SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482904982|ref|YP_007903542.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482904982|ref|YP_007903542.1|
Domain Number 1 Region: 6-363
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.57e-86
Family Cystathionine synthase-like 0.00000000000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|482904982|ref|YP_007903542.1|
Sequence length 367
Comment 2-aminoethylphosphonate--pyruvate transaminase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQQLTALATASEGYTSV
LLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARMVEMAGLMGIAHHAYDCGEVARPDV
QAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAHRYGKTYIVDAMSSFGGIPMDI
AALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSLSLDLYAQWRCMEDNHGKW
RFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPI
ITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFRIGNIGEVYAADITALLTAIR
TAMYWTK
Download sequence
Identical sequences A0A0D6HAN9 A0A0F6AXQ7 A0A0F7J6F0 A0A0H3NA04 A0A0U1FDE6 A0A0W3L4Z9 A0A2D3ALU4 A0A2H9YN46 E8XKL8 P96060 S5HHV9
gi|525839114|ref|YP_008256327.1| gi|482904982|ref|YP_007903542.1| gi|526219330|ref|YP_008264684.1| ABAO01000012|CDS_101842-102945 AE006468|CDS_484208-485311 CP001363|CDS_484901-486004 FN424405|CDS_524711-525814 gi|378698394|ref|YP_005180351.1| gi|16763811|ref|NP_459426.1| NP_459426.1.58477 WP_000203955.1.100010 WP_000203955.1.100234 WP_000203955.1.100376 WP_000203955.1.100424 WP_000203955.1.100436 WP_000203955.1.100484 WP_000203955.1.100488 WP_000203955.1.100597 WP_000203955.1.10076 WP_000203955.1.100781 WP_000203955.1.100793 WP_000203955.1.100869 WP_000203955.1.100871 WP_000203955.1.100882 WP_000203955.1.101007 WP_000203955.1.101020 WP_000203955.1.101074 WP_000203955.1.101078 WP_000203955.1.101180 WP_000203955.1.101259 WP_000203955.1.101284 WP_000203955.1.101291 WP_000203955.1.101353 WP_000203955.1.101386 WP_000203955.1.101404 WP_000203955.1.101420 WP_000203955.1.101589 WP_000203955.1.101707 WP_000203955.1.101734 WP_000203955.1.101878 WP_000203955.1.10220 WP_000203955.1.10266 WP_000203955.1.10429 WP_000203955.1.10439 WP_000203955.1.10678 WP_000203955.1.10753 WP_000203955.1.10992 WP_000203955.1.11024 WP_000203955.1.11031 WP_000203955.1.11098 WP_000203955.1.11168 WP_000203955.1.11190 WP_000203955.1.11295 WP_000203955.1.11455 WP_000203955.1.11458 WP_000203955.1.11518 WP_000203955.1.11532 WP_000203955.1.11543 WP_000203955.1.11763 WP_000203955.1.11772 WP_000203955.1.11897 WP_000203955.1.12114 WP_000203955.1.12351 WP_000203955.1.12370 WP_000203955.1.12546 WP_000203955.1.1264 WP_000203955.1.12728 WP_000203955.1.12879 WP_000203955.1.12936 WP_000203955.1.12995 WP_000203955.1.13027 WP_000203955.1.13106 WP_000203955.1.13130 WP_000203955.1.13414 WP_000203955.1.13488 WP_000203955.1.13509 WP_000203955.1.13669 WP_000203955.1.13741 WP_000203955.1.1387 WP_000203955.1.13908 WP_000203955.1.13932 WP_000203955.1.13968 WP_000203955.1.14001 WP_000203955.1.14041 WP_000203955.1.14151 WP_000203955.1.14239 WP_000203955.1.14320 WP_000203955.1.14379 WP_000203955.1.14406 