SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482904769|ref|YP_007903329.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482904769|ref|YP_007903329.1|
Domain Number 1 Region: 6-357
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.9e-83
Family AAT-like 0.00000000000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|482904769|ref|YP_007903329.1|
Sequence length 364
Comment threonine-phosphate decarboxylase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MALFNSAHGGNIREAATVLGISPDQLLDFSANINPLGMPVSVKRALIDNLDCIERYPDAD
YFHLHQALARHHQVPASWILAGNGETESIFTVASGLKPRRAMIVTPGFAEYGRALAQSGC
EIRRWSLREADGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNI
NLILDEAFIDFIPHETGFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMR
RQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLLTVYPGRANYL
LLRCEREDIDLQRRLLTQRILIRSCANYPGLDSRYYRVAIRSAAQNERLLAALRNVLTGI
APAD
Download sequence
Identical sequences A0A0D6H300 A0A0F6AYE2 A0A0F7DI30 A0A0H3N9F7 A0A0U1IDC4 A0A0W4GR63 A0A249V0Z6 A0A2D3AMC5 A0A2D3TYI7 A0A2H9YMH7 E8XA03 P97084
gi|550900077|ref|YP_008669169.1| NP_459636.1.58477 WP_001173255.1.100002 WP_001173255.1.100010 WP_001173255.1.100234 WP_001173255.1.100258 WP_001173255.1.100376 WP_001173255.1.100424 WP_001173255.1.100436 WP_001173255.1.100472 WP_001173255.1.100484 WP_001173255.1.100488 WP_001173255.1.100650 WP_001173255.1.10076 WP_001173255.1.100781 WP_001173255.1.100793 WP_001173255.1.100869 WP_001173255.1.100871 WP_001173255.1.100882 WP_001173255.1.101007 WP_001173255.1.101020 WP_001173255.1.101074 WP_001173255.1.101078 WP_001173255.1.101180 WP_001173255.1.101259 WP_001173255.1.101284 WP_001173255.1.101291 WP_001173255.1.101320 WP_001173255.1.101353 WP_001173255.1.101386 WP_001173255.1.101404 WP_001173255.1.101420 WP_001173255.1.101520 WP_001173255.1.101589 WP_001173255.1.101707 WP_001173255.1.101734 WP_001173255.1.101841 WP_001173255.1.101878 WP_001173255.1.10191 WP_001173255.1.101953 WP_001173255.1.10220 WP_001173255.1.10266 WP_001173255.1.10429 WP_001173255.1.10439 WP_001173255.1.10521 WP_001173255.1.10678 WP_001173255.1.10753 WP_001173255.1.10992 WP_001173255.1.11000 WP_001173255.1.11024 WP_001173255.1.11031 WP_001173255.1.11098 WP_001173255.1.11168 WP_001173255.1.11190 WP_001173255.1.11295 WP_001173255.1.11455 WP_001173255.1.11458 WP_001173255.1.11518 WP_001173255.1.11532 WP_001173255.1.11543 WP_001173255.1.11763 WP_001173255.1.11772 WP_001173255.1.11897 WP_001173255.1.12025 WP_001173255.1.12114 WP_001173255.1.12351 WP_001173255.1.12370 WP_001173255.1.12546 WP_001173255.1.1264 WP_001173255.1.12728 WP_001173255.1.12879 WP_001173255.1.12936 WP_001173255.1.12995 WP_001173255.1.13027 WP_001173255.1.13106 WP_001173255.1.13130 WP_001173255.1.13334 WP_001173255.1.13414 WP_001173255.1.13488 WP_001173255.1.13509 WP_001173255.1.13669 WP_001173255.1.13741 WP_001173255.1.1387 WP_001173255.1.13908 WP_001173255.1.13932 WP_001173255.1.13968 WP_001173255.1.14001 WP_001173255.1.14151 WP_001173255.1.14239 WP_001173255.1.14320 WP_001173255.1.14379 WP_001173255.1.14406 WP_001173255.1.14410 WP_001173255.1.14524 WP_001173255.1.14554 WP_001173255.1.14725 WP_001173255.1.14852 WP_001173255.1.1489 WP_001173255.1.14932 WP_001173255.1.15055 WP_001173255.1.15223 WP_001173255.1.15226 WP_001173255.1.15316 WP_001173255.1.15369 WP_001173255.1.1540 WP_001173255.1.15508 WP_001173255.1.15830 WP_001173255.1.16006 WP_001173255.1.16062 