SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482904628|ref|YP_007903188.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482904628|ref|YP_007903188.1|
Domain Number 1 Region: 1-421
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.95e-136
Family GABA-aminotransferase-like 0.000000000000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|482904628|ref|YP_007903188.1|
Sequence length 429
Comment adenosylmethionine--8-amino-7-oxononanoate transaminase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MTTDDLAFDKRHIWHPYTSMTSPLPVYPVERAEGCELVLASGKRLIEGMSSWWAAIHGYN
HPQLNAAMKAQIDAMSHVMFGGITHQPAVNLCRKLVAITPEPLECVFLADSGSVSVEVAM
KMALQYWQARGESRQRFLTFRHGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQS
RMDGEWDESDIAPFARLMAAHRHEIAAVILEPIVQGAGGMRIYHPQWLRRIRNMCDREGI
LLIADEIATGFGRTGKLFACEHAGIAPDILCLGKALTGGTMTLSATLTTRQVAETISNGE
AGCFMHGPTFMGNPLACAVACANLTLLESGEWRQQVASIESQLRAELAPAQSSPWVADVR
VLGAIGVVETTHPVNMAALQRFFVGQGVWIRPFGKLIYLMPPYIIRPDQLRRLTQAVNDA
VHNETFFSH
Download sequence
Identical sequences A0A0D6GZ72 A0A0F6AYU3 A0A0F7J7H1 A0A0H3NAZ3 A0A0U1GWL0 A0A0W4Q3R4 A0A2D3AMQ6 A0A2H9YES8 E8XBQ7 P12677
99287.STM0793 gi|378698731|ref|YP_005180688.1| gi|383495577|ref|YP_005396266.1| gi|378444272|ref|YP_005231904.1| ABAO01000039|CDS_39405-38116 AE006468|CDS_860083-858794 CP001363|CDS_860424-859135 FN424405|CDS_898735-897446 gi|16764156|ref|NP_459771.1| gi|549723480|ref|YP_008643670.1| IDP00936 gi|482904628|ref|YP_007903188.1| gi|378449153|ref|YP_005236512.1| gi|378983388|ref|YP_005246543.1| NP_459771.1.58477 WP_000205518.1.100010 WP_000205518.1.100234 WP_000205518.1.100376 WP_000205518.1.100424 WP_000205518.1.100436 WP_000205518.1.100484 WP_000205518.1.100488 WP_000205518.1.100597 WP_000205518.1.10076 WP_000205518.1.100781 WP_000205518.1.100793 WP_000205518.1.100869 WP_000205518.1.100871 WP_000205518.1.100882 WP_000205518.1.101020 WP_000205518.1.101074 WP_000205518.1.101078 WP_000205518.1.101180 WP_000205518.1.101259 WP_000205518.1.101284 WP_000205518.1.101353 WP_000205518.1.101386 WP_000205518.1.101404 WP_000205518.1.101420 WP_000205518.1.101589 WP_000205518.1.101707 WP_000205518.1.101734 WP_000205518.1.101953 WP_000205518.1.10220 WP_000205518.1.10266 WP_000205518.1.10439 WP_000205518.1.10678 WP_000205518.1.10753 WP_000205518.1.10992 WP_000205518.1.11024 WP_000205518.1.11031 WP_000205518.1.11098 WP_000205518.1.11168 WP_000205518.1.11190 WP_000205518.1.11295 WP_000205518.1.11455 WP_000205518.1.11458 WP_000205518.1.11518 WP_000205518.1.11532 WP_000205518.1.11763 WP_000205518.1.11897 WP_000205518.1.12114 WP_000205518.1.12351 WP_000205518.1.12370 WP_000205518.1.12546 WP_000205518.1.1264 WP_000205518.1.12728 WP_000205518.1.12879 WP_000205518.1.12936 WP_000205518.1.12995 WP_000205518.1.13027 WP_000205518.1.13106 WP_000205518.1.13130 WP_000205518.1.13414 WP_000205518.1.13488 WP_000205518.1.13509 WP_000205518.1.13669 WP_000205518.1.13741 WP_000205518.1.1387 WP_000205518.1.13908 WP_000205518.1.13932 WP_000205518.1.13968 