WP_000203955.1.14410 WP_000203955.1.14524 WP_000203955.1.14554 WP_000203955.1.14725 WP_000203955.1.14852 WP_000203955.1.1489 WP_000203955.1.14932 WP_000203955.1.15055 WP_000203955.1.15223 WP_000203955.1.15226 WP_000203955.1.15316 WP_000203955.1.15369 WP_000203955.1.1540 WP_000203955.1.15508 WP_000203955.1.15784 WP_000203955.1.15830 WP_000203955.1.16062 WP_000203955.1.16063 WP_000203955.1.16103 WP_000203955.1.16226 WP_000203955.1.16233 WP_000203955.1.16284 WP_000203955.1.16328 WP_000203955.1.1635 WP_000203955.1.16468 WP_000203955.1.16614 WP_000203955.1.16650 WP_000203955.1.16686 WP_000203955.1.16691 WP_000203955.1.16732 WP_000203955.1.16735 WP_000203955.1.16786 WP_000203955.1.16858 WP_000203955.1.16896 WP_000203955.1.16965 WP_000203955.1.1700 WP_000203955.1.17307 WP_000203955.1.174 WP_000203955.1.17480 WP_000203955.1.17546 WP_000203955.1.17702 WP_000203955.1.17705 WP_000203955.1.18019 WP_000203955.1.18111 WP_000203955.1.18163 WP_000203955.1.18265 WP_000203955.1.18267 WP_000203955.1.18468 WP_000203955.1.18607 WP_000203955.1.18705 WP_000203955.1.18715 WP_000203955.1.18776 WP_000203955.1.18822 WP_000203955.1.18881 WP_000203955.1.18940 WP_000203955.1.18949 WP_000203955.1.19053 WP_000203955.1.19320 WP_000203955.1.19458 WP_000203955.1.19460 WP_000203955.1.19461 WP_000203955.1.19614 WP_000203955.1.19702 WP_000203955.1.19706 WP_000203955.1.19724 WP_000203955.1.19749 WP_000203955.1.19784 WP_000203955.1.19802 WP_000203955.1.19809 WP_000203955.1.19867 WP_000203955.1.1998 WP_000203955.1.2010 WP_000203955.1.20212 WP_000203955.1.20266 WP_000203955.1.20271 WP_000203955.1.20362 WP_000203955.1.20418 WP_000203955.1.20443 WP_000203955.1.20525 WP_000203955.1.2054 WP_000203955.1.20553 WP_000203955.1.20626 WP_000203955.1.20646 WP_000203955.1.20886 WP_000203955.1.20908 WP_000203955.1.21049 WP_000203955.1.21146 WP_000203955.1.21245 WP_000203955.1.21246 WP_000203955.1.21269 WP_000203955.1.21400 WP_000203955.1.21497 WP_000203955.1.21499 WP_000203955.1.21603 WP_000203955.1.21751 WP_000203955.1.21757 WP_000203955.1.22024 WP_000203955.1.2205 WP_000203955.1.22062 WP_000203955.1.22067 WP_000203955.1.2221 WP_000203955.1.22379 WP_000203955.1.22427 WP_000203955.1.2246 WP_000203955.1.22485 WP_000203955.1.22620 WP_000203955.1.22870 WP_000203955.1.22979 WP_000203955.1.23102 WP_000203955.1.23114 WP_000203955.1.2314 WP_000203955.1.23192 WP_000203955.1.23259 WP_000203955.1.23460 WP_000203955.1.23472 WP_000203955.1.23634 WP_000203955.1.2364 WP_000203955.1.23932 WP_000203955.1.24017 WP_000203955.1.24206 WP_000203955.1.24308 WP_000203955.1.24578 WP_000203955.1.24737 WP_000203955.1.24779 WP_000203955.1.25008 WP_000203955.1.25015 WP_000203955.1.25405 WP_000203955.1.25454 WP_000203955.1.25493 WP_000203955.1.25668 WP_000203955.1.25690 WP_000203955.1.2570 WP_000203955.1.25740 WP_000203955.1.25793 WP_000203955.1.25814 WP_000203955.1.25988 WP_000203955.1.26282 WP_000203955.1.26311 WP_000203955.1.26319 WP_000203955.1.26429 WP_000203955.1.26440 WP_000203955.1.26493 WP_000203955.1.26551 WP_000203955.1.26567 WP_000203955.1.27010 WP_000203955.1.27173 