SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482905357|ref|YP_007903917.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482905357|ref|YP_007903917.1|
Domain Number 1 Region: 20-423
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.46e-134
Family GABA-aminotransferase-like 0.00000000000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|482905357|ref|YP_007903917.1|
Sequence length 427
Comment 4-aminobutyrate aminotransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MNTNNALMQRRHNAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
GIVSAVEAQLKKLSHTCFQVLAYEPYLALCERMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGAIAFSGAYHGRTHYTLSLTGKVHPYSAGMGLMPGHVYRALYPCPLHNISD
DDAIASIERIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDQHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRADVMDAIAPGGLGGTYAG
NPIACAAALAVLDIFEQENLLQKANTLGKTLRDGLMEIAETHREIGDVRGLGAMIAIELF
ENGDPGKPNAALTADIVTRAREKGLILLSCGPYYNILRILVPLTIEASQIRQGLEIIAQC
FDEAKQA
Download sequence
Identical sequences A0A0D6IJ15 A0A0F6B5J3 A0A0F7DJA4 A0A0H3NF14 A0A0M0PX96 A0A0U1GMN1 A0A265BC51 A0A2D3AFC3 A0A2H9YBP3 C0PWI9 Q57KY2 Q8ZMM1
gi|378990121|ref|YP_005253285.1| gi|378985385|ref|YP_005248541.1| gi|378700708|ref|YP_005182665.1| IDP01016 ABAO01000014|CDS_74505-75788 ABEL01000015|CDS_34643-35926 ABFF01000027|CDS_28802-27519 ABFG01000005|CDS_284031-282748 AE006468|CDS_2941597-2942880 AE017220|CDS_2896280-2897563 CP000857|CDS_2876811-2878094 CP001120|CDS_2916108-2917391 CP001363|CDS_2961832-2963115 FN424405|CDS_2934582-2935865 gi|194450310|ref|YP_002046752.1| gi|549725370|ref|YP_008645560.1| gi|386592485|ref|YP_006088885.1| gi|526221230|ref|YP_008267003.1| gi|525829334|ref|YP_008252416.1| gi|16766103|ref|NP_461718.1| gi|224584574|ref|YP_002638372.1| 321314.SC2724 454169.SeHA_C2972 476213.SPC_2835 99287.STM2792 NP_461718.1.58477 WP_001095556.1.100010 WP_001095556.1.100234 WP_001095556.1.100376 WP_001095556.1.100424 WP_001095556.1.100436 WP_001095556.1.100484 WP_001095556.1.100488 WP_001095556.1.100597 WP_001095556.1.100730 WP_001095556.1.10076 WP_001095556.1.100781 WP_001095556.1.100793 WP_001095556.1.100869 WP_001095556.1.100871 WP_001095556.1.100882 WP_001095556.1.101007 WP_001095556.1.101020 WP_001095556.1.101074 WP_001095556.1.101078 WP_001095556.1.101180 WP_001095556.1.101259 WP_001095556.1.101284 WP_001095556.1.101291 WP_001095556.1.1013 WP_001095556.1.101353 WP_001095556.1.101386 WP_001095556.1.101404 WP_001095556.1.101420 WP_001095556.1.101454 WP_001095556.1.101589 WP_001095556.1.101636 WP_001095556.1.101707 WP_001095556.1.101734 WP_001095556.1.101741 WP_001095556.1.101878 WP_001095556.1.101953 WP_001095556.1.101975 WP_001095556.1.10220 WP_001095556.1.10231 WP_001095556.1.10266 WP_001095556.1.10429 WP_001095556.1.10439 WP_001095556.1.10566 WP_001095556.1.10678 WP_001095556.1.10711 WP_001095556.1.10753 WP_001095556.1.10992 WP_001095556.1.11024 WP_001095556.1.11031 WP_001095556.1.11098 WP_001095556.1.1110 WP_001095556.1.11156 WP_001095556.1.11168 WP_001095556.1.11190 WP_001095556.1.11254 WP_001095556.1.11295 WP_001095556.1.11455 WP_001095556.1.11458 WP_001095556.1.11518 WP_001095556.1.11532 WP_001095556.1.11543 WP_001095556.1.11588 WP_001095556.1.11677 WP_001095556.1.11687 WP_001095556.1.11735 WP_001095556.1.11763 WP_001095556.1.11772 WP_001095556.1.11834 WP_001095556.1.11868 WP_001095556.1.11875 WP_001095556.1.11897 WP_001095556.1.11964 WP_001095556.1.12017 WP_001095556.1.12114 WP_001095556.1.12351 WP_001095556.1.12370 WP_001095556.1.12397 WP_001095556.1.12546 WP_001095556.1.1264 WP_001095556.1.12701 WP_001095556.1.12728 WP_001095556.1.12879 WP_001095556.1.12936 WP_001095556.1.12995 WP_001095556.1.13027 WP_001095556.1.13101 WP_001095556.1.13106 WP_001095556.1.13130 WP_001095556.1.13207 WP_001095556.1.13414 WP_001095556.1.13488 WP_001095556.1.13509 WP_001095556.1.13669 WP_001095556.1.13741 WP_001095556.1.1387 WP_001095556.1.13908 WP_001095556.1.13932 WP_001095556.1.13968 WP_001095556.1.14001 WP_001095556.1.14050 WP_001095556.1.14056 WP_001095556.1.14111 WP_001095556.1.14151 WP_001095556.1.14239 WP_001095556.1.14320 WP_001095556.1.14379 WP_001095556.1.1440 WP_001095556.1.14406 WP_001095556.1.14410 WP_001095556.1.14436 WP_001095556.1.14458 