WP_001173255.1.16063 WP_001173255.1.16103 WP_001173255.1.16226 WP_001173255.1.16233 WP_001173255.1.16244 WP_001173255.1.16284 WP_001173255.1.16328 WP_001173255.1.1635 WP_001173255.1.16468 WP_001173255.1.16614 WP_001173255.1.16650 WP_001173255.1.16686 WP_001173255.1.16691 WP_001173255.1.167 WP_001173255.1.16735 WP_001173255.1.16786 WP_001173255.1.16858 WP_001173255.1.16896 WP_001173255.1.16916 WP_001173255.1.16944 WP_001173255.1.16965 WP_001173255.1.1700 WP_001173255.1.17307 WP_001173255.1.174 WP_001173255.1.17480 WP_001173255.1.17546 WP_001173255.1.17702 WP_001173255.1.17705 WP_001173255.1.17747 WP_001173255.1.18019 WP_001173255.1.18111 WP_001173255.1.18163 WP_001173255.1.18265 WP_001173255.1.18267 WP_001173255.1.18282 WP_001173255.1.18468 WP_001173255.1.18607 WP_001173255.1.18715 WP_001173255.1.18776 WP_001173255.1.18822 WP_001173255.1.18881 WP_001173255.1.18940 WP_001173255.1.18949 WP_001173255.1.19053 WP_001173255.1.19320 WP_001173255.1.19458 WP_001173255.1.19460 WP_001173255.1.19461 WP_001173255.1.19614 WP_001173255.1.19642 WP_001173255.1.19660 WP_001173255.1.19702 WP_001173255.1.19706 WP_001173255.1.19724 WP_001173255.1.19749 WP_001173255.1.19784 WP_001173255.1.19802 WP_001173255.1.19809 WP_001173255.1.19867 WP_001173255.1.1998 WP_001173255.1.2010 WP_001173255.1.20212 WP_001173255.1.20266 WP_001173255.1.20271 WP_001173255.1.20330 WP_001173255.1.20362 WP_001173255.1.20376 WP_001173255.1.20418 WP_001173255.1.20443 WP_001173255.1.20525 WP_001173255.1.2054 WP_001173255.1.20553 WP_001173255.1.20626 WP_001173255.1.20646 WP_001173255.1.20886 WP_001173255.1.20908 WP_001173255.1.21049 WP_001173255.1.21146 WP_001173255.1.21245 WP_001173255.1.21246 WP_001173255.1.21269 WP_001173255.1.21400 WP_001173255.1.21497 WP_001173255.1.21499 WP_001173255.1.21548 WP_001173255.1.21603 WP_001173255.1.21751 WP_001173255.1.21757 WP_001173255.1.22024 WP_001173255.1.2205 WP_001173255.1.22062 WP_001173255.1.22067 WP_001173255.1.2221 WP_001173255.1.22323 WP_001173255.1.2235 WP_001173255.1.22379 WP_001173255.1.22427 WP_001173255.1.2246 WP_001173255.1.22485 WP_001173255.1.22537 WP_001173255.1.22620 WP_001173255.1.22870 WP_001173255.1.22979 WP_001173255.1.23102 WP_001173255.1.23114 WP_001173255.1.2314 WP_001173255.1.23169 WP_001173255.1.23192 WP_001173255.1.23259 WP_001173255.1.23460 WP_001173255.1.23472 WP_001173255.1.23634 WP_001173255.1.2364 WP_001173255.1.23932 WP_001173255.1.24017 WP_001173255.1.24206 WP_001173255.1.24308 WP_001173255.1.24578 WP_001173255.1.24737 WP_001173255.1.24779 WP_001173255.1.25008 WP_001173255.1.25015 WP_001173255.1.25206 WP_001173255.1.25405 WP_001173255.1.25454 WP_001173255.1.25493 WP_001173255.1.25668 WP_001173255.1.25690 WP_001173255.1.2570 WP_001173255.1.25740 WP_001173255.1.25793 WP_001173255.1.25814 WP_001173255.1.25988 WP_001173255.1.26282 WP_001173255.1.26311 WP_001173255.1.26319 WP_001173255.1.26429 WP_001173255.1.26440 WP_001173255.1.26493 WP_001173255.1.26551 WP_001173255.1.26567 WP_001173255.1.27010 WP_001173255.1.27173 WP_001173255.1.27206 WP_001173255.1.27423 WP_001173255.1.27561 WP_001173255.1.2763 WP_001173255.1.27665 WP_001173255.1.27707 WP_001173255.1.27761 WP_001173255.1.2777 WP_001173255.1.27857 WP_001173255.1.27997 WP_001173255.1.28094 WP_001173255.1.28126 WP_001173255.1.28170 WP_001173255.1.28302 WP_001173255.1.2835 WP_001173255.1.28370 WP_001173255.1.28538 WP_001173255.1.28575 