WP_000203955.1.27206 WP_000203955.1.27423 WP_000203955.1.27561 WP_000203955.1.2763 WP_000203955.1.27665 WP_000203955.1.27707 WP_000203955.1.27761 WP_000203955.1.2777 WP_000203955.1.27857 WP_000203955.1.27977 WP_000203955.1.28094 WP_000203955.1.28170 WP_000203955.1.28225 WP_000203955.1.28302 WP_000203955.1.2835 WP_000203955.1.28370 WP_000203955.1.28538 WP_000203955.1.28575 WP_000203955.1.28625 WP_000203955.1.28655 WP_000203955.1.28694 WP_000203955.1.2879 WP_000203955.1.28830 WP_000203955.1.2890 WP_000203955.1.28938 WP_000203955.1.28946 WP_000203955.1.29006 WP_000203955.1.29010 WP_000203955.1.2910 WP_000203955.1.29588 WP_000203955.1.29601 WP_000203955.1.29606 WP_000203955.1.29615 WP_000203955.1.29619 WP_000203955.1.29704 WP_000203955.1.29969 WP_000203955.1.30006 WP_000203955.1.30027 WP_000203955.1.30180 WP_000203955.1.30469 WP_000203955.1.30505 WP_000203955.1.30507 WP_000203955.1.30535 WP_000203955.1.30547 WP_000203955.1.30794 WP_000203955.1.30833 WP_000203955.1.30835 WP_000203955.1.30972 WP_000203955.1.31 WP_000203955.1.3113 WP_000203955.1.31185 WP_000203955.1.3119 WP_000203955.1.31190 WP_000203955.1.31195 WP_000203955.1.31196 WP_000203955.1.31281 WP_000203955.1.31362 WP_000203955.1.31504 WP_000203955.1.31515 WP_000203955.1.31578 WP_000203955.1.31658 WP_000203955.1.31940 WP_000203955.1.31967 WP_000203955.1.31972 WP_000203955.1.32192 WP_000203955.1.32206 WP_000203955.1.32438 WP_000203955.1.32515 WP_000203955.1.32660 WP_000203955.1.32702 WP_000203955.1.32714 WP_000203955.1.32786 WP_000203955.1.32804 WP_000203955.1.32907 WP_000203955.1.33030 WP_000203955.1.33127 WP_000203955.1.33143 WP_000203955.1.33248 WP_000203955.1.33261 WP_000203955.1.333 WP_000203955.1.33492 WP_000203955.1.33553 WP_000203955.1.33592 WP_000203955.1.33894 WP_000203955.1.34043 WP_000203955.1.34075 WP_000203955.1.34257 WP_000203955.1.34279 WP_000203955.1.34319 WP_000203955.1.34453 WP_000203955.1.34975 WP_000203955.1.35045 WP_000203955.1.35129 WP_000203955.1.35184 WP_000203955.1.35404 WP_000203955.1.35408 WP_000203955.1.35425 WP_000203955.1.35446 WP_000203955.1.35463 WP_000203955.1.35503 WP_000203955.1.35509 WP_000203955.1.35590 WP_000203955.1.35940 WP_000203955.1.36003 WP_000203955.1.3601 WP_000203955.1.36609 WP_000203955.1.36690 WP_000203955.1.3670 WP_000203955.1.36705 WP_000203955.1.36918 WP_000203955.1.36931 WP_000203955.1.37073 WP_000203955.1.37111 WP_000203955.1.37112 WP_000203955.1.37256 WP_000203955.1.37293 WP_000203955.1.37370 WP_000203955.1.37376 WP_000203955.1.3744 WP_000203955.1.37498 WP_000203955.1.37504 WP_000203955.1.37618 WP_000203955.1.37968 WP_000203955.1.37978 WP_000203955.1.38125 WP_000203955.1.38145 WP_000203955.1.383 WP_000203955.1.3848 WP_000203955.1.38609 WP_000203955.1.38613 WP_000203955.1.38673 WP_000203955.1.38693 WP_000203955.1.38773 WP_000203955.1.38882 WP_000203955.1.38913 WP_000203955.1.39003 WP_000203955.1.39136 WP_000203955.1.39197 WP_000203955.1.39229 WP_000203955.1.39405 WP_000203955.1.39420 WP_000203955.1.39449 WP_000203955.1.39512 WP_000203955.1.39629 WP_000203955.1.39763 WP_000203955.1.39862 