WP_001095556.1.14466 WP_001095556.1.14524 WP_001095556.1.14554 WP_001095556.1.14618 WP_001095556.1.14725 WP_001095556.1.14789 WP_001095556.1.14852 WP_001095556.1.14876 WP_001095556.1.1489 WP_001095556.1.14932 WP_001095556.1.15055 WP_001095556.1.15102 WP_001095556.1.15124 WP_001095556.1.15223 WP_001095556.1.15226 WP_001095556.1.15316 WP_001095556.1.15369 WP_001095556.1.1540 WP_001095556.1.15468 WP_001095556.1.15508 WP_001095556.1.15627 WP_001095556.1.15637 WP_001095556.1.15784 WP_001095556.1.15830 WP_001095556.1.15862 WP_001095556.1.15910 WP_001095556.1.15986 WP_001095556.1.16004 WP_001095556.1.16047 WP_001095556.1.16062 WP_001095556.1.16063 WP_001095556.1.16103 WP_001095556.1.16172 WP_001095556.1.16226 WP_001095556.1.16233 WP_001095556.1.16284 WP_001095556.1.16328 WP_001095556.1.1635 WP_001095556.1.16361 WP_001095556.1.16468 WP_001095556.1.16525 WP_001095556.1.16551 WP_001095556.1.16614 WP_001095556.1.16650 WP_001095556.1.16686 WP_001095556.1.16691 WP_001095556.1.16732 WP_001095556.1.16735 WP_001095556.1.16786 WP_001095556.1.16858 WP_001095556.1.16873 WP_001095556.1.16896 WP_001095556.1.16903 WP_001095556.1.16916 WP_001095556.1.16965 WP_001095556.1.1700 WP_001095556.1.17093 WP_001095556.1.17307 WP_001095556.1.174 WP_001095556.1.17480 WP_001095556.1.17546 WP_001095556.1.1757 WP_001095556.1.17693 WP_001095556.1.17702 WP_001095556.1.17705 WP_001095556.1.17743 WP_001095556.1.17758 WP_001095556.1.17891 WP_001095556.1.1798 WP_001095556.1.18019 WP_001095556.1.18111 WP_001095556.1.18122 WP_001095556.1.18163 WP_001095556.1.1818 WP_001095556.1.1825 WP_001095556.1.18254 WP_001095556.1.18265 WP_001095556.1.18267 WP_001095556.1.18468 WP_001095556.1.18607 WP_001095556.1.18705 WP_001095556.1.18715 WP_001095556.1.18776 WP_001095556.1.18822 WP_001095556.1.18881 WP_001095556.1.18940 WP_001095556.1.18949 WP_001095556.1.19053 WP_001095556.1.19273 WP_001095556.1.19320 WP_001095556.1.19458 WP_001095556.1.19460 WP_001095556.1.19461 WP_001095556.1.19588 WP_001095556.1.19614 WP_001095556.1.19616 WP_001095556.1.1968 WP_001095556.1.19702 WP_001095556.1.19706 WP_001095556.1.19724 WP_001095556.1.19740 WP_001095556.1.19749 WP_001095556.1.19784 WP_001095556.1.19793 WP_001095556.1.19802 WP_001095556.1.19809 WP_001095556.1.19867 WP_001095556.1.19975 WP_001095556.1.1998 WP_001095556.1.20 WP_001095556.1.2010 WP_001095556.1.20212 WP_001095556.1.20266 WP_001095556.1.20271 WP_001095556.1.20362 WP_001095556.1.20415 WP_001095556.1.20418 WP_001095556.1.20443 WP_001095556.1.20446 WP_001095556.1.20488 WP_001095556.1.20503 WP_001095556.1.20525 WP_001095556.1.2054 WP_001095556.1.20553 WP_001095556.1.20614 WP_001095556.1.20626 WP_001095556.1.20646 WP_001095556.1.20862 WP_001095556.1.20886 WP_001095556.1.20900 WP_001095556.1.20908 WP_001095556.1.21049 WP_001095556.1.21136 WP_001095556.1.21146 WP_001095556.1.21245 WP_001095556.1.21246 WP_001095556.1.21269 WP_001095556.1.21351 WP_001095556.1.21400 WP_001095556.1.2146 WP_001095556.1.21497 WP_001095556.1.21499 WP_001095556.1.21603 WP_001095556.1.21751 WP_001095556.1.21757 WP_001095556.1.21825 WP_001095556.1.21991 WP_001095556.1.22024 WP_001095556.1.2205 WP_001095556.1.22062 WP_001095556.1.22067 WP_001095556.1.2221 WP_001095556.1.22235 WP_001095556.1.22270 WP_001095556.1.2235 WP_001095556.1.22379 WP_001095556.1.22427 WP_001095556.1.2246 WP_001095556.1.22485 WP_001095556.1.22620 WP_001095556.1.22692 WP_001095556.1.22758 WP_001095556.1.22864 WP_001095556.1.22870 WP_001095556.1.22979 WP_001095556.1.23102 WP_001095556.1.23114 WP_001095556.1.2314 WP_001095556.1.23192 WP_001095556.1.23259 WP_001095556.1.23379 WP_001095556.1.23460 WP_001095556.1.23472 WP_001095556.1.23482 WP_001095556.1.23509 WP_001095556.1.23513 WP_001095556.1.23634 WP_001095556.1.2364 WP_001095556.1.23646 WP_001095556.1.23755 WP_001095556.1.23932 WP_001095556.1.23959 WP_001095556.1.24017 WP_001095556.1.24082 WP_001095556.1.24206 WP_001095556.1.24308 WP_001095556.1.24578 WP_001095556.1.24737 WP_001095556.1.24779 WP_001095556.1.24995 WP_001095556.1.25008 WP_001095556.1.25015 WP_001095556.1.25119 WP_001095556.1.25405 WP_001095556.1.25454 WP_001095556.1.25493 WP_001095556.1.25668 WP_001095556.1.25690 WP_001095556.1.2570 WP_001095556.1.25740 WP_001095556.1.25793 