WP_001173255.1.28625 WP_001173255.1.28655 WP_001173255.1.28694 WP_001173255.1.2879 WP_001173255.1.2890 WP_001173255.1.28938 WP_001173255.1.28946 WP_001173255.1.29006 WP_001173255.1.29010 WP_001173255.1.2910 WP_001173255.1.29588 WP_001173255.1.29601 WP_001173255.1.29606 WP_001173255.1.29615 WP_001173255.1.29619 WP_001173255.1.29704 WP_001173255.1.29969 WP_001173255.1.30006 WP_001173255.1.30027 WP_001173255.1.30180 WP_001173255.1.30469 WP_001173255.1.30505 WP_001173255.1.30507 WP_001173255.1.30535 WP_001173255.1.30547 WP_001173255.1.30794 WP_001173255.1.30833 WP_001173255.1.30835 WP_001173255.1.30972 WP_001173255.1.31 WP_001173255.1.3113 WP_001173255.1.31185 WP_001173255.1.3119 WP_001173255.1.31190 WP_001173255.1.31195 WP_001173255.1.31196 WP_001173255.1.31219 WP_001173255.1.31281 WP_001173255.1.31362 WP_001173255.1.31504 WP_001173255.1.31515 WP_001173255.1.31578 WP_001173255.1.31658 WP_001173255.1.31940 WP_001173255.1.31967 WP_001173255.1.31972 WP_001173255.1.32192 WP_001173255.1.32206 WP_001173255.1.32434 WP_001173255.1.32438 WP_001173255.1.32515 WP_001173255.1.32527 WP_001173255.1.32660 WP_001173255.1.32702 WP_001173255.1.32714 WP_001173255.1.32786 WP_001173255.1.32804 WP_001173255.1.32860 WP_001173255.1.32907 WP_001173255.1.33030 WP_001173255.1.33127 WP_001173255.1.33143 WP_001173255.1.33248 WP_001173255.1.33261 WP_001173255.1.333 WP_001173255.1.33492 WP_001173255.1.33553 WP_001173255.1.33592 WP_001173255.1.33825 WP_001173255.1.33894 WP_001173255.1.34043 WP_001173255.1.34075 WP_001173255.1.34257 WP_001173255.1.34279 WP_001173255.1.34319 WP_001173255.1.3445 WP_001173255.1.34453 WP_001173255.1.34496 WP_001173255.1.3476 WP_001173255.1.3489 WP_001173255.1.34975 WP_001173255.1.34977 WP_001173255.1.35045 WP_001173255.1.35129 WP_001173255.1.35184 WP_001173255.1.35404 WP_001173255.1.35408 WP_001173255.1.35425 WP_001173255.1.35429 WP_001173255.1.35446 WP_001173255.1.35463 WP_001173255.1.35503 WP_001173255.1.35509 WP_001173255.1.35590 WP_001173255.1.35940 WP_001173255.1.36003 WP_001173255.1.3601 WP_001173255.1.36609 WP_001173255.1.36690 WP_001173255.1.3670 WP_001173255.1.36705 WP_001173255.1.36918 WP_001173255.1.36931 WP_001173255.1.37063 WP_001173255.1.37073 WP_001173255.1.37111 WP_001173255.1.37112 WP_001173255.1.37256 WP_001173255.1.37293 WP_001173255.1.37370 WP_001173255.1.37376 WP_001173255.1.3744 WP_001173255.1.37498 WP_001173255.1.37504 WP_001173255.1.3756 WP_001173255.1.37618 WP_001173255.1.37687 WP_001173255.1.37968 WP_001173255.1.37978 WP_001173255.1.38125 WP_001173255.1.38145 WP_001173255.1.383 WP_001173255.1.3848 WP_001173255.1.38613 WP_001173255.1.38673 WP_001173255.1.3869 WP_001173255.1.38693 WP_001173255.1.38773 WP_001173255.1.38882 WP_001173255.1.38913 WP_001173255.1.39003 WP_001173255.1.39038 WP_001173255.1.39136 WP_001173255.1.39197 WP_001173255.1.39229 WP_001173255.1.39405 WP_001173255.1.39420 WP_001173255.1.39449 WP_001173255.1.39512 WP_001173255.1.39556 WP_001173255.1.39629 WP_001173255.1.39763 WP_001173255.1.39862 WP_001173255.1.39921 WP_001173255.1.39923 WP_001173255.1.40017 WP_001173255.1.40072 WP_001173255.1.40073 WP_001173255.1.4011 WP_001173255.1.40111 WP_001173255.1.40208 WP_001173255.1.40240 WP_001173255.1.40257 WP_001173255.1.40292 WP_001173255.1.40305 WP_001173255.1.40311 WP_001173255.1.40395 WP_001173255.1.40465 WP_001173255.1.40508 WP_001173255.1.40710 WP_001173255.1.4087 