WP_000205518.1.14001 WP_000205518.1.14151 WP_000205518.1.14239 WP_000205518.1.14320 WP_000205518.1.14379 WP_000205518.1.14406 WP_000205518.1.14410 WP_000205518.1.14466 WP_000205518.1.14524 WP_000205518.1.14554 WP_000205518.1.14725 WP_000205518.1.14852 WP_000205518.1.1489 WP_000205518.1.14932 WP_000205518.1.15124 WP_000205518.1.15223 WP_000205518.1.15226 WP_000205518.1.15316 WP_000205518.1.15369 WP_000205518.1.1540 WP_000205518.1.15508 WP_000205518.1.15784 WP_000205518.1.15830 WP_000205518.1.16062 WP_000205518.1.16063 WP_000205518.1.16103 WP_000205518.1.16226 WP_000205518.1.16233 WP_000205518.1.16284 WP_000205518.1.16328 WP_000205518.1.1635 WP_000205518.1.16468 WP_000205518.1.16614 WP_000205518.1.16650 WP_000205518.1.16686 WP_000205518.1.16691 WP_000205518.1.16732 WP_000205518.1.16735 WP_000205518.1.16786 WP_000205518.1.16858 WP_000205518.1.16896 WP_000205518.1.16916 WP_000205518.1.16965 WP_000205518.1.1700 WP_000205518.1.17307 WP_000205518.1.174 WP_000205518.1.17480 WP_000205518.1.17546 WP_000205518.1.17702 WP_000205518.1.17705 WP_000205518.1.18019 WP_000205518.1.18111 WP_000205518.1.18163 WP_000205518.1.18265 WP_000205518.1.18267 WP_000205518.1.18468 WP_000205518.1.18607 WP_000205518.1.18705 WP_000205518.1.18715 WP_000205518.1.18776 WP_000205518.1.18822 WP_000205518.1.18881 WP_000205518.1.18940 WP_000205518.1.18949 WP_000205518.1.19053 WP_000205518.1.19320 WP_000205518.1.19458 WP_000205518.1.19460 WP_000205518.1.19461 WP_000205518.1.19614 WP_000205518.1.19702 WP_000205518.1.19706 WP_000205518.1.19724 WP_000205518.1.19749 WP_000205518.1.19784 WP_000205518.1.19802 WP_000205518.1.19809 WP_000205518.1.19867 WP_000205518.1.1998 WP_000205518.1.20 WP_000205518.1.2010 WP_000205518.1.20212 WP_000205518.1.20266 WP_000205518.1.20271 WP_000205518.1.20362 WP_000205518.1.20418 WP_000205518.1.20443 WP_000205518.1.20525 WP_000205518.1.2054 WP_000205518.1.20553 WP_000205518.1.20626 WP_000205518.1.20646 WP_000205518.1.20908 WP_000205518.1.21049 WP_000205518.1.21146 WP_000205518.1.21245 WP_000205518.1.21246 WP_000205518.1.21269 WP_000205518.1.21400 WP_000205518.1.21497 WP_000205518.1.21499 WP_000205518.1.21603 WP_000205518.1.21751 WP_000205518.1.21757 WP_000205518.1.22024 WP_000205518.1.2205 WP_000205518.1.22062 WP_000205518.1.22067 WP_000205518.1.2221 WP_000205518.1.2235 WP_000205518.1.22379 WP_000205518.1.22427 WP_000205518.1.2246 WP_000205518.1.22485 WP_000205518.1.22620 WP_000205518.1.22870 WP_000205518.1.22979 WP_000205518.1.23102 WP_000205518.1.23114 WP_000205518.1.2314 WP_000205518.1.23192 WP_000205518.1.23259 WP_000205518.1.23460 WP_000205518.1.23472 WP_000205518.1.23482 WP_000205518.1.23634 WP_000205518.1.2364 WP_000205518.1.23932 WP_000205518.1.24017 WP_000205518.1.24206 WP_000205518.1.24308 WP_000205518.1.24578 WP_000205518.1.24737 WP_000205518.1.24779 WP_000205518.1.25008 WP_000205518.1.25015 WP_000205518.1.25405 WP_000205518.1.25454 WP_000205518.1.25493 WP_000205518.1.25668 WP_000205518.1.25690 