WP_001095556.1.25814 WP_001095556.1.25928 WP_001095556.1.25988 WP_001095556.1.26282 WP_001095556.1.26311 WP_001095556.1.26319 WP_001095556.1.26429 WP_001095556.1.26440 WP_001095556.1.26493 WP_001095556.1.26551 WP_001095556.1.26567 WP_001095556.1.26741 WP_001095556.1.26882 WP_001095556.1.26919 WP_001095556.1.26980 WP_001095556.1.27010 WP_001095556.1.27072 WP_001095556.1.27084 WP_001095556.1.27173 WP_001095556.1.27206 WP_001095556.1.27223 WP_001095556.1.27255 WP_001095556.1.27423 WP_001095556.1.27523 WP_001095556.1.27544 WP_001095556.1.27561 WP_001095556.1.2763 WP_001095556.1.27665 WP_001095556.1.27707 WP_001095556.1.27713 WP_001095556.1.27761 WP_001095556.1.2777 WP_001095556.1.27815 WP_001095556.1.27857 WP_001095556.1.27977 WP_001095556.1.28032 WP_001095556.1.28094 WP_001095556.1.28170 WP_001095556.1.28301 WP_001095556.1.28302 WP_001095556.1.2835 WP_001095556.1.28370 WP_001095556.1.28538 WP_001095556.1.28575 WP_001095556.1.28625 WP_001095556.1.28655 WP_001095556.1.28694 WP_001095556.1.2879 WP_001095556.1.2890 WP_001095556.1.28938 WP_001095556.1.28946 WP_001095556.1.28948 WP_001095556.1.29006 WP_001095556.1.29010 WP_001095556.1.29099 WP_001095556.1.2910 WP_001095556.1.29113 WP_001095556.1.29255 WP_001095556.1.29349 WP_001095556.1.29509 WP_001095556.1.29588 WP_001095556.1.29601 WP_001095556.1.29606 WP_001095556.1.29615 WP_001095556.1.29619 WP_001095556.1.29704 WP_001095556.1.29827 WP_001095556.1.29969 WP_001095556.1.29990 WP_001095556.1.30006 WP_001095556.1.30022 WP_001095556.1.30027 WP_001095556.1.30180 WP_001095556.1.30195 WP_001095556.1.30202 WP_001095556.1.30469 WP_001095556.1.30505 WP_001095556.1.30507 WP_001095556.1.30535 WP_001095556.1.30547 WP_001095556.1.3068 WP_001095556.1.30794 WP_001095556.1.3080 WP_001095556.1.30833 WP_001095556.1.30835 WP_001095556.1.30972 WP_001095556.1.31 WP_001095556.1.31092 WP_001095556.1.31122 WP_001095556.1.3113 WP_001095556.1.3114 WP_001095556.1.31185 WP_001095556.1.3119 WP_001095556.1.31190 WP_001095556.1.31195 WP_001095556.1.31196 WP_001095556.1.31281 WP_001095556.1.31362 WP_001095556.1.31451 WP_001095556.1.31504 WP_001095556.1.31515 WP_001095556.1.31578 WP_001095556.1.31658 WP_001095556.1.31665 WP_001095556.1.31725 WP_001095556.1.31940 WP_001095556.1.31952 WP_001095556.1.31967 WP_001095556.1.31972 WP_001095556.1.32192 WP_001095556.1.32206 WP_001095556.1.32260 WP_001095556.1.32438 WP_001095556.1.32491 WP_001095556.1.32493 WP_001095556.1.32515 WP_001095556.1.32660 WP_001095556.1.32702 WP_001095556.1.32714 WP_001095556.1.32786 WP_001095556.1.32804 WP_001095556.1.32907 WP_001095556.1.33030 WP_001095556.1.33106 WP_001095556.1.33127 WP_001095556.1.33143 WP_001095556.1.33248 WP_001095556.1.33261 WP_001095556.1.333 WP_001095556.1.33492 WP_001095556.1.33553 WP_001095556.1.33580 WP_001095556.1.33592 WP_001095556.1.33894 WP_001095556.1.3394 WP_001095556.1.33986 WP_001095556.1.34043 WP_001095556.1.34075 WP_001095556.1.34257 WP_001095556.1.34279 WP_001095556.1.34319 WP_001095556.1.34417 WP_001095556.1.34453 WP_001095556.1.34458 WP_001095556.1.34610 WP_001095556.1.34854 WP_001095556.1.34856 WP_001095556.1.34972 WP_001095556.1.34975 WP_001095556.1.35045 WP_001095556.1.35129 WP_001095556.1.35184 WP_001095556.1.35193 WP_001095556.1.35404 WP_001095556.1.35408 WP_001095556.1.35425 WP_001095556.1.35446 WP_001095556.1.35463 WP_001095556.1.35503 WP_001095556.1.35509 WP_001095556.1.35590 WP_001095556.1.35648 WP_001095556.1.35892 WP_001095556.1.35940 WP_001095556.1.36003 WP_001095556.1.3601 WP_001095556.1.36017 WP_001095556.1.36547 WP_001095556.1.36609 WP_001095556.1.36690 WP_001095556.1.3670 WP_001095556.1.36705 WP_001095556.1.36918 WP_001095556.1.36931 WP_001095556.1.36948 WP_001095556.1.37013 WP_001095556.1.37073 WP_001095556.1.37111 WP_001095556.1.37112 WP_001095556.1.37256 WP_001095556.1.37293 WP_001095556.1.37370 WP_001095556.1.37376 WP_001095556.1.3744 WP_001095556.1.37478 WP_001095556.1.37498 WP_001095556.1.37504 WP_001095556.1.37521 WP_001095556.1.37618 WP_001095556.1.37968 WP_001095556.1.37978 WP_001095556.1.38125 WP_001095556.1.38145 WP_001095556.1.383 WP_001095556.1.38393 WP_001095556.1.3848 WP_001095556.1.38569 WP_001095556.1.38613 WP_001095556.1.38673 WP_001095556.1.38693 WP_001095556.1.38773 