WP_001173255.1.40877 WP_001173255.1.41017 WP_001173255.1.41086 WP_001173255.1.41091 WP_001173255.1.41226 WP_001173255.1.41279 WP_001173255.1.41516 WP_001173255.1.41554 WP_001173255.1.41591 WP_001173255.1.41662 WP_001173255.1.41708 WP_001173255.1.41761 WP_001173255.1.4178 WP_001173255.1.41859 WP_001173255.1.41882 WP_001173255.1.41979 WP_001173255.1.41985 WP_001173255.1.42104 WP_001173255.1.42320 WP_001173255.1.42342 WP_001173255.1.4239 WP_001173255.1.42422 WP_001173255.1.42685 WP_001173255.1.4276 WP_001173255.1.42864 WP_001173255.1.4288 WP_001173255.1.43018 WP_001173255.1.43041 WP_001173255.1.43086 WP_001173255.1.43244 WP_001173255.1.43312 WP_001173255.1.43351 WP_001173255.1.43437 WP_001173255.1.43522 WP_001173255.1.43528 WP_001173255.1.43613 WP_001173255.1.43668 WP_001173255.1.43886 WP_001173255.1.44005 WP_001173255.1.44043 WP_001173255.1.44099 WP_001173255.1.44121 WP_001173255.1.44291 WP_001173255.1.44310 WP_001173255.1.44386 WP_001173255.1.44479 WP_001173255.1.44640 WP_001173255.1.4467 WP_001173255.1.44747 WP_001173255.1.44877 WP_001173255.1.44927 WP_001173255.1.44971 WP_001173255.1.45067 WP_001173255.1.45074 WP_001173255.1.45079 WP_001173255.1.45098 WP_001173255.1.45177 WP_001173255.1.45184 WP_001173255.1.45259 WP_001173255.1.45344 WP_001173255.1.45349 WP_001173255.1.45365 WP_001173255.1.45550 WP_001173255.1.45585 WP_001173255.1.45660 WP_001173255.1.45690 WP_001173255.1.45797 WP_001173255.1.458 WP_001173255.1.46011 WP_001173255.1.46069 WP_001173255.1.46112 WP_001173255.1.46173 WP_001173255.1.46174 WP_001173255.1.46187 WP_001173255.1.46303 WP_001173255.1.46595 WP_001173255.1.46675 WP_001173255.1.46930 WP_001173255.1.47057 WP_001173255.1.47214 WP_001173255.1.47257 WP_001173255.1.47429 WP_001173255.1.47448 WP_001173255.1.4747 WP_001173255.1.47472 WP_001173255.1.47478 WP_001173255.1.47621 WP_001173255.1.4775 WP_001173255.1.47799 WP_001173255.1.48242 WP_001173255.1.48253 WP_001173255.1.483 WP_001173255.1.48367 WP_001173255.1.48377 WP_001173255.1.48455 WP_001173255.1.4853 WP_001173255.1.48788 WP_001173255.1.48876 WP_001173255.1.48894 WP_001173255.1.48919 WP_001173255.1.49084 WP_001173255.1.49155 WP_001173255.1.49204 WP_001173255.1.49239 WP_001173255.1.49256 WP_001173255.1.49290 WP_001173255.1.49340 WP_001173255.1.49366 WP_001173255.1.49490 WP_001173255.1.49515 WP_001173255.1.49572 WP_001173255.1.49647 WP_001173255.1.4979 WP_001173255.1.49803 WP_001173255.1.49805 WP_001173255.1.49929 WP_001173255.1.50080 WP_001173255.1.50161 WP_001173255.1.50211 WP_001173255.1.50239 WP_001173255.1.50376 WP_001173255.1.50389 WP_001173255.1.50676 WP_001173255.1.50774 WP_001173255.1.50804 WP_001173255.1.50808 WP_001173255.1.5088 WP_001173255.1.50908 WP_001173255.1.50941 WP_001173255.1.51014 WP_001173255.1.51022 WP_001173255.1.51179 WP_001173255.1.51182 WP_001173255.1.51186 WP_001173255.1.51487 WP_001173255.1.51488 WP_001173255.1.51634 WP_001173255.1.51649 WP_001173255.1.51686 WP_001173255.1.51756 WP_001173255.1.51911 WP_001173255.1.51932 WP_001173255.1.51989 WP_001173255.1.52047 WP_001173255.1.52121 WP_001173255.1.52148 WP_001173255.1.5216 WP_001173255.1.52346 WP_001173255.1.52353 WP_001173255.1.52361 WP_001173255.1.52653 WP_001173255.1.52656 WP_001173255.1.52743 WP_001173255.1.52857 WP_001173255.1.52898 WP_001173255.1.52915 WP_001173255.1.53190 WP_001173255.1.53406 WP_001173255.1.53436 WP_001173255.1.53454 WP_001173255.1.53466 