 WP_000079584.1.79297 WP_000079584.1.79335 WP_000079584.1.79462 WP_000079584.1.79472 WP_000079584.1.79490 WP_000079584.1.79495 WP_000079584.1.79529 WP_000079584.1.79570 WP_000079584.1.7964 WP_000079584.1.79659 WP_000079584.1.79668 WP_000079584.1.79708 WP_000079584.1.7979 WP_000079584.1.79845 WP_000079584.1.79892 WP_000079584.1.80077 WP_000079584.1.80137 WP_000079584.1.80182 WP_000079584.1.80296 WP_000079584.1.80366 WP_000079584.1.80529 WP_000079584.1.80586 WP_000079584.1.80780 WP_000079584.1.80831 WP_000079584.1.80850 WP_000079584.1.80881 WP_000079584.1.80939 WP_000079584.1.8096 WP_000079584.1.81037 WP_000079584.1.81069 WP_000079584.1.81149 WP_000079584.1.81175 WP_000079584.1.8119 WP_000079584.1.81193 WP_000079584.1.81354 WP_000079584.1.81425 WP_000079584.1.81667 WP_000079584.1.81750 WP_000079584.1.81785 WP_000079584.1.81902 WP_000079584.1.81965 WP_000079584.1.81974 WP_000079584.1.82337 WP_000079584.1.82479 WP_000079584.1.82503 WP_000079584.1.82515 WP_000079584.1.82676 WP_000079584.1.82761 WP_000079584.1.8282 WP_000079584.1.82841 WP_000079584.1.82843 WP_000079584.1.82895 WP_000079584.1.82944 WP_000079584.1.82956 WP_000079584.1.82992 WP_000079584.1.83061 WP_000079584.1.83092 WP_000079584.1.83163 WP_000079584.1.83301 WP_000079584.1.83305 WP_000079584.1.83413 WP_000079584.1.83491 WP_000079584.1.83523 WP_000079584.1.8354 WP_000079584.1.83650 WP_000079584.1.83721 WP_000079584.1.83759 WP_000079584.1.83760 WP_000079584.1.83854 WP_000079584.1.83979 WP_000079584.1.83995 WP_000079584.1.84103 WP_000079584.1.84283 WP_000079584.1.84355 WP_000079584.1.84392 WP_000079584.1.8441 WP_000079584.1.84532 WP_000079584.1.84554 WP_000079584.1.84659 WP_000079584.1.84899 WP_000079584.1.8497 WP_000079584.1.85014 WP_000079584.1.85040 WP_000079584.1.85120 WP_000079584.1.85134 WP_000079584.1.85147 WP_000079584.1.85178 WP_000079584.1.85180 WP_000079584.1.85190 WP_000079584.1.8533 WP_000079584.1.8545 WP_000079584.1.85481 WP_000079584.1.85483 WP_000079584.1.8552 WP_000079584.1.85541 WP_000079584.1.8556 WP_000079584.1.85615 WP_000079584.1.85617 WP_000079584.1.85663 WP_000079584.1.85671 WP_000079584.1.85672 WP_000079584.1.85777 WP_000079584.1.85886 WP_000079584.1.85900 WP_000079584.1.85904 WP_000079584.1.85976 WP_000079584.1.86017 WP_000079584.1.86306 WP_000079584.1.86356 WP_000079584.1.86450 WP_000079584.1.86453 WP_000079584.1.86469 WP_000079584.1.86580 WP_000079584.1.86588 WP_000079584.1.86634 WP_000079584.1.86661 WP_000079584.1.8672 WP_000079584.1.8678 WP_000079584.1.86810 WP_000079584.1.8684 WP_000079584.1.86895 WP_000079584.1.86906 WP_000079584.1.86982 WP_000079584.1.87095 WP_000079584.1.87143 WP_000079584.1.87283 WP_000079584.1.87323 WP_000079584.1.8736 WP_000079584.1.87460 WP_000079584.1.87552 WP_000079584.1.87779 WP_000079584.1.87875 WP_000079584.1.87945 WP_000079584.1.88019 WP_000079584.1.88073 WP_000079584.1.8809 WP_000079584.1.88291 WP_000079584.1.88293 WP_000079584.1.88303 WP_000079584.1.8837 WP_000079584.1.88393 WP_000079584.1.88703 WP_000079584.1.88762 WP_000079584.1.88792 WP_000079584.1.88902 WP_000079584.1.8891 WP_000079584.1.88942 WP_000079584.1.88981 WP_000079584.1.89008 WP_000079584.1.89116 WP_000079584.1.89138 WP_000079584.1.89304 WP_000079584.1.89512 WP_000079584.1.89527 WP_000079584.1.89570 WP_000079584.1.8958 WP_000079584.1.89604 WP_000079584.1.89622 WP_000079584.1.89659 WP_000079584.1.89902 WP_000079584.1.8996 WP_000079584.1.9002 WP_000079584.1.90084 WP_000079584.1.90097 WP_000079584.1.90248 