WP_001095556.1.38781 WP_001095556.1.38882 WP_001095556.1.38913 WP_001095556.1.39003 WP_001095556.1.39113 WP_001095556.1.39136 WP_001095556.1.39197 WP_001095556.1.39229 WP_001095556.1.39265 WP_001095556.1.39405 WP_001095556.1.39420 WP_001095556.1.39449 WP_001095556.1.39471 WP_001095556.1.39512 WP_001095556.1.39609 WP_001095556.1.39629 WP_001095556.1.39724 WP_001095556.1.39763 WP_001095556.1.39862 WP_001095556.1.39921 WP_001095556.1.39923 WP_001095556.1.40017 WP_001095556.1.40072 WP_001095556.1.40073 WP_001095556.1.4011 WP_001095556.1.40208 WP_001095556.1.40229 WP_001095556.1.40240 WP_001095556.1.40257 WP_001095556.1.40258 WP_001095556.1.40292 WP_001095556.1.40305 WP_001095556.1.40341 WP_001095556.1.40380 WP_001095556.1.40395 WP_001095556.1.40465 WP_001095556.1.40710 WP_001095556.1.4075 WP_001095556.1.4087 WP_001095556.1.40877 WP_001095556.1.40979 WP_001095556.1.40996 WP_001095556.1.41017 WP_001095556.1.41018 WP_001095556.1.41086 WP_001095556.1.41091 WP_001095556.1.41226 WP_001095556.1.41279 WP_001095556.1.41554 WP_001095556.1.41572 WP_001095556.1.41591 WP_001095556.1.41662 WP_001095556.1.41708 WP_001095556.1.41761 WP_001095556.1.41877 WP_001095556.1.41882 WP_001095556.1.41979 WP_001095556.1.41985 WP_001095556.1.42104 WP_001095556.1.42156 WP_001095556.1.4222 WP_001095556.1.42243 WP_001095556.1.42320 WP_001095556.1.42342 WP_001095556.1.42422 WP_001095556.1.42444 WP_001095556.1.42676 WP_001095556.1.42707 WP_001095556.1.4276 WP_001095556.1.42864 WP_001095556.1.4288 WP_001095556.1.4289 WP_001095556.1.43018 WP_001095556.1.43041 WP_001095556.1.43077 WP_001095556.1.43244 WP_001095556.1.43276 WP_001095556.1.43312 WP_001095556.1.43334 WP_001095556.1.43339 WP_001095556.1.43371 WP_001095556.1.43437 WP_001095556.1.43438 WP_001095556.1.43441 WP_001095556.1.43522 WP_001095556.1.43613 WP_001095556.1.43668 WP_001095556.1.43710 WP_001095556.1.43778 WP_001095556.1.43886 WP_001095556.1.43951 WP_001095556.1.44005 WP_001095556.1.44043 WP_001095556.1.44099 WP_001095556.1.44121 WP_001095556.1.44291 WP_001095556.1.44300 WP_001095556.1.44310 WP_001095556.1.44386 WP_001095556.1.44433 WP_001095556.1.44479 WP_001095556.1.44640 WP_001095556.1.4467 WP_001095556.1.44747 WP_001095556.1.4485 WP_001095556.1.44877 WP_001095556.1.449 WP_001095556.1.44927 WP_001095556.1.44933 WP_001095556.1.44943 WP_001095556.1.45067 WP_001095556.1.45074 WP_001095556.1.45079 WP_001095556.1.45098 WP_001095556.1.45145 WP_001095556.1.45177 WP_001095556.1.45184 WP_001095556.1.45259 WP_001095556.1.45349 WP_001095556.1.45365 WP_001095556.1.4540 WP_001095556.1.45434 WP_001095556.1.45550 WP_001095556.1.45582 WP_001095556.1.45585 WP_001095556.1.45622 WP_001095556.1.45660 WP_001095556.1.45690 WP_001095556.1.45781 WP_001095556.1.458 WP_001095556.1.45848 WP_001095556.1.46011 WP_001095556.1.46069 WP_001095556.1.46112 WP_001095556.1.46173 WP_001095556.1.46174 WP_001095556.1.46187 WP_001095556.1.46205 WP_001095556.1.46278 WP_001095556.1.46303 WP_001095556.1.46323 WP_001095556.1.46434 WP_001095556.1.46572 WP_001095556.1.46595 WP_001095556.1.46675 WP_001095556.1.46732 WP_001095556.1.47008 WP_001095556.1.47057 WP_001095556.1.47214 WP_001095556.1.47389 WP_001095556.1.47429 WP_001095556.1.47448 WP_001095556.1.4747 WP_001095556.1.47472 WP_001095556.1.47506 WP_001095556.1.47579 WP_001095556.1.47621 WP_001095556.1.4770 WP_001095556.1.47799 WP_001095556.1.47849 WP_001095556.1.48242 WP_001095556.1.48253 WP_001095556.1.483 WP_001095556.1.48367 WP_001095556.1.48377 WP_001095556.1.4853 WP_001095556.1.48788 WP_001095556.1.4885 WP_001095556.1.48855 WP_001095556.1.48876 WP_001095556.1.48894 WP_001095556.1.48919 WP_001095556.1.49012 WP_001095556.1.49084 WP_001095556.1.49113 WP_001095556.1.49155 WP_001095556.1.49204 WP_001095556.1.49239 WP_001095556.1.49256 WP_001095556.1.49290 WP_001095556.1.49340 WP_001095556.1.49366 WP_001095556.1.49490 WP_001095556.1.49515 WP_001095556.1.49572 WP_001095556.1.49686 WP_001095556.1.4979 WP_001095556.1.49803 WP_001095556.1.49805 WP_001095556.1.49929 WP_001095556.1.50080 WP_001095556.1.50161 WP_001095556.1.50211 WP_001095556.1.50251 WP_001095556.1.50376 WP_001095556.1.50389 WP_001095556.1.50404 WP_001095556.1.50497 WP_001095556.1.50676 WP_001095556.1.50777 WP_001095556.1.50804 