WP_001173255.1.53529 WP_001173255.1.53543 WP_001173255.1.53757 WP_001173255.1.53812 WP_001173255.1.54033 WP_001173255.1.54075 WP_001173255.1.54196 WP_001173255.1.542 WP_001173255.1.54209 WP_001173255.1.54271 WP_001173255.1.54273 WP_001173255.1.54274 WP_001173255.1.54319 WP_001173255.1.54364 WP_001173255.1.54400 WP_001173255.1.54644 WP_001173255.1.54662 WP_001173255.1.54722 WP_001173255.1.54749 WP_001173255.1.54764 WP_001173255.1.55008 WP_001173255.1.55152 WP_001173255.1.55156 WP_001173255.1.55285 WP_001173255.1.55475 WP_001173255.1.55647 WP_001173255.1.55743 WP_001173255.1.55768 WP_001173255.1.55782 WP_001173255.1.55796 WP_001173255.1.55993 WP_001173255.1.56002 WP_001173255.1.56012 WP_001173255.1.56105 WP_001173255.1.56238 WP_001173255.1.56286 WP_001173255.1.56304 WP_001173255.1.56305 WP_001173255.1.56414 WP_001173255.1.56438 WP_001173255.1.56560 WP_001173255.1.56597 WP_001173255.1.56601 WP_001173255.1.56614 WP_001173255.1.56671 WP_001173255.1.56682 WP_001173255.1.56875 WP_001173255.1.56877 WP_001173255.1.57168 WP_001173255.1.57187 WP_001173255.1.57232 WP_001173255.1.57377 WP_001173255.1.57418 WP_001173255.1.57433 WP_001173255.1.57515 WP_001173255.1.57529 WP_001173255.1.57576 WP_001173255.1.57601 WP_001173255.1.57607 WP_001173255.1.57763 WP_001173255.1.57862 WP_001173255.1.57890 WP_001173255.1.57891 WP_001173255.1.57978 WP_001173255.1.5801 WP_001173255.1.58041 WP_001173255.1.58418 WP_001173255.1.5854 WP_001173255.1.58548 WP_001173255.1.5858 WP_001173255.1.58662 WP_001173255.1.58669 WP_001173255.1.58745 WP_001173255.1.58803 WP_001173255.1.5886 WP_001173255.1.59094 WP_001173255.1.59224 WP_001173255.1.59321 WP_001173255.1.59375 WP_001173255.1.59458 WP_001173255.1.59490 WP_001173255.1.59508 WP_001173255.1.5953 WP_001173255.1.59684 WP_001173255.1.59694 WP_001173255.1.59771 WP_001173255.1.5979 WP_001173255.1.59953 WP_001173255.1.60008 WP_001173255.1.60021 WP_001173255.1.60069 WP_001173255.1.60140 WP_001173255.1.60155 WP_001173255.1.60285 WP_001173255.1.60379 WP_001173255.1.60464 WP_001173255.1.60643 WP_001173255.1.60874 WP_001173255.1.60941 WP_001173255.1.61078 WP_001173255.1.6114 WP_001173255.1.61232 WP_001173255.1.6129 WP_001173255.1.61296 WP_001173255.1.61345 WP_001173255.1.61417 WP_001173255.1.61609 WP_001173255.1.61712 WP_001173255.1.61714 WP_001173255.1.61730 WP_001173255.1.61857 WP_001173255.1.61918 WP_001173255.1.61952 WP_001173255.1.62007 WP_001173255.1.62025 WP_001173255.1.62076 WP_001173255.1.62204 WP_001173255.1.62304 WP_001173255.1.62364 WP_001173255.1.62374 WP_001173255.1.62403 WP_001173255.1.6253 WP_001173255.1.62570 WP_001173255.1.62853 WP_001173255.1.62903 WP_001173255.1.62910 WP_001173255.1.62955 WP_001173255.1.63063 WP_001173255.1.63203 WP_001173255.1.63256 WP_001173255.1.63290 WP_001173255.1.63382 WP_001173255.1.63432 WP_001173255.1.63461 WP_001173255.1.63479 WP_001173255.1.63577 WP_001173255.1.63664 WP_001173255.1.63677 WP_001173255.1.63718 WP_001173255.1.6375 WP_001173255.1.63834 WP_001173255.1.64046 WP_001173255.1.6423 WP_001173255.1.64244 WP_001173255.1.64403 WP_001173255.1.64649 WP_001173255.1.64667 WP_001173255.1.64702 WP_001173255.1.64757 WP_001173255.1.64781 WP_001173255.1.64831 WP_001173255.1.6489 WP_001173255.1.65018 WP_001173255.1.65028 WP_001173255.1.65163 WP_001173255.1.65171 WP_001173255.1.65185 WP_001173255.1.65248 WP_001173255.1.65474 WP_001173255.1.65572 WP_001173255.1.65633 