WP_000205518.1.2570 WP_000205518.1.25740 WP_000205518.1.25793 WP_000205518.1.25814 WP_000205518.1.25988 WP_000205518.1.26282 WP_000205518.1.26311 WP_000205518.1.26319 WP_000205518.1.26429 WP_000205518.1.26440 WP_000205518.1.26493 WP_000205518.1.26551 WP_000205518.1.26567 WP_000205518.1.27010 WP_000205518.1.27173 WP_000205518.1.27206 WP_000205518.1.27423 WP_000205518.1.2763 WP_000205518.1.27665 WP_000205518.1.27707 WP_000205518.1.27761 WP_000205518.1.2777 WP_000205518.1.27857 WP_000205518.1.27977 WP_000205518.1.28094 WP_000205518.1.28170 WP_000205518.1.28302 WP_000205518.1.2835 WP_000205518.1.28370 WP_000205518.1.28538 WP_000205518.1.28575 WP_000205518.1.28625 WP_000205518.1.28655 WP_000205518.1.28694 WP_000205518.1.2879 WP_000205518.1.2890 WP_000205518.1.28938 WP_000205518.1.28946 WP_000205518.1.29006 WP_000205518.1.29010 WP_000205518.1.2910 WP_000205518.1.29588 WP_000205518.1.29601 WP_000205518.1.29606 WP_000205518.1.29615 WP_000205518.1.29619 WP_000205518.1.29704 WP_000205518.1.29969 WP_000205518.1.30006 WP_000205518.1.30027 WP_000205518.1.30180 WP_000205518.1.30469 WP_000205518.1.30507 WP_000205518.1.30535 WP_000205518.1.30547 WP_000205518.1.30794 WP_000205518.1.30833 WP_000205518.1.30835 WP_000205518.1.30972 WP_000205518.1.31 WP_000205518.1.3113 WP_000205518.1.31185 WP_000205518.1.3119 WP_000205518.1.31190 WP_000205518.1.31195 WP_000205518.1.31196 WP_000205518.1.31281 WP_000205518.1.31362 WP_000205518.1.31504 WP_000205518.1.31515 WP_000205518.1.31578 WP_000205518.1.31658 WP_000205518.1.31940 WP_000205518.1.31967 WP_000205518.1.31972 WP_000205518.1.32192 WP_000205518.1.32206 WP_000205518.1.32438 WP_000205518.1.32515 WP_000205518.1.32660 WP_000205518.1.32702 WP_000205518.1.32714 WP_000205518.1.32786 WP_000205518.1.32804 WP_000205518.1.32907 WP_000205518.1.33030 WP_000205518.1.33127 WP_000205518.1.33143 WP_000205518.1.33248 WP_000205518.1.33261 WP_000205518.1.333 WP_000205518.1.33492 WP_000205518.1.33553 WP_000205518.1.33592 WP_000205518.1.33894 WP_000205518.1.34043 WP_000205518.1.34075 WP_000205518.1.34257 WP_000205518.1.34279 WP_000205518.1.34319 WP_000205518.1.34453 WP_000205518.1.34610 WP_000205518.1.34856 WP_000205518.1.34975 WP_000205518.1.35045 WP_000205518.1.35184 WP_000205518.1.35404 WP_000205518.1.35408 WP_000205518.1.35425 WP_000205518.1.35446 WP_000205518.1.35463 WP_000205518.1.35503 WP_000205518.1.35509 WP_000205518.1.35590 WP_000205518.1.35940 WP_000205518.1.36003 WP_000205518.1.3601 WP_000205518.1.36609 WP_000205518.1.36690 WP_000205518.1.3670 WP_000205518.1.36705 WP_000205518.1.36918 WP_000205518.1.36931 WP_000205518.1.37073 WP_000205518.1.37111 WP_000205518.1.37112 WP_000205518.1.37293 WP_000205518.1.37370 WP_000205518.1.37376 WP_000205518.1.3744 WP_000205518.1.37498 WP_000205518.1.37504 WP_000205518.1.37618 WP_000205518.1.37968 WP_000205518.1.37978 WP_000205518.1.38125 WP_000205518.1.38145 WP_000205518.1.383 WP_000205518.1.3848 WP_000205518.1.38613 WP_000205518.1.38673 WP_000205518.1.38693 