WP_001095556.1.50808 WP_001095556.1.5088 WP_001095556.1.50908 WP_001095556.1.50941 WP_001095556.1.50999 WP_001095556.1.51014 WP_001095556.1.51022 WP_001095556.1.51066 WP_001095556.1.51179 WP_001095556.1.51182 WP_001095556.1.51186 WP_001095556.1.51224 WP_001095556.1.51487 WP_001095556.1.51488 WP_001095556.1.51613 WP_001095556.1.51634 WP_001095556.1.51649 WP_001095556.1.51686 WP_001095556.1.51756 WP_001095556.1.51831 WP_001095556.1.51911 WP_001095556.1.51932 WP_001095556.1.51989 WP_001095556.1.52121 WP_001095556.1.52161 WP_001095556.1.52170 WP_001095556.1.52336 WP_001095556.1.52346 WP_001095556.1.52353 WP_001095556.1.52361 WP_001095556.1.52653 WP_001095556.1.52656 WP_001095556.1.52692 WP_001095556.1.52743 WP_001095556.1.52744 WP_001095556.1.52857 WP_001095556.1.52866 WP_001095556.1.52898 WP_001095556.1.52915 WP_001095556.1.52949 WP_001095556.1.52985 WP_001095556.1.53190 WP_001095556.1.53272 WP_001095556.1.53406 WP_001095556.1.53466 WP_001095556.1.53529 WP_001095556.1.53543 WP_001095556.1.53757 WP_001095556.1.53812 WP_001095556.1.53905 WP_001095556.1.54033 WP_001095556.1.54075 WP_001095556.1.54196 WP_001095556.1.54209 WP_001095556.1.54271 WP_001095556.1.54274 WP_001095556.1.54319 WP_001095556.1.54364 WP_001095556.1.54400 WP_001095556.1.54522 WP_001095556.1.54526 WP_001095556.1.5456 WP_001095556.1.54644 WP_001095556.1.54662 WP_001095556.1.54694 WP_001095556.1.54722 WP_001095556.1.54749 WP_001095556.1.54764 WP_001095556.1.54814 WP_001095556.1.54845 WP_001095556.1.54992 WP_001095556.1.55008 WP_001095556.1.55073 WP_001095556.1.55152 WP_001095556.1.55156 WP_001095556.1.5527 WP_001095556.1.55285 WP_001095556.1.55325 WP_001095556.1.55430 WP_001095556.1.55475 WP_001095556.1.55557 WP_001095556.1.5560 WP_001095556.1.55647 WP_001095556.1.55743 WP_001095556.1.55768 WP_001095556.1.55782 WP_001095556.1.55973 WP_001095556.1.56002 WP_001095556.1.56012 WP_001095556.1.56026 WP_001095556.1.56105 WP_001095556.1.56238 WP_001095556.1.56244 WP_001095556.1.56286 WP_001095556.1.56304 WP_001095556.1.56414 WP_001095556.1.56438 WP_001095556.1.56559 WP_001095556.1.56560 WP_001095556.1.56601 WP_001095556.1.56614 WP_001095556.1.56647 WP_001095556.1.56651 WP_001095556.1.56660 WP_001095556.1.56671 WP_001095556.1.56682 WP_001095556.1.56875 WP_001095556.1.56877 WP_001095556.1.57000 WP_001095556.1.57168 WP_001095556.1.57187 WP_001095556.1.57233 WP_001095556.1.57356 WP_001095556.1.57377 WP_001095556.1.57418 WP_001095556.1.57433 WP_001095556.1.57515 WP_001095556.1.57529 WP_001095556.1.57576 WP_001095556.1.57601 WP_001095556.1.57607 WP_001095556.1.5774 WP_001095556.1.57763 WP_001095556.1.57862 WP_001095556.1.57890 WP_001095556.1.57891 WP_001095556.1.57902 WP_001095556.1.57978 WP_001095556.1.5801 WP_001095556.1.58041 WP_001095556.1.58358 WP_001095556.1.58407 WP_001095556.1.58418 WP_001095556.1.58451 WP_001095556.1.58548 WP_001095556.1.5858 WP_001095556.1.58662 WP_001095556.1.58669 WP_001095556.1.58745 WP_001095556.1.58803 WP_001095556.1.5886 WP_001095556.1.59094 WP_001095556.1.59136 WP_001095556.1.59224 WP_001095556.1.59375 WP_001095556.1.59420 WP_001095556.1.59458 WP_001095556.1.59490 WP_001095556.1.59508 WP_001095556.1.59684 WP_001095556.1.59694 WP_001095556.1.59771 WP_001095556.1.5979 WP_001095556.1.59953 WP_001095556.1.60008 WP_001095556.1.60021 WP_001095556.1.60069 WP_001095556.1.60140 WP_001095556.1.60155 WP_001095556.1.60209 WP_001095556.1.60285 WP_001095556.1.60379 WP_001095556.1.60464 WP_001095556.1.60486 WP_001095556.1.60545 WP_001095556.1.60561 WP_001095556.1.60772 WP_001095556.1.60874 WP_001095556.1.60941 WP_001095556.1.61078 WP_001095556.1.6114 WP_001095556.1.61232 WP_001095556.1.6129 WP_001095556.1.61296 WP_001095556.1.61345 WP_001095556.1.61417 WP_001095556.1.61574 WP_001095556.1.61662 WP_001095556.1.61712 WP_001095556.1.61714 WP_001095556.1.61730 WP_001095556.1.61857 WP_001095556.1.61918 WP_001095556.1.61952 WP_001095556.1.62007 WP_001095556.1.62020 WP_001095556.1.62025 WP_001095556.1.6209 WP_001095556.1.62204 WP_001095556.1.62257 WP_001095556.1.62271 WP_001095556.1.62304 WP_001095556.1.62339 WP_001095556.1.62364 WP_001095556.1.62374 WP_001095556.1.62403 WP_001095556.1.6253 WP_001095556.1.62853 WP_001095556.1.62903 WP_001095556.1.62910 