WP_001173255.1.6565 WP_001173255.1.65696 WP_001173255.1.6575 WP_001173255.1.65782 WP_001173255.1.65876 WP_001173255.1.6594 WP_001173255.1.66270 WP_001173255.1.6630 WP_001173255.1.66314 WP_001173255.1.66362 WP_001173255.1.6638 WP_001173255.1.6640 WP_001173255.1.66600 WP_001173255.1.66698 WP_001173255.1.6680 WP_001173255.1.66834 WP_001173255.1.66901 WP_001173255.1.66962 WP_001173255.1.67037 WP_001173255.1.67045 WP_001173255.1.67181 WP_001173255.1.67268 WP_001173255.1.67347 WP_001173255.1.67465 WP_001173255.1.67552 WP_001173255.1.67682 WP_001173255.1.67829 WP_001173255.1.67887 WP_001173255.1.68073 WP_001173255.1.68201 WP_001173255.1.68206 WP_001173255.1.6827 WP_001173255.1.68275 WP_001173255.1.6849 WP_001173255.1.68547 WP_001173255.1.68589 WP_001173255.1.68655 WP_001173255.1.68656 WP_001173255.1.6875 WP_001173255.1.68778 WP_001173255.1.68787 WP_001173255.1.68894 WP_001173255.1.68928 WP_001173255.1.68975 WP_001173255.1.69006 WP_001173255.1.6913 WP_001173255.1.69146 WP_001173255.1.69255 WP_001173255.1.69371 WP_001173255.1.69397 WP_001173255.1.69465 WP_001173255.1.69564 WP_001173255.1.69592 WP_001173255.1.69644 WP_001173255.1.69704 WP_001173255.1.7021 WP_001173255.1.70241 WP_001173255.1.70269 WP_001173255.1.70289 WP_001173255.1.70447 WP_001173255.1.70485 WP_001173255.1.70643 WP_001173255.1.70683 WP_001173255.1.70883 WP_001173255.1.70914 WP_001173255.1.70922 WP_001173255.1.70948 WP_001173255.1.71116 WP_001173255.1.71146 WP_001173255.1.71165 WP_001173255.1.71188 WP_001173255.1.71202 WP_001173255.1.71243 WP_001173255.1.71248 WP_001173255.1.71306 WP_001173255.1.71337 WP_001173255.1.71378 WP_001173255.1.71401 WP_001173255.1.71481 WP_001173255.1.71691 WP_001173255.1.71702 WP_001173255.1.71750 WP_001173255.1.71845 WP_001173255.1.71881 WP_001173255.1.71908 WP_001173255.1.71952 WP_001173255.1.71973 WP_001173255.1.72105 WP_001173255.1.72203 WP_001173255.1.72372 WP_001173255.1.72376 WP_001173255.1.72594 WP_001173255.1.72871 WP_001173255.1.72975 WP_001173255.1.73062 WP_001173255.1.7315 WP_001173255.1.73200 WP_001173255.1.7334 WP_001173255.1.73377 WP_001173255.1.73481 WP_001173255.1.73535 WP_001173255.1.7356 WP_001173255.1.73561 WP_001173255.1.73581 WP_001173255.1.73617 WP_001173255.1.73667 WP_001173255.1.73753 WP_001173255.1.73758 WP_001173255.1.73794 WP_001173255.1.7387 WP_001173255.1.73924 WP_001173255.1.73926 WP_001173255.1.74029 WP_001173255.1.74181 WP_001173255.1.74191 WP_001173255.1.7433 WP_001173255.1.74379 WP_001173255.1.74410 WP_001173255.1.74466 WP_001173255.1.74529 WP_001173255.1.74545 WP_001173255.1.74644 WP_001173255.1.74702 WP_001173255.1.74745 WP_001173255.1.75129 WP_001173255.1.75187 WP_001173255.1.75288 WP_001173255.1.75334 WP_001173255.1.75362 WP_001173255.1.75385 WP_001173255.1.75392 WP_001173255.1.75760 WP_001173255.1.75764 WP_001173255.1.75828 WP_001173255.1.75837 WP_001173255.1.75874 WP_001173255.1.75945 WP_001173255.1.76020 WP_001173255.1.76252 WP_001173255.1.76445 WP_001173255.1.7660 WP_001173255.1.76673 WP_001173255.1.76706 WP_001173255.1.76721 WP_001173255.1.76756 WP_001173255.1.76760 WP_001173255.1.76875 WP_001173255.1.76880 WP_001173255.1.76899 WP_001173255.1.77038 WP_001173255.1.77047 WP_001173255.1.77080 WP_001173255.1.7712 WP_001173255.1.77180 WP_001173255.1.77244 WP_001173255.1.77292 WP_001173255.1.77349 WP_001173255.1.77514 WP_001173255.1.77549 WP_001173255.1.77692 WP_001173255.1.77729 WP_001173255.1.7782 