WP_000205518.1.38773 WP_000205518.1.38882 WP_000205518.1.38913 WP_000205518.1.39003 WP_000205518.1.39136 WP_000205518.1.39197 WP_000205518.1.39229 WP_000205518.1.39405 WP_000205518.1.39420 WP_000205518.1.39449 WP_000205518.1.39512 WP_000205518.1.39629 WP_000205518.1.39763 WP_000205518.1.39862 WP_000205518.1.39921 WP_000205518.1.39923 WP_000205518.1.40017 WP_000205518.1.40072 WP_000205518.1.40073 WP_000205518.1.4011 WP_000205518.1.40208 WP_000205518.1.40240 WP_000205518.1.40257 WP_000205518.1.40292 WP_000205518.1.40305 WP_000205518.1.40311 WP_000205518.1.40380 WP_000205518.1.40395 WP_000205518.1.40465 WP_000205518.1.40710 WP_000205518.1.4075 WP_000205518.1.4087 WP_000205518.1.40877 WP_000205518.1.41017 WP_000205518.1.41086 WP_000205518.1.41091 WP_000205518.1.41226 WP_000205518.1.41279 WP_000205518.1.41516 WP_000205518.1.41554 WP_000205518.1.41572 WP_000205518.1.41591 WP_000205518.1.41662 WP_000205518.1.41761 WP_000205518.1.41882 WP_000205518.1.41979 WP_000205518.1.41985 WP_000205518.1.42104 WP_000205518.1.42320 WP_000205518.1.42342 WP_000205518.1.42422 WP_000205518.1.4276 WP_000205518.1.42864 WP_000205518.1.4288 WP_000205518.1.43018 WP_000205518.1.43041 WP_000205518.1.43244 WP_000205518.1.43312 WP_000205518.1.43334 WP_000205518.1.43437 WP_000205518.1.43522 WP_000205518.1.43613 WP_000205518.1.43668 WP_000205518.1.43886 WP_000205518.1.44043 WP_000205518.1.44099 WP_000205518.1.44121 WP_000205518.1.44291 WP_000205518.1.44310 WP_000205518.1.44479 WP_000205518.1.44640 WP_000205518.1.4467 WP_000205518.1.44747 WP_000205518.1.4485 WP_000205518.1.44877 WP_000205518.1.44927 WP_000205518.1.45067 WP_000205518.1.45074 WP_000205518.1.45079 WP_000205518.1.45098 WP_000205518.1.45177 WP_000205518.1.45184 WP_000205518.1.45259 WP_000205518.1.45349 WP_000205518.1.45365 WP_000205518.1.45550 WP_000205518.1.45585 WP_000205518.1.45660 WP_000205518.1.45690 WP_000205518.1.458 WP_000205518.1.46011 WP_000205518.1.46069 WP_000205518.1.46112 WP_000205518.1.46174 WP_000205518.1.46187 WP_000205518.1.46303 WP_000205518.1.46595 WP_000205518.1.46675 WP_000205518.1.47057 WP_000205518.1.47214 WP_000205518.1.47429 WP_000205518.1.47448 WP_000205518.1.4747 WP_000205518.1.47472 WP_000205518.1.47478 WP_000205518.1.47621 WP_000205518.1.47799 WP_000205518.1.48242 WP_000205518.1.48253 WP_000205518.1.483 WP_000205518.1.48367 WP_000205518.1.48377 WP_000205518.1.4853 WP_000205518.1.48788 WP_000205518.1.4885 WP_000205518.1.48876 WP_000205518.1.48894 WP_000205518.1.48919 WP_000205518.1.49084 WP_000205518.1.49155 WP_000205518.1.49204 WP_000205518.1.49239 WP_000205518.1.49256 WP_000205518.1.49290 WP_000205518.1.49340 WP_000205518.1.49366 WP_000205518.1.49490 WP_000205518.1.49515 WP_000205518.1.49572 WP_000205518.1.4979 WP_000205518.1.49803 WP_000205518.1.49805 WP_000205518.1.49929 WP_000205518.1.50080 WP_000205518.1.50161 WP_000205518.1.50211 WP_000205518.1.50376 WP_000205518.1.50389 WP_000205518.1.50676 WP_000205518.1.50804 WP_000205518.1.50808 