WP_000203955.1.39921 WP_000203955.1.39923 WP_000203955.1.40017 WP_000203955.1.40072 WP_000203955.1.40073 WP_000203955.1.4011 WP_000203955.1.40208 WP_000203955.1.40240 WP_000203955.1.40257 WP_000203955.1.40292 WP_000203955.1.40305 WP_000203955.1.40311 WP_000203955.1.40395 WP_000203955.1.40465 WP_000203955.1.40710 WP_000203955.1.4075 WP_000203955.1.4087 WP_000203955.1.40877 WP_000203955.1.41017 WP_000203955.1.41086 WP_000203955.1.41091 WP_000203955.1.41226 WP_000203955.1.41279 WP_000203955.1.41516 WP_000203955.1.41554 WP_000203955.1.41591 WP_000203955.1.41662 WP_000203955.1.41708 WP_000203955.1.41761 WP_000203955.1.41882 WP_000203955.1.41979 WP_000203955.1.41985 WP_000203955.1.42104 WP_000203955.1.42320 WP_000203955.1.42342 WP_000203955.1.42422 WP_000203955.1.4276 WP_000203955.1.42864 WP_000203955.1.4288 WP_000203955.1.43018 WP_000203955.1.43041 WP_000203955.1.43244 WP_000203955.1.43312 WP_000203955.1.43437 WP_000203955.1.43522 WP_000203955.1.43613 WP_000203955.1.43668 WP_000203955.1.43886 WP_000203955.1.44005 WP_000203955.1.44043 WP_000203955.1.44099 WP_000203955.1.44121 WP_000203955.1.44291 WP_000203955.1.44310 WP_000203955.1.44479 WP_000203955.1.44578 WP_000203955.1.44640 WP_000203955.1.4467 WP_000203955.1.44747 WP_000203955.1.4485 WP_000203955.1.44877 WP_000203955.1.44927 WP_000203955.1.45038 WP_000203955.1.45067 WP_000203955.1.45074 WP_000203955.1.45079 WP_000203955.1.45098 WP_000203955.1.45177 WP_000203955.1.45184 WP_000203955.1.45259 WP_000203955.1.45349 WP_000203955.1.45365 WP_000203955.1.45550 WP_000203955.1.45585 WP_000203955.1.45660 WP_000203955.1.45690 WP_000203955.1.458 WP_000203955.1.46011 WP_000203955.1.46069 WP_000203955.1.46112 WP_000203955.1.46173 WP_000203955.1.46174 WP_000203955.1.46187 WP_000203955.1.46303 WP_000203955.1.46595 WP_000203955.1.46675 WP_000203955.1.46693 WP_000203955.1.46804 WP_000203955.1.47057 WP_000203955.1.47214 WP_000203955.1.47429 WP_000203955.1.47448 WP_000203955.1.4747 WP_000203955.1.47472 WP_000203955.1.47478 WP_000203955.1.47621 WP_000203955.1.47799 WP_000203955.1.48242 WP_000203955.1.48253 WP_000203955.1.483 WP_000203955.1.48367 WP_000203955.1.48377 WP_000203955.1.4853 WP_000203955.1.48788 WP_000203955.1.48894 WP_000203955.1.48919 WP_000203955.1.49084 WP_000203955.1.49155 WP_000203955.1.49204 WP_000203955.1.49239 WP_000203955.1.49256 WP_000203955.1.49290 WP_000203955.1.49340 WP_000203955.1.49366 WP_000203955.1.49375 WP_000203955.1.49490 WP_000203955.1.49515 WP_000203955.1.49572 WP_000203955.1.4979 WP_000203955.1.49803 WP_000203955.1.49805 WP_000203955.1.49929 WP_000203955.1.50080 WP_000203955.1.50161 WP_000203955.1.50211 WP_000203955.1.50376 WP_000203955.1.50389 WP_000203955.1.50413 WP_000203955.1.50676 WP_000203955.1.50804 WP_000203955.1.50808 WP_000203955.1.5088 WP_000203955.1.50908 WP_000203955.1.50941 WP_000203955.1.51014 WP_000203955.1.51022 WP_000203955.1.51179 WP_000203955.1.51182 WP_000203955.1.51186 WP_000203955.1.51487 WP_000203955.1.51488 WP_000203955.1.51634 WP_000203955.1.51649 WP_000203955.1.51686 WP_000203955.1.51756 WP_000203955.1.51911 