WP_001095556.1.62955 WP_001095556.1.63129 WP_001095556.1.63150 WP_001095556.1.63181 WP_001095556.1.63186 WP_001095556.1.63203 WP_001095556.1.63243 WP_001095556.1.63256 WP_001095556.1.63290 WP_001095556.1.63382 WP_001095556.1.63461 WP_001095556.1.63479 WP_001095556.1.63577 WP_001095556.1.63664 WP_001095556.1.63718 WP_001095556.1.6375 WP_001095556.1.63757 WP_001095556.1.63797 WP_001095556.1.63834 WP_001095556.1.6399 WP_001095556.1.64018 WP_001095556.1.64046 WP_001095556.1.64208 WP_001095556.1.6423 WP_001095556.1.64244 WP_001095556.1.64387 WP_001095556.1.64403 WP_001095556.1.64645 WP_001095556.1.64649 WP_001095556.1.64690 WP_001095556.1.64702 WP_001095556.1.64757 WP_001095556.1.64781 WP_001095556.1.64831 WP_001095556.1.6489 WP_001095556.1.64894 WP_001095556.1.65018 WP_001095556.1.65028 WP_001095556.1.65052 WP_001095556.1.65168 WP_001095556.1.65171 WP_001095556.1.65238 WP_001095556.1.65248 WP_001095556.1.65269 WP_001095556.1.6535 WP_001095556.1.65474 WP_001095556.1.65633 WP_001095556.1.6565 WP_001095556.1.65696 WP_001095556.1.6575 WP_001095556.1.65782 WP_001095556.1.65940 WP_001095556.1.65956 WP_001095556.1.66049 WP_001095556.1.66129 WP_001095556.1.6630 WP_001095556.1.66314 WP_001095556.1.66330 WP_001095556.1.66358 WP_001095556.1.66362 WP_001095556.1.66365 WP_001095556.1.6638 WP_001095556.1.6640 WP_001095556.1.66678 WP_001095556.1.66698 WP_001095556.1.6680 WP_001095556.1.66834 WP_001095556.1.66901 WP_001095556.1.66962 WP_001095556.1.67 WP_001095556.1.67037 WP_001095556.1.67045 WP_001095556.1.67100 WP_001095556.1.67181 WP_001095556.1.67235 WP_001095556.1.67268 WP_001095556.1.67347 WP_001095556.1.6739 WP_001095556.1.67465 WP_001095556.1.67552 WP_001095556.1.67682 WP_001095556.1.67803 WP_001095556.1.67827 WP_001095556.1.67829 WP_001095556.1.67887 WP_001095556.1.68073 WP_001095556.1.6809 WP_001095556.1.68201 WP_001095556.1.68206 WP_001095556.1.6827 WP_001095556.1.68275 WP_001095556.1.68401 WP_001095556.1.68477 WP_001095556.1.6849 WP_001095556.1.68547 WP_001095556.1.68589 WP_001095556.1.68655 WP_001095556.1.68656 WP_001095556.1.68778 WP_001095556.1.68787 WP_001095556.1.68894 WP_001095556.1.68928 WP_001095556.1.68975 WP_001095556.1.69001 WP_001095556.1.69006 WP_001095556.1.6904 WP_001095556.1.6913 WP_001095556.1.69146 WP_001095556.1.69151 WP_001095556.1.69255 WP_001095556.1.69359 WP_001095556.1.69397 WP_001095556.1.6954 WP_001095556.1.69564 WP_001095556.1.69644 WP_001095556.1.69704 WP_001095556.1.69758 WP_001095556.1.69807 WP_001095556.1.69808 WP_001095556.1.69848 WP_001095556.1.69975 WP_001095556.1.7021 WP_001095556.1.70241 WP_001095556.1.70269 WP_001095556.1.70289 WP_001095556.1.70447 WP_001095556.1.70485 WP_001095556.1.70643 WP_001095556.1.70683 WP_001095556.1.70883 WP_001095556.1.70922 WP_001095556.1.70948 WP_001095556.1.70959 WP_001095556.1.71023 WP_001095556.1.71116 WP_001095556.1.71146 WP_001095556.1.71165 WP_001095556.1.71188 WP_001095556.1.71202 WP_001095556.1.71243 WP_001095556.1.71306 WP_001095556.1.71337 WP_001095556.1.71363 WP_001095556.1.71378 WP_001095556.1.71401 WP_001095556.1.71418 WP_001095556.1.71636 WP_001095556.1.71702 WP_001095556.1.71750 WP_001095556.1.71798 WP_001095556.1.71845 WP_001095556.1.71881 WP_001095556.1.71908 WP_001095556.1.71929 WP_001095556.1.71952 WP_001095556.1.71973 WP_001095556.1.72105 WP_001095556.1.72203 WP_001095556.1.72376 WP_001095556.1.72403 WP_001095556.1.72594 WP_001095556.1.72642 WP_001095556.1.72728 WP_001095556.1.72871 WP_001095556.1.72975 WP_001095556.1.73125 WP_001095556.1.7315 WP_001095556.1.73200 WP_001095556.1.7334 WP_001095556.1.73377 WP_001095556.1.73461 WP_001095556.1.73481 WP_001095556.1.7356 WP_001095556.1.73581 WP_001095556.1.73617 WP_001095556.1.73753 WP_001095556.1.73758 WP_001095556.1.73847 WP_001095556.1.7387 WP_001095556.1.73924 WP_001095556.1.74029 WP_001095556.1.74181 WP_001095556.1.74191 WP_001095556.1.7433 WP_001095556.1.74379 WP_001095556.1.74410 WP_001095556.1.74422 WP_001095556.1.74466 WP_001095556.1.745 WP_001095556.1.74529 WP_001095556.1.74545 WP_001095556.1.74661 WP_001095556.1.74745 WP_001095556.1.74826 WP_001095556.1.7491 WP_001095556.1.75009 WP_001095556.1.75058 WP_001095556.1.75129 WP_001095556.1.75187 WP_001095556.1.75288 WP_001095556.1.75334 WP_001095556.1.75362 