WP_000205518.1.5088 WP_000205518.1.50908 WP_000205518.1.50941 WP_000205518.1.51014 WP_000205518.1.51022 WP_000205518.1.51179 WP_000205518.1.51182 WP_000205518.1.51186 WP_000205518.1.51487 WP_000205518.1.51488 WP_000205518.1.51634 WP_000205518.1.51649 WP_000205518.1.51686 WP_000205518.1.51756 WP_000205518.1.51911 WP_000205518.1.51932 WP_000205518.1.51989 WP_000205518.1.52121 WP_000205518.1.52346 WP_000205518.1.52353 WP_000205518.1.52361 WP_000205518.1.52656 WP_000205518.1.52743 WP_000205518.1.52857 WP_000205518.1.52898 WP_000205518.1.52915 WP_000205518.1.53190 WP_000205518.1.53406 WP_000205518.1.53466 WP_000205518.1.53529 WP_000205518.1.53543 WP_000205518.1.53757 WP_000205518.1.53812 WP_000205518.1.54033 WP_000205518.1.54075 WP_000205518.1.54196 WP_000205518.1.54209 WP_000205518.1.54271 WP_000205518.1.54319 WP_000205518.1.54364 WP_000205518.1.54400 WP_000205518.1.54644 WP_000205518.1.54662 WP_000205518.1.54722 WP_000205518.1.54749 WP_000205518.1.54764 WP_000205518.1.55008 WP_000205518.1.55152 WP_000205518.1.55156 WP_000205518.1.55285 WP_000205518.1.55475 WP_000205518.1.55647 WP_000205518.1.55743 WP_000205518.1.55768 WP_000205518.1.55782 WP_000205518.1.55796 WP_000205518.1.56002 WP_000205518.1.56012 WP_000205518.1.56105 WP_000205518.1.56238 WP_000205518.1.56304 WP_000205518.1.56414 WP_000205518.1.56438 WP_000205518.1.56560 WP_000205518.1.56601 WP_000205518.1.56614 WP_000205518.1.56671 WP_000205518.1.56682 WP_000205518.1.56875 WP_000205518.1.56877 WP_000205518.1.57168 WP_000205518.1.57187 WP_000205518.1.57377 WP_000205518.1.57433 WP_000205518.1.57515 WP_000205518.1.57529 WP_000205518.1.57576 WP_000205518.1.57601 WP_000205518.1.57607 WP_000205518.1.57763 WP_000205518.1.57862 WP_000205518.1.57890 WP_000205518.1.57891 WP_000205518.1.57978 WP_000205518.1.5801 WP_000205518.1.58041 WP_000205518.1.58418 WP_000205518.1.58548 WP_000205518.1.5858 WP_000205518.1.58662 WP_000205518.1.58669 WP_000205518.1.58745 WP_000205518.1.58803 WP_000205518.1.5886 WP_000205518.1.59094 WP_000205518.1.59224 WP_000205518.1.59458 WP_000205518.1.59490 WP_000205518.1.59508 WP_000205518.1.59684 WP_000205518.1.59694 WP_000205518.1.59771 WP_000205518.1.5979 WP_000205518.1.59953 WP_000205518.1.60008 WP_000205518.1.60021 WP_000205518.1.60069 WP_000205518.1.60140 WP_000205518.1.60155 WP_000205518.1.60285 WP_000205518.1.60379 WP_000205518.1.60464 WP_000205518.1.60874 WP_000205518.1.60941 WP_000205518.1.61078 WP_000205518.1.6114 WP_000205518.1.61232 WP_000205518.1.6129 WP_000205518.1.61296 WP_000205518.1.61345 WP_000205518.1.61417 WP_000205518.1.61574 WP_000205518.1.61712 WP_000205518.1.61714 WP_000205518.1.61730 WP_000205518.1.61857 WP_000205518.1.61918 WP_000205518.1.61952 WP_000205518.1.62007 WP_000205518.1.62025 WP_000205518.1.62204 WP_000205518.1.62304 WP_000205518.1.62364 WP_000205518.1.62403 WP_000205518.1.6253 WP_000205518.1.62903 WP_000205518.1.62955 WP_000205518.1.63181 WP_000205518.1.63203 WP_000205518.1.63256 WP_000205518.1.63290 