WP_000203955.1.51932 WP_000203955.1.51989 WP_000203955.1.52121 WP_000203955.1.52346 WP_000203955.1.52353 WP_000203955.1.52361 WP_000203955.1.52653 WP_000203955.1.52656 WP_000203955.1.52743 WP_000203955.1.52857 WP_000203955.1.52898 WP_000203955.1.52915 WP_000203955.1.53190 WP_000203955.1.53406 WP_000203955.1.53466 WP_000203955.1.53529 WP_000203955.1.53543 WP_000203955.1.53757 WP_000203955.1.53812 WP_000203955.1.54033 WP_000203955.1.54075 WP_000203955.1.54196 WP_000203955.1.54209 WP_000203955.1.54271 WP_000203955.1.54274 WP_000203955.1.54319 WP_000203955.1.54364 WP_000203955.1.54400 WP_000203955.1.54644 WP_000203955.1.54662 WP_000203955.1.54722 WP_000203955.1.54749 WP_000203955.1.54764 WP_000203955.1.55008 WP_000203955.1.55152 WP_000203955.1.55156 WP_000203955.1.55285 WP_000203955.1.55475 WP_000203955.1.55647 WP_000203955.1.55743 WP_000203955.1.55768 WP_000203955.1.55782 WP_000203955.1.55796 WP_000203955.1.56002 WP_000203955.1.56012 WP_000203955.1.56105 WP_000203955.1.56238 WP_000203955.1.56286 WP_000203955.1.56304 WP_000203955.1.56414 WP_000203955.1.56438 WP_000203955.1.56560 WP_000203955.1.56601 WP_000203955.1.56614 WP_000203955.1.56615 WP_000203955.1.56671 WP_000203955.1.56682 WP_000203955.1.56875 WP_000203955.1.56877 WP_000203955.1.57168 WP_000203955.1.57187 WP_000203955.1.57377 WP_000203955.1.57433 WP_000203955.1.57515 WP_000203955.1.57529 WP_000203955.1.57576 WP_000203955.1.57601 WP_000203955.1.57607 WP_000203955.1.57763 WP_000203955.1.57862 WP_000203955.1.57890 WP_000203955.1.57891 WP_000203955.1.57978 WP_000203955.1.5801 WP_000203955.1.58418 WP_000203955.1.58548 WP_000203955.1.5858 WP_000203955.1.58662 WP_000203955.1.58669 WP_000203955.1.58745 WP_000203955.1.58803 WP_000203955.1.5886 WP_000203955.1.59094 WP_000203955.1.59224 WP_000203955.1.59375 WP_000203955.1.59458 WP_000203955.1.59490 WP_000203955.1.59508 WP_000203955.1.59521 WP_000203955.1.59684 WP_000203955.1.59694 WP_000203955.1.59710 WP_000203955.1.59771 WP_000203955.1.5979 WP_000203955.1.59953 WP_000203955.1.60008 WP_000203955.1.60021 WP_000203955.1.60069 WP_000203955.1.60140 WP_000203955.1.60155 WP_000203955.1.60285 WP_000203955.1.60379 WP_000203955.1.60464 WP_000203955.1.60874 WP_000203955.1.60941 WP_000203955.1.61045 WP_000203955.1.61078 WP_000203955.1.6114 WP_000203955.1.61232 WP_000203955.1.6129 WP_000203955.1.61296 WP_000203955.1.61345 WP_000203955.1.61417 WP_000203955.1.61712 WP_000203955.1.61714 WP_000203955.1.61730 WP_000203955.1.61857 WP_000203955.1.61918 WP_000203955.1.61952 WP_000203955.1.62007 WP_000203955.1.62025 WP_000203955.1.62204 WP_000203955.1.62304 WP_000203955.1.62364 WP_000203955.1.62374 WP_000203955.1.62403 WP_000203955.1.6253 WP_000203955.1.62853 WP_000203955.1.62903 WP_000203955.1.62910 WP_000203955.1.62955 WP_000203955.1.63203 WP_000203955.1.63256 WP_000203955.1.63290 WP_000203955.1.63382 WP_000203955.1.63432 WP_000203955.1.63461 WP_000203955.1.63479 WP_000203955.1.63577 WP_000203955.1.63664 WP_000203955.1.63718 WP_000203955.1.6375 WP_000203955.1.63834 WP_000203955.1.64046 WP_000203955.1.6423 WP_000203955.1.64244 