WP_001173255.1.77846 WP_001173255.1.77918 WP_001173255.1.77960 WP_001173255.1.78033 WP_001173255.1.78076 WP_001173255.1.78096 WP_001173255.1.78100 WP_001173255.1.78110 WP_001173255.1.78383 WP_001173255.1.78407 WP_001173255.1.7861 WP_001173255.1.78618 WP_001173255.1.78673 WP_001173255.1.78735 WP_001173255.1.78802 WP_001173255.1.78830 WP_001173255.1.78835 WP_001173255.1.78871 WP_001173255.1.78874 WP_001173255.1.78918 WP_001173255.1.78930 WP_001173255.1.79151 WP_001173255.1.79167 WP_001173255.1.79235 WP_001173255.1.79335 WP_001173255.1.79462 WP_001173255.1.79472 WP_001173255.1.79490 WP_001173255.1.79495 WP_001173255.1.79529 WP_001173255.1.7964 WP_001173255.1.79659 WP_001173255.1.79668 WP_001173255.1.79708 WP_001173255.1.7979 WP_001173255.1.79845 WP_001173255.1.80077 WP_001173255.1.80137 WP_001173255.1.80182 WP_001173255.1.80296 WP_001173255.1.80366 WP_001173255.1.80780 WP_001173255.1.80831 WP_001173255.1.80850 WP_001173255.1.80881 WP_001173255.1.80939 WP_001173255.1.8096 WP_001173255.1.81037 WP_001173255.1.81069 WP_001173255.1.81149 WP_001173255.1.81175 WP_001173255.1.8119 WP_001173255.1.81354 WP_001173255.1.81410 WP_001173255.1.81425 WP_001173255.1.81472 WP_001173255.1.81750 WP_001173255.1.81785 WP_001173255.1.81902 WP_001173255.1.81974 WP_001173255.1.82337 WP_001173255.1.82395 WP_001173255.1.82479 WP_001173255.1.82503 WP_001173255.1.82515 WP_001173255.1.82676 WP_001173255.1.82761 WP_001173255.1.8282 WP_001173255.1.82944 WP_001173255.1.82956 WP_001173255.1.83092 WP_001173255.1.83163 WP_001173255.1.83365 WP_001173255.1.83413 WP_001173255.1.83491 WP_001173255.1.83523 WP_001173255.1.8354 WP_001173255.1.83651 WP_001173255.1.83721 WP_001173255.1.83760 WP_001173255.1.83995 WP_001173255.1.84103 WP_001173255.1.84283 WP_001173255.1.84392 WP_001173255.1.8441 WP_001173255.1.84532 WP_001173255.1.84554 WP_001173255.1.84659 WP_001173255.1.84693 WP_001173255.1.84899 WP_001173255.1.8497 WP_001173255.1.85040 WP_001173255.1.85134 WP_001173255.1.85178 WP_001173255.1.85180 WP_001173255.1.85190 WP_001173255.1.8533 WP_001173255.1.8545 WP_001173255.1.85469 WP_001173255.1.85481 WP_001173255.1.85483 WP_001173255.1.85541 WP_001173255.1.8556 WP_001173255.1.85615 WP_001173255.1.85617 WP_001173255.1.85663 WP_001173255.1.85671 WP_001173255.1.85672 WP_001173255.1.85855 WP_001173255.1.85886 WP_001173255.1.85900 WP_001173255.1.85904 WP_001173255.1.85976 WP_001173255.1.86306 WP_001173255.1.86310 WP_001173255.1.86356 WP_001173255.1.86450 WP_001173255.1.86469 WP_001173255.1.86580 WP_001173255.1.86588 WP_001173255.1.86661 WP_001173255.1.8672 WP_001173255.1.8678 WP_001173255.1.86810 WP_001173255.1.8684 WP_001173255.1.86895 WP_001173255.1.86906 WP_001173255.1.87095 WP_001173255.1.87323 WP_001173255.1.8736 WP_001173255.1.87460 WP_001173255.1.87552 WP_001173255.1.87779 WP_001173255.1.87945 WP_001173255.1.88019 WP_001173255.1.88073 WP_001173255.1.8809 WP_001173255.1.88291 WP_001173255.1.88293 WP_001173255.1.8837 WP_001173255.1.88393 WP_001173255.1.88703 WP_001173255.1.88792 WP_001173255.1.88902 WP_001173255.1.8891 WP_001173255.1.88981 WP_001173255.1.89008 WP_001173255.1.89116 WP_001173255.1.89138 WP_001173255.1.89304 WP_001173255.1.89512 WP_001173255.1.89527 WP_001173255.1.89570 WP_001173255.1.89604 WP_001173255.1.89622 WP_001173255.1.89659 WP_001173255.1.89902 WP_001173255.1.8996 WP_001173255.1.90097 WP_001173255.1.90252 WP_001173255.1.90348 