WP_000205518.1.63382 WP_000205518.1.63432 WP_000205518.1.63479 WP_000205518.1.63577 WP_000205518.1.63664 WP_000205518.1.63718 WP_000205518.1.6375 WP_000205518.1.63757 WP_000205518.1.63834 WP_000205518.1.64046 WP_000205518.1.6423 WP_000205518.1.64244 WP_000205518.1.64403 WP_000205518.1.64649 WP_000205518.1.64702 WP_000205518.1.64757 WP_000205518.1.64781 WP_000205518.1.64831 WP_000205518.1.6489 WP_000205518.1.65018 WP_000205518.1.65028 WP_000205518.1.65171 WP_000205518.1.65248 WP_000205518.1.6535 WP_000205518.1.65474 WP_000205518.1.65633 WP_000205518.1.6565 WP_000205518.1.65696 WP_000205518.1.6575 WP_000205518.1.65782 WP_000205518.1.6630 WP_000205518.1.66314 WP_000205518.1.66358 WP_000205518.1.66362 WP_000205518.1.6638 WP_000205518.1.6640 WP_000205518.1.66698 WP_000205518.1.66834 WP_000205518.1.66901 WP_000205518.1.66962 WP_000205518.1.67037 WP_000205518.1.67045 WP_000205518.1.67181 WP_000205518.1.67268 WP_000205518.1.67347 WP_000205518.1.67465 WP_000205518.1.67552 WP_000205518.1.67682 WP_000205518.1.67887 WP_000205518.1.68073 WP_000205518.1.68201 WP_000205518.1.68206 WP_000205518.1.6827 WP_000205518.1.68275 WP_000205518.1.6849 WP_000205518.1.68547 WP_000205518.1.68589 WP_000205518.1.68655 WP_000205518.1.68656 WP_000205518.1.68778 WP_000205518.1.68787 WP_000205518.1.68894 WP_000205518.1.68928 WP_000205518.1.68975 WP_000205518.1.69006 WP_000205518.1.6913 WP_000205518.1.69146 WP_000205518.1.69255 WP_000205518.1.69397 WP_000205518.1.69564 WP_000205518.1.69644 WP_000205518.1.69704 WP_000205518.1.7021 WP_000205518.1.70241 WP_000205518.1.70269 WP_000205518.1.70289 WP_000205518.1.70447 WP_000205518.1.70643 WP_000205518.1.70683 WP_000205518.1.70883 WP_000205518.1.70922 WP_000205518.1.70948 WP_000205518.1.71116 WP_000205518.1.71165 WP_000205518.1.71188 WP_000205518.1.71202 WP_000205518.1.71243 WP_000205518.1.71306 WP_000205518.1.71337 WP_000205518.1.71378 WP_000205518.1.71702 WP_000205518.1.71750 WP_000205518.1.71845 WP_000205518.1.71881 WP_000205518.1.71908 WP_000205518.1.71952 WP_000205518.1.71973 WP_000205518.1.72105 WP_000205518.1.72203 WP_000205518.1.72376 WP_000205518.1.72594 WP_000205518.1.72871 WP_000205518.1.72975 WP_000205518.1.7315 WP_000205518.1.73200 WP_000205518.1.7334 WP_000205518.1.73377 WP_000205518.1.73481 WP_000205518.1.7356 WP_000205518.1.73581 WP_000205518.1.73617 WP_000205518.1.73753 WP_000205518.1.73758 WP_000205518.1.73794 WP_000205518.1.7387 WP_000205518.1.73924 WP_000205518.1.74029 WP_000205518.1.74181 WP_000205518.1.74191 WP_000205518.1.7433 WP_000205518.1.74379 WP_000205518.1.74410 WP_000205518.1.74466 WP_000205518.1.74529 WP_000205518.1.74545 WP_000205518.1.74745 WP_000205518.1.75187 WP_000205518.1.75288 WP_000205518.1.75334 WP_000205518.1.75362 WP_000205518.1.75385 WP_000205518.1.75392 WP_000205518.1.75760 WP_000205518.1.75764 WP_000205518.1.75837 WP_000205518.1.75874 WP_000205518.1.75945 WP_000205518.1.76020 WP_000205518.1.76252 WP_000205518.1.76445 WP_000205518.1.7660 WP_000205518.1.76673 