WP_000203955.1.64403 WP_000203955.1.64649 WP_000203955.1.64702 WP_000203955.1.64757 WP_000203955.1.64781 WP_000203955.1.64831 WP_000203955.1.6489 WP_000203955.1.65018 WP_000203955.1.65028 WP_000203955.1.65171 WP_000203955.1.65248 WP_000203955.1.6535 WP_000203955.1.65474 WP_000203955.1.65633 WP_000203955.1.6565 WP_000203955.1.65696 WP_000203955.1.6575 WP_000203955.1.65782 WP_000203955.1.6630 WP_000203955.1.66314 WP_000203955.1.66362 WP_000203955.1.6638 WP_000203955.1.6640 WP_000203955.1.66698 WP_000203955.1.6680 WP_000203955.1.66820 WP_000203955.1.66834 WP_000203955.1.66901 WP_000203955.1.66962 WP_000203955.1.67037 WP_000203955.1.67045 WP_000203955.1.67181 WP_000203955.1.67268 WP_000203955.1.67347 WP_000203955.1.67465 WP_000203955.1.67552 WP_000203955.1.67637 WP_000203955.1.67682 WP_000203955.1.67829 WP_000203955.1.67887 WP_000203955.1.68073 WP_000203955.1.68201 WP_000203955.1.68206 WP_000203955.1.6827 WP_000203955.1.68275 WP_000203955.1.6849 WP_000203955.1.68547 WP_000203955.1.68589 WP_000203955.1.68655 WP_000203955.1.68656 WP_000203955.1.68778 WP_000203955.1.68787 WP_000203955.1.68894 WP_000203955.1.68928 WP_000203955.1.68975 WP_000203955.1.69006 WP_000203955.1.6913 WP_000203955.1.69146 WP_000203955.1.69255 WP_000203955.1.69397 WP_000203955.1.69564 WP_000203955.1.69644 WP_000203955.1.69704 WP_000203955.1.7021 WP_000203955.1.70241 WP_000203955.1.70269 WP_000203955.1.70289 WP_000203955.1.70447 WP_000203955.1.70485 WP_000203955.1.70643 WP_000203955.1.70683 WP_000203955.1.70883 WP_000203955.1.70922 WP_000203955.1.70948 WP_000203955.1.71116 WP_000203955.1.71146 WP_000203955.1.71165 WP_000203955.1.71188 WP_000203955.1.71202 WP_000203955.1.71243 WP_000203955.1.71306 WP_000203955.1.71337 WP_000203955.1.71378 WP_000203955.1.71401 WP_000203955.1.71702 WP_000203955.1.71750 WP_000203955.1.71845 WP_000203955.1.71881 WP_000203955.1.71908 WP_000203955.1.71952 WP_000203955.1.71973 WP_000203955.1.72105 WP_000203955.1.72203 WP_000203955.1.72376 WP_000203955.1.72594 WP_000203955.1.72871 WP_000203955.1.72975 WP_000203955.1.7315 WP_000203955.1.73200 WP_000203955.1.7334 WP_000203955.1.73377 WP_000203955.1.73481 WP_000203955.1.7356 WP_000203955.1.73581 WP_000203955.1.73617 WP_000203955.1.73753 WP_000203955.1.73758 WP_000203955.1.73794 WP_000203955.1.7387 WP_000203955.1.73924 WP_000203955.1.74029 WP_000203955.1.74181 WP_000203955.1.74191 WP_000203955.1.7433 WP_000203955.1.74379 WP_000203955.1.74410 WP_000203955.1.74466 WP_000203955.1.74529 WP_000203955.1.74545 WP_000203955.1.74745 WP_000203955.1.75129 WP_000203955.1.75187 WP_000203955.1.75288 WP_000203955.1.75334 WP_000203955.1.75362 WP_000203955.1.75385 WP_000203955.1.75392 WP_000203955.1.75760 WP_000203955.1.75764 WP_000203955.1.75837 WP_000203955.1.75874 WP_000203955.1.75945 WP_000203955.1.76020 WP_000203955.1.76102 WP_000203955.1.76170 WP_000203955.1.76252 WP_000203955.1.76445 WP_000203955.1.7660 WP_000203955.1.76673 WP_000203955.1.76706 WP_000203955.1.76721 WP_000203955.1.76756 WP_000203955.1.76760 WP_000203955.1.76875 WP_000203955.1.76880 WP_000203955.1.76899 