WP_001095556.1.75385 WP_001095556.1.75392 WP_001095556.1.75609 WP_001095556.1.75760 WP_001095556.1.75764 WP_001095556.1.75837 WP_001095556.1.75874 WP_001095556.1.75945 WP_001095556.1.75957 WP_001095556.1.76020 WP_001095556.1.76162 WP_001095556.1.76252 WP_001095556.1.76327 WP_001095556.1.76445 WP_001095556.1.76548 WP_001095556.1.76576 WP_001095556.1.7660 WP_001095556.1.76673 WP_001095556.1.76706 WP_001095556.1.76721 WP_001095556.1.76724 WP_001095556.1.76756 WP_001095556.1.76760 WP_001095556.1.76875 WP_001095556.1.76880 WP_001095556.1.76899 WP_001095556.1.77038 WP_001095556.1.77047 WP_001095556.1.77080 WP_001095556.1.7712 WP_001095556.1.77177 WP_001095556.1.77180 WP_001095556.1.77193 WP_001095556.1.77244 WP_001095556.1.77267 WP_001095556.1.77292 WP_001095556.1.77349 WP_001095556.1.77390 WP_001095556.1.77514 WP_001095556.1.77529 WP_001095556.1.77549 WP_001095556.1.77692 WP_001095556.1.77710 WP_001095556.1.7782 WP_001095556.1.77851 WP_001095556.1.77898 WP_001095556.1.77918 WP_001095556.1.77960 WP_001095556.1.78033 WP_001095556.1.78053 WP_001095556.1.78076 WP_001095556.1.78096 WP_001095556.1.78100 WP_001095556.1.78110 WP_001095556.1.78120 WP_001095556.1.78301 WP_001095556.1.78372 WP_001095556.1.78383 WP_001095556.1.78407 WP_001095556.1.7861 WP_001095556.1.78618 WP_001095556.1.78673 WP_001095556.1.78735 WP_001095556.1.78738 WP_001095556.1.78802 WP_001095556.1.78830 WP_001095556.1.78835 WP_001095556.1.78838 WP_001095556.1.78862 WP_001095556.1.78871 WP_001095556.1.78874 WP_001095556.1.7891 WP_001095556.1.78918 WP_001095556.1.78930 WP_001095556.1.79151 WP_001095556.1.79167 WP_001095556.1.79203 WP_001095556.1.79335 WP_001095556.1.79462 WP_001095556.1.79472 WP_001095556.1.79490 WP_001095556.1.79495 WP_001095556.1.79529 WP_001095556.1.79570 WP_001095556.1.7964 WP_001095556.1.79659 WP_001095556.1.79668 WP_001095556.1.79708 WP_001095556.1.79734 WP_001095556.1.79832 WP_001095556.1.79845 WP_001095556.1.80077 WP_001095556.1.80137 WP_001095556.1.80182 WP_001095556.1.80236 WP_001095556.1.80296 WP_001095556.1.80366 WP_001095556.1.80448 WP_001095556.1.80651 WP_001095556.1.80741 WP_001095556.1.80780 WP_001095556.1.80831 WP_001095556.1.80850 WP_001095556.1.80881 WP_001095556.1.80939 WP_001095556.1.8096 WP_001095556.1.81037 WP_001095556.1.81069 WP_001095556.1.81149 WP_001095556.1.81175 WP_001095556.1.8119 WP_001095556.1.81193 WP_001095556.1.81305 WP_001095556.1.81320 WP_001095556.1.81328 WP_001095556.1.81354 WP_001095556.1.81425 WP_001095556.1.81504 WP_001095556.1.81528 WP_001095556.1.81735 WP_001095556.1.81750 WP_001095556.1.81760 WP_001095556.1.81785 WP_001095556.1.81902 WP_001095556.1.81974 WP_001095556.1.81995 WP_001095556.1.82099 WP_001095556.1.82192 WP_001095556.1.82232 WP_001095556.1.82269 WP_001095556.1.82337 WP_001095556.1.82464 WP_001095556.1.82479 WP_001095556.1.82503 WP_001095556.1.82515 WP_001095556.1.82676 WP_001095556.1.82761 WP_001095556.1.8282 WP_001095556.1.82944 WP_001095556.1.82946 WP_001095556.1.82956 WP_001095556.1.83092 WP_001095556.1.83163 WP_001095556.1.83305 WP_001095556.1.83378 WP_001095556.1.83382 WP_001095556.1.83413 WP_001095556.1.83491 WP_001095556.1.83523 WP_001095556.1.8354 WP_001095556.1.83721 WP_001095556.1.83760 WP_001095556.1.83995 WP_001095556.1.84077 WP_001095556.1.84103 WP_001095556.1.84168 WP_001095556.1.84283 WP_001095556.1.84291 WP_001095556.1.84392 WP_001095556.1.84397 WP_001095556.1.8441 WP_001095556.1.84461 WP_001095556.1.84532 WP_001095556.1.84554 WP_001095556.1.84659 WP_001095556.1.84899 WP_001095556.1.849 WP_001095556.1.8497 WP_001095556.1.85040 WP_001095556.1.85134 WP_001095556.1.85178 WP_001095556.1.85180 WP_001095556.1.85190 WP_001095556.1.8533 WP_001095556.1.8545 WP_001095556.1.85481 WP_001095556.1.85483 WP_001095556.1.85541 WP_001095556.1.8556 WP_001095556.1.85568 WP_001095556.1.85615 WP_001095556.1.85617 WP_001095556.1.85663 WP_001095556.1.85671 WP_001095556.1.85672 WP_001095556.1.85675 WP_001095556.1.85777 WP_001095556.1.85886 WP_001095556.1.85900 WP_001095556.1.85904 WP_001095556.1.85976 WP_001095556.1.86007 WP_001095556.1.86173 WP_001095556.1.86285 WP_001095556.1.86306 WP_001095556.1.86356 WP_001095556.1.86450 WP_001095556.1.86469 WP_001095556.1.86580 WP_001095556.1.86588 