WP_000205518.1.76706 WP_000205518.1.76721 WP_000205518.1.76756 WP_000205518.1.76760 WP_000205518.1.76875 WP_000205518.1.76880 WP_000205518.1.76899 WP_000205518.1.77038 WP_000205518.1.77047 WP_000205518.1.77080 WP_000205518.1.7712 WP_000205518.1.77180 WP_000205518.1.77244 WP_000205518.1.77292 WP_000205518.1.77349 WP_000205518.1.77514 WP_000205518.1.77529 WP_000205518.1.77549 WP_000205518.1.77692 WP_000205518.1.7782 WP_000205518.1.77851 WP_000205518.1.77898 WP_000205518.1.77918 WP_000205518.1.77960 WP_000205518.1.78033 WP_000205518.1.78076 WP_000205518.1.78096 WP_000205518.1.78100 WP_000205518.1.78110 WP_000205518.1.78120 WP_000205518.1.78383 WP_000205518.1.78407 WP_000205518.1.7861 WP_000205518.1.78618 WP_000205518.1.78673 WP_000205518.1.78735 WP_000205518.1.78802 WP_000205518.1.78830 WP_000205518.1.78835 WP_000205518.1.78918 WP_000205518.1.78930 WP_000205518.1.79151 WP_000205518.1.79167 WP_000205518.1.79335 WP_000205518.1.79462 WP_000205518.1.79472 WP_000205518.1.79490 WP_000205518.1.79495 WP_000205518.1.79529 WP_000205518.1.79570 WP_000205518.1.7964 WP_000205518.1.79659 WP_000205518.1.79668 WP_000205518.1.79708 WP_000205518.1.79845 WP_000205518.1.80077 WP_000205518.1.80137 WP_000205518.1.80182 WP_000205518.1.80296 WP_000205518.1.80366 WP_000205518.1.80831 WP_000205518.1.80850 WP_000205518.1.80881 WP_000205518.1.80939 WP_000205518.1.8096 WP_000205518.1.81037 WP_000205518.1.81069 WP_000205518.1.81149 WP_000205518.1.81175 WP_000205518.1.8119 WP_000205518.1.81193 WP_000205518.1.81425 WP_000205518.1.81750 WP_000205518.1.81785 WP_000205518.1.81902 WP_000205518.1.81974 WP_000205518.1.82337 WP_000205518.1.82479 WP_000205518.1.82503 WP_000205518.1.82515 WP_000205518.1.82676 WP_000205518.1.82761 WP_000205518.1.8282 WP_000205518.1.82944 WP_000205518.1.82956 WP_000205518.1.83092 WP_000205518.1.83163 WP_000205518.1.83305 WP_000205518.1.83413 WP_000205518.1.83491 WP_000205518.1.83523 WP_000205518.1.8354 WP_000205518.1.83721 WP_000205518.1.83760 WP_000205518.1.83995 WP_000205518.1.84103 WP_000205518.1.84283 WP_000205518.1.84392 WP_000205518.1.8441 WP_000205518.1.84554 WP_000205518.1.84659 WP_000205518.1.84899 WP_000205518.1.8497 WP_000205518.1.85040 WP_000205518.1.85134 WP_000205518.1.85178 WP_000205518.1.85180 WP_000205518.1.85190 WP_000205518.1.85481 WP_000205518.1.85483 WP_000205518.1.8556 WP_000205518.1.85615 WP_000205518.1.85617 WP_000205518.1.85663 WP_000205518.1.85671 WP_000205518.1.85672 WP_000205518.1.85777 WP_000205518.1.85886 WP_000205518.1.85900 WP_000205518.1.85904 WP_000205518.1.85976 WP_000205518.1.86306 WP_000205518.1.86356 WP_000205518.1.86450 WP_000205518.1.86469 WP_000205518.1.86580 WP_000205518.1.86588 WP_000205518.1.86661 WP_000205518.1.8672 WP_000205518.1.8678 WP_000205518.1.86810 WP_000205518.1.8684 WP_000205518.1.86895 WP_000205518.1.86906 WP_000205518.1.87095 WP_000205518.1.87323 WP_000205518.1.8736 WP_000205518.1.87552 WP_000205518.1.87779 WP_000205518.1.87945 WP_000205518.1.88019 