WP_000203955.1.77038 WP_000203955.1.77047 WP_000203955.1.77080 WP_000203955.1.7712 WP_000203955.1.77180 WP_000203955.1.77244 WP_000203955.1.77292 WP_000203955.1.77349 WP_000203955.1.77514 WP_000203955.1.77549 WP_000203955.1.77692 WP_000203955.1.7782 WP_000203955.1.77851 WP_000203955.1.77918 WP_000203955.1.77960 WP_000203955.1.78033 WP_000203955.1.78076 WP_000203955.1.78096 WP_000203955.1.78100 WP_000203955.1.78110 WP_000203955.1.78120 WP_000203955.1.78383 WP_000203955.1.78407 WP_000203955.1.7861 WP_000203955.1.78618 WP_000203955.1.78673 WP_000203955.1.78735 WP_000203955.1.78802 WP_000203955.1.78830 WP_000203955.1.78835 WP_000203955.1.78871 WP_000203955.1.78874 WP_000203955.1.78918 WP_000203955.1.78930 WP_000203955.1.79151 WP_000203955.1.79167 WP_000203955.1.79335 WP_000203955.1.79462 WP_000203955.1.79472 WP_000203955.1.79490 WP_000203955.1.79495 WP_000203955.1.79529 WP_000203955.1.7964 WP_000203955.1.79659 WP_000203955.1.79668 WP_000203955.1.79708 WP_000203955.1.79845 WP_000203955.1.80077 WP_000203955.1.80137 WP_000203955.1.80182 WP_000203955.1.80296 WP_000203955.1.80366 WP_000203955.1.80780 WP_000203955.1.80831 WP_000203955.1.80850 WP_000203955.1.80881 WP_000203955.1.80939 WP_000203955.1.8096 WP_000203955.1.81037 WP_000203955.1.81069 WP_000203955.1.81149 WP_000203955.1.81175 WP_000203955.1.8119 WP_000203955.1.81354 WP_000203955.1.81425 WP_000203955.1.81750 WP_000203955.1.81785 WP_000203955.1.81902 WP_000203955.1.81974 WP_000203955.1.82337 WP_000203955.1.82479 WP_000203955.1.82503 WP_000203955.1.82515 WP_000203955.1.82676 WP_000203955.1.82761 WP_000203955.1.8282 WP_000203955.1.82944 WP_000203955.1.82956 WP_000203955.1.83092 WP_000203955.1.83163 WP_000203955.1.83305 WP_000203955.1.83413 WP_000203955.1.83491 WP_000203955.1.83523 WP_000203955.1.8354 WP_000203955.1.83721 WP_000203955.1.83760 WP_000203955.1.83995 WP_000203955.1.84103 WP_000203955.1.84283 WP_000203955.1.84392 WP_000203955.1.8441 WP_000203955.1.84532 WP_000203955.1.84554 WP_000203955.1.84659 WP_000203955.1.84899 WP_000203955.1.8497 WP_000203955.1.85040 WP_000203955.1.85134 WP_000203955.1.85178 WP_000203955.1.85180 WP_000203955.1.85190 WP_000203955.1.8533 WP_000203955.1.8545 WP_000203955.1.85481 WP_000203955.1.85483 WP_000203955.1.85541 WP_000203955.1.8556 WP_000203955.1.85615 WP_000203955.1.85617 WP_000203955.1.85663 WP_000203955.1.85671 WP_000203955.1.85672 WP_000203955.1.85777 WP_000203955.1.85886 WP_000203955.1.85900 WP_000203955.1.85904 WP_000203955.1.85976 WP_000203955.1.86306 WP_000203955.1.86356 WP_000203955.1.86450 WP_000203955.1.86469 WP_000203955.1.86580 WP_000203955.1.86588 WP_000203955.1.86661 WP_000203955.1.8672 WP_000203955.1.8678 WP_000203955.1.86810 WP_000203955.1.8684 WP_000203955.1.86895 WP_000203955.1.86906 WP_000203955.1.87095 WP_000203955.1.8736 WP_000203955.1.87460 WP_000203955.1.87552 WP_000203955.1.87779 WP_000203955.1.87945 WP_000203955.1.88019 WP_000203955.1.88073 WP_000203955.1.8809 WP_000203955.1.88291 WP_000203955.1.88293 WP_000203955.1.8837 WP_000203955.1.88393 WP_000203955.1.88703 WP_000203955.1.88792 