WP_001173255.1.90363 WP_001173255.1.90417 WP_001173255.1.90453 WP_001173255.1.90458 WP_001173255.1.90472 WP_001173255.1.90557 WP_001173255.1.90585 WP_001173255.1.90641 WP_001173255.1.90734 WP_001173255.1.91003 WP_001173255.1.91069 WP_001173255.1.91278 WP_001173255.1.9131 WP_001173255.1.91512 WP_001173255.1.91524 WP_001173255.1.91564 WP_001173255.1.91628 WP_001173255.1.91724 WP_001173255.1.91732 WP_001173255.1.91788 WP_001173255.1.92013 WP_001173255.1.92060 WP_001173255.1.92093 WP_001173255.1.92108 WP_001173255.1.92171 WP_001173255.1.92183 WP_001173255.1.92208 WP_001173255.1.92268 WP_001173255.1.92299 WP_001173255.1.92310 WP_001173255.1.92318 WP_001173255.1.92443 WP_001173255.1.92482 WP_001173255.1.92531 WP_001173255.1.92669 WP_001173255.1.92671 WP_001173255.1.92738 WP_001173255.1.93086 WP_001173255.1.93101 WP_001173255.1.93136 WP_001173255.1.93155 WP_001173255.1.93275 WP_001173255.1.93365 WP_001173255.1.93376 WP_001173255.1.93543 WP_001173255.1.93650 WP_001173255.1.93656 WP_001173255.1.93662 WP_001173255.1.937 WP_001173255.1.93705 WP_001173255.1.93804 WP_001173255.1.9389 WP_001173255.1.93994 WP_001173255.1.94064 WP_001173255.1.94072 WP_001173255.1.94162 WP_001173255.1.94168 WP_001173255.1.94198 WP_001173255.1.9432 WP_001173255.1.94352 WP_001173255.1.94354 WP_001173255.1.94380 WP_001173255.1.94458 WP_001173255.1.94565 WP_001173255.1.94584 WP_001173255.1.94674 WP_001173255.1.94796 WP_001173255.1.94947 WP_001173255.1.94959 WP_001173255.1.95051 WP_001173255.1.95085 WP_001173255.1.95121 WP_001173255.1.95171 WP_001173255.1.95282 WP_001173255.1.95546 WP_001173255.1.95630 WP_001173255.1.95911 WP_001173255.1.96139 WP_001173255.1.96317 WP_001173255.1.96343 WP_001173255.1.9644 WP_001173255.1.96469 WP_001173255.1.96497 WP_001173255.1.96500 WP_001173255.1.96555 WP_001173255.1.96563 WP_001173255.1.96732 WP_001173255.1.96771 WP_001173255.1.96810 WP_001173255.1.97015 WP_001173255.1.97145 WP_001173255.1.97190 WP_001173255.1.97318 WP_001173255.1.97369 WP_001173255.1.97597 WP_001173255.1.97613 WP_001173255.1.97620 WP_001173255.1.97725 WP_001173255.1.97727 WP_001173255.1.97732 WP_001173255.1.97736 WP_001173255.1.9775 WP_001173255.1.97846 WP_001173255.1.98006 WP_001173255.1.98019 WP_001173255.1.98022 WP_001173255.1.98110 WP_001173255.1.98146 WP_001173255.1.98219 WP_001173255.1.9841 WP_001173255.1.98495 WP_001173255.1.98531 WP_001173255.1.98577 WP_001173255.1.98677 WP_001173255.1.98760 WP_001173255.1.98843 WP_001173255.1.99072 WP_001173255.1.99098 WP_001173255.1.99184 WP_001173255.1.99276 WP_001173255.1.99646 WP_001173255.1.99657 WP_001173255.1.99660 WP_001173255.1.99712 WP_001173255.1.99813 WP_001173255.1.99858 WP_001173255.1.99889 WP_001173255.1.99958 gi|378983248|ref|YP_005246403.1| gi|16764021|ref|NP_459636.1| gi|379699862|ref|YP_005241590.1| ABAM02000001|CDS_1204685-1205779 ABAO01000003|CDS_204606-205700 AE006468|CDS_705777-706871 CP000886|CDS_2419172-2418078 CP001363|CDS_706273-707367 FN424405|CDS_744587-745681 gi|549723346|ref|YP_008643536.1| 272994.SPAB_02906 99287.STM0644 gi|383495444|ref|YP_005396133.1| gi|378698597|ref|YP_005180554.1| gi|378449001|ref|YP_005236360.1| gi|482904769|ref|YP_007903329.1| gi|525838937|ref|YP_008256116.1| gi|526219507|ref|YP_008264894.1| gi|378444138|ref|YP_005231770.1| gi|161615138|ref|YP_001589103.1| gi|378988042|ref|YP_005251206.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]