WP_000079584.1.90252 WP_000079584.1.90348 WP_000079584.1.90417 WP_000079584.1.90453 WP_000079584.1.90458 WP_000079584.1.90557 WP_000079584.1.90585 WP_000079584.1.90641 WP_000079584.1.90734 WP_000079584.1.90866 WP_000079584.1.91003 WP_000079584.1.91049 WP_000079584.1.91069 WP_000079584.1.91278 WP_000079584.1.91470 WP_000079584.1.91512 WP_000079584.1.91564 WP_000079584.1.91628 WP_000079584.1.91655 WP_000079584.1.91724 WP_000079584.1.91732 WP_000079584.1.91788 WP_000079584.1.91903 WP_000079584.1.92013 WP_000079584.1.92047 WP_000079584.1.92093 WP_000079584.1.92108 WP_000079584.1.92183 WP_000079584.1.92208 WP_000079584.1.92268 WP_000079584.1.92310 WP_000079584.1.92375 WP_000079584.1.92439 WP_000079584.1.92443 WP_000079584.1.92482 WP_000079584.1.92531 WP_000079584.1.92562 WP_000079584.1.92669 WP_000079584.1.92671 WP_000079584.1.92729 WP_000079584.1.92738 WP_000079584.1.92975 WP_000079584.1.92988 WP_000079584.1.93086 WP_000079584.1.93101 WP_000079584.1.93136 WP_000079584.1.93155 WP_000079584.1.93365 WP_000079584.1.93543 WP_000079584.1.93596 WP_000079584.1.93650 WP_000079584.1.93656 WP_000079584.1.93662 WP_000079584.1.937 WP_000079584.1.93705 WP_000079584.1.93761 WP_000079584.1.93804 WP_000079584.1.9389 WP_000079584.1.93956 WP_000079584.1.93994 WP_000079584.1.94072 WP_000079584.1.94162 WP_000079584.1.94168 WP_000079584.1.94198 WP_000079584.1.9432 WP_000079584.1.94354 WP_000079584.1.94380 WP_000079584.1.94458 WP_000079584.1.94565 WP_000079584.1.94584 WP_000079584.1.94674 WP_000079584.1.94796 WP_000079584.1.94959 WP_000079584.1.95051 WP_000079584.1.95085 WP_000079584.1.95121 WP_000079584.1.9516 WP_000079584.1.95282 WP_000079584.1.95546 WP_000079584.1.95630 WP_000079584.1.95911 WP_000079584.1.96054 WP_000079584.1.96139 WP_000079584.1.96317 WP_000079584.1.96335 WP_000079584.1.96343 WP_000079584.1.9644 WP_000079584.1.96469 WP_000079584.1.96500 WP_000079584.1.96555 WP_000079584.1.96563 WP_000079584.1.96590 WP_000079584.1.96732 WP_000079584.1.96771 WP_000079584.1.96798 WP_000079584.1.96917 WP_000079584.1.97015 WP_000079584.1.97145 WP_000079584.1.97190 WP_000079584.1.97318 WP_000079584.1.97369 WP_000079584.1.97594 WP_000079584.1.97597 WP_000079584.1.97613 WP_000079584.1.97620 WP_000079584.1.97727 WP_000079584.1.97732 WP_000079584.1.97736 WP_000079584.1.9775 WP_000079584.1.97846 WP_000079584.1.98006 WP_000079584.1.98019 WP_000079584.1.98022 WP_000079584.1.98110 WP_000079584.1.98146 WP_000079584.1.98219 WP_000079584.1.98250 WP_000079584.1.98314 WP_000079584.1.9841 WP_000079584.1.98495 WP_000079584.1.98513 WP_000079584.1.98531 WP_000079584.1.98577 WP_000079584.1.98676 WP_000079584.1.98677 WP_000079584.1.98760 WP_000079584.1.98843 WP_000079584.1.98899 WP_000079584.1.9898 WP_000079584.1.99098 WP_000079584.1.99184 WP_000079584.1.99267 WP_000079584.1.99276 WP_000079584.1.99646 WP_000079584.1.99657 WP_000079584.1.99660 WP_000079584.1.99712 WP_000079584.1.99725 WP_000079584.1.99813 WP_000079584.1.99858 WP_000079584.1.99889 WP_000079584.1.99958 gi|378988321|ref|YP_005251485.1| gi|482904483|ref|YP_007903043.1| 423368.SNSL254_A1010 99287.STM0977 gi|378983535|ref|YP_005246690.1| gi|378449336|ref|YP_005236695.1| gi|378444414|ref|YP_005232046.1| gi|525838707|ref|YP_008255831.1| gi|550900351|ref|YP_008669443.1| gi|378698872|ref|YP_005180829.1| gi|549723621|ref|YP_008643811.1| gi|383495716|ref|YP_005396405.1| gi|525947783|ref|YP_008309247.1| gi|528818704|ref|YP_008359907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]