WP_000203955.1.88902 WP_000203955.1.8891 WP_000203955.1.89008 WP_000203955.1.89116 WP_000203955.1.89138 WP_000203955.1.89304 WP_000203955.1.89512 WP_000203955.1.89527 WP_000203955.1.89570 WP_000203955.1.89604 WP_000203955.1.89622 WP_000203955.1.89659 WP_000203955.1.89902 WP_000203955.1.8996 WP_000203955.1.90097 WP_000203955.1.90252 WP_000203955.1.90417 WP_000203955.1.90453 WP_000203955.1.90458 WP_000203955.1.90557 WP_000203955.1.90585 WP_000203955.1.90641 WP_000203955.1.90734 WP_000203955.1.91003 WP_000203955.1.91069 WP_000203955.1.91278 WP_000203955.1.91493 WP_000203955.1.91512 WP_000203955.1.91564 WP_000203955.1.91628 WP_000203955.1.91724 WP_000203955.1.91732 WP_000203955.1.91788 WP_000203955.1.92013 WP_000203955.1.92093 WP_000203955.1.92108 WP_000203955.1.92183 WP_000203955.1.92208 WP_000203955.1.92268 WP_000203955.1.92310 WP_000203955.1.92443 WP_000203955.1.92482 WP_000203955.1.92531 WP_000203955.1.92669 WP_000203955.1.92671 WP_000203955.1.92738 WP_000203955.1.93086 WP_000203955.1.93101 WP_000203955.1.93136 WP_000203955.1.93155 WP_000203955.1.93365 WP_000203955.1.93543 WP_000203955.1.93650 WP_000203955.1.93656 WP_000203955.1.93662 WP_000203955.1.937 WP_000203955.1.93705 WP_000203955.1.93804 WP_000203955.1.9389 WP_000203955.1.93994 WP_000203955.1.94072 WP_000203955.1.94162 WP_000203955.1.94168 WP_000203955.1.94198 WP_000203955.1.9432 WP_000203955.1.94354 WP_000203955.1.94380 WP_000203955.1.94458 WP_000203955.1.94565 WP_000203955.1.94584 WP_000203955.1.94674 WP_000203955.1.94796 WP_000203955.1.94959 WP_000203955.1.95051 WP_000203955.1.95085 WP_000203955.1.95121 WP_000203955.1.95282 WP_000203955.1.95546 WP_000203955.1.95630 WP_000203955.1.95911 WP_000203955.1.96139 WP_000203955.1.96317 WP_000203955.1.96343 WP_000203955.1.9644 WP_000203955.1.96469 WP_000203955.1.96500 WP_000203955.1.96555 WP_000203955.1.96563 WP_000203955.1.96732 WP_000203955.1.96771 WP_000203955.1.97015 WP_000203955.1.97145 WP_000203955.1.97190 WP_000203955.1.97318 WP_000203955.1.97369 WP_000203955.1.97594 WP_000203955.1.97597 WP_000203955.1.97613 WP_000203955.1.97620 WP_000203955.1.97727 WP_000203955.1.97732 WP_000203955.1.97736 WP_000203955.1.9775 WP_000203955.1.97846 WP_000203955.1.98006 WP_000203955.1.98019 WP_000203955.1.98022 WP_000203955.1.98110 WP_000203955.1.98146 WP_000203955.1.98219 WP_000203955.1.9841 WP_000203955.1.98495 WP_000203955.1.98531 WP_000203955.1.98577 WP_000203955.1.98677 WP_000203955.1.98760 WP_000203955.1.98843 WP_000203955.1.99098 WP_000203955.1.99184 WP_000203955.1.99276 WP_000203955.1.99646 WP_000203955.1.99657 WP_000203955.1.99660 WP_000203955.1.99712 WP_000203955.1.99813 WP_000203955.1.99858 WP_000203955.1.99889 WP_000203955.1.99958 gi|549723145|ref|YP_008643335.1| gi|525856795|ref|YP_008259685.1| gi|383495239|ref|YP_005395928.1| gi|378983036|ref|YP_005246191.1| gi|378987832|ref|YP_005250996.1| gi|379699651|ref|YP_005241379.1| gi|378443935|ref|YP_005231567.1| 99287.STM0431 gi|550899886|ref|YP_008668978.1| gi|378448766|ref|YP_005236125.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]