WP_000205518.1.88073 WP_000205518.1.8809 WP_000205518.1.88291 WP_000205518.1.88293 WP_000205518.1.8837 WP_000205518.1.88393 WP_000205518.1.88703 WP_000205518.1.88792 WP_000205518.1.88902 WP_000205518.1.8891 WP_000205518.1.88981 WP_000205518.1.89008 WP_000205518.1.89116 WP_000205518.1.89138 WP_000205518.1.89304 WP_000205518.1.89512 WP_000205518.1.89527 WP_000205518.1.89570 WP_000205518.1.89604 WP_000205518.1.89622 WP_000205518.1.89902 WP_000205518.1.8996 WP_000205518.1.90252 WP_000205518.1.90417 WP_000205518.1.90453 WP_000205518.1.90458 WP_000205518.1.90557 WP_000205518.1.90641 WP_000205518.1.90734 WP_000205518.1.91003 WP_000205518.1.91278 WP_000205518.1.91512 WP_000205518.1.91564 WP_000205518.1.91628 WP_000205518.1.91655 WP_000205518.1.91724 WP_000205518.1.91732 WP_000205518.1.91788 WP_000205518.1.92013 WP_000205518.1.92093 WP_000205518.1.92108 WP_000205518.1.92183 WP_000205518.1.92208 WP_000205518.1.92268 WP_000205518.1.92310 WP_000205518.1.92443 WP_000205518.1.92482 WP_000205518.1.92531 WP_000205518.1.92671 WP_000205518.1.92738 WP_000205518.1.93086 WP_000205518.1.93101 WP_000205518.1.93136 WP_000205518.1.93155 WP_000205518.1.93365 WP_000205518.1.93543 WP_000205518.1.93650 WP_000205518.1.93656 WP_000205518.1.93662 WP_000205518.1.937 WP_000205518.1.93705 WP_000205518.1.93804 WP_000205518.1.9389 WP_000205518.1.93994 WP_000205518.1.94072 WP_000205518.1.94162 WP_000205518.1.94168 WP_000205518.1.94198 WP_000205518.1.9432 WP_000205518.1.94354 WP_000205518.1.94380 WP_000205518.1.94565 WP_000205518.1.94584 WP_000205518.1.94674 WP_000205518.1.94796 WP_000205518.1.94959 WP_000205518.1.95051 WP_000205518.1.95085 WP_000205518.1.95121 WP_000205518.1.95282 WP_000205518.1.95630 WP_000205518.1.95911 WP_000205518.1.96139 WP_000205518.1.96317 WP_000205518.1.96343 WP_000205518.1.9644 WP_000205518.1.96469 WP_000205518.1.96500 WP_000205518.1.96555 WP_000205518.1.96563 WP_000205518.1.96732 WP_000205518.1.96771 WP_000205518.1.97015 WP_000205518.1.97145 WP_000205518.1.97190 WP_000205518.1.97318 WP_000205518.1.97369 WP_000205518.1.97594 WP_000205518.1.97597 WP_000205518.1.97613 WP_000205518.1.97620 WP_000205518.1.97727 WP_000205518.1.97732 WP_000205518.1.97736 WP_000205518.1.9775 WP_000205518.1.97846 WP_000205518.1.98006 WP_000205518.1.98019 WP_000205518.1.98022 WP_000205518.1.98110 WP_000205518.1.98146 WP_000205518.1.98219 WP_000205518.1.9841 WP_000205518.1.98495 WP_000205518.1.98531 WP_000205518.1.98577 WP_000205518.1.98676 WP_000205518.1.98677 WP_000205518.1.98760 WP_000205518.1.98843 WP_000205518.1.9898 WP_000205518.1.99098 WP_000205518.1.99184 WP_000205518.1.99267 WP_000205518.1.99276 WP_000205518.1.99646 WP_000205518.1.99657 WP_000205518.1.99660 WP_000205518.1.99712 WP_000205518.1.99813 WP_000205518.1.99858 WP_000205518.1.99889 WP_000205518.1.99958 gi|379700002|ref|YP_005241730.1| gi|526219614|ref|YP_008265031.1| gi|378988177|ref|YP_005251341.1| gi|550900211|ref|YP_008669303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]