WP_001095556.1.86661 WP_001095556.1.8671 WP_001095556.1.8672 WP_001095556.1.8678 WP_001095556.1.86810 WP_001095556.1.8684 WP_001095556.1.86895 WP_001095556.1.86906 WP_001095556.1.87051 WP_001095556.1.87095 WP_001095556.1.87323 WP_001095556.1.8736 WP_001095556.1.87460 WP_001095556.1.87552 WP_001095556.1.87695 WP_001095556.1.87779 WP_001095556.1.87899 WP_001095556.1.8792 WP_001095556.1.87945 WP_001095556.1.88019 WP_001095556.1.88073 WP_001095556.1.8809 WP_001095556.1.88092 WP_001095556.1.88174 WP_001095556.1.88222 WP_001095556.1.88291 WP_001095556.1.88293 WP_001095556.1.8837 WP_001095556.1.88393 WP_001095556.1.88423 WP_001095556.1.88703 WP_001095556.1.88792 WP_001095556.1.88902 WP_001095556.1.8891 WP_001095556.1.88957 WP_001095556.1.88967 WP_001095556.1.88980 WP_001095556.1.88981 WP_001095556.1.88995 WP_001095556.1.89008 WP_001095556.1.89054 WP_001095556.1.89114 WP_001095556.1.89116 WP_001095556.1.89119 WP_001095556.1.89138 WP_001095556.1.89188 WP_001095556.1.89215 WP_001095556.1.89304 WP_001095556.1.89512 WP_001095556.1.89527 WP_001095556.1.89570 WP_001095556.1.8958 WP_001095556.1.89604 WP_001095556.1.89622 WP_001095556.1.89657 WP_001095556.1.89659 WP_001095556.1.89765 WP_001095556.1.89817 WP_001095556.1.89902 WP_001095556.1.8996 WP_001095556.1.90033 WP_001095556.1.90097 WP_001095556.1.90252 WP_001095556.1.90311 WP_001095556.1.90417 WP_001095556.1.90440 WP_001095556.1.90453 WP_001095556.1.90458 WP_001095556.1.90557 WP_001095556.1.90585 WP_001095556.1.9064 WP_001095556.1.90641 WP_001095556.1.90734 WP_001095556.1.91003 WP_001095556.1.91056 WP_001095556.1.91069 WP_001095556.1.91179 WP_001095556.1.91278 WP_001095556.1.91459 WP_001095556.1.91512 WP_001095556.1.91564 WP_001095556.1.91621 WP_001095556.1.91625 WP_001095556.1.91628 WP_001095556.1.91655 WP_001095556.1.91724 WP_001095556.1.91732 WP_001095556.1.91788 WP_001095556.1.92013 WP_001095556.1.92093 WP_001095556.1.92108 WP_001095556.1.92165 WP_001095556.1.92183 WP_001095556.1.92208 WP_001095556.1.92213 WP_001095556.1.92268 WP_001095556.1.92310 WP_001095556.1.92411 WP_001095556.1.92443 WP_001095556.1.92482 WP_001095556.1.92531 WP_001095556.1.92562 WP_001095556.1.92575 WP_001095556.1.92669 WP_001095556.1.92671 WP_001095556.1.92738 WP_001095556.1.92879 WP_001095556.1.92893 WP_001095556.1.92895 WP_001095556.1.92926 WP_001095556.1.93059 WP_001095556.1.93086 WP_001095556.1.93101 WP_001095556.1.93136 WP_001095556.1.93155 WP_001095556.1.93339 WP_001095556.1.93365 WP_001095556.1.93543 WP_001095556.1.93650 WP_001095556.1.93656 WP_001095556.1.93662 WP_001095556.1.937 WP_001095556.1.93705 WP_001095556.1.93741 WP_001095556.1.93804 WP_001095556.1.9389 WP_001095556.1.93937 WP_001095556.1.93994 WP_001095556.1.94072 WP_001095556.1.94162 WP_001095556.1.94168 WP_001095556.1.94198 WP_001095556.1.9432 WP_001095556.1.94354 WP_001095556.1.94380 WP_001095556.1.94458 WP_001095556.1.94565 WP_001095556.1.94584 WP_001095556.1.94655 WP_001095556.1.94674 WP_001095556.1.94796 WP_001095556.1.94959 WP_001095556.1.95051 WP_001095556.1.95085 WP_001095556.1.95121 WP_001095556.1.95152 WP_001095556.1.95248 WP_001095556.1.95249 WP_001095556.1.95277 WP_001095556.1.95282 WP_001095556.1.95388 WP_001095556.1.95404 WP_001095556.1.95546 WP_001095556.1.95630 WP_001095556.1.95670 WP_001095556.1.95691 WP_001095556.1.95701 WP_001095556.1.95826 WP_001095556.1.95911 WP_001095556.1.95939 WP_001095556.1.96004 WP_001095556.1.96139 WP_001095556.1.96162 WP_001095556.1.96317 WP_001095556.1.96343 WP_001095556.1.96429 WP_001095556.1.9644 WP_001095556.1.96469 WP_001095556.1.96500 WP_001095556.1.96555 WP_001095556.1.96563 WP_001095556.1.96732 WP_001095556.1.9674 WP_001095556.1.96771 WP_001095556.1.96890 WP_001095556.1.97015 WP_001095556.1.97047 WP_001095556.1.97089 WP_001095556.1.97143 WP_001095556.1.97145 WP_001095556.1.97190 WP_001095556.1.97297 WP_001095556.1.97318 WP_001095556.1.97369 WP_001095556.1.97386 WP_001095556.1.97413 WP_001095556.1.97477 WP_001095556.1.97487 WP_001095556.1.97594 WP_001095556.1.97597 WP_001095556.1.97613 WP_001095556.1.97620 WP_001095556.1.97631 WP_001095556.1.97727 WP_001095556.1.97732 WP_001095556.1.97736 WP_001095556.1.9775 WP_001095556.1.97846 WP_001095556.1.9799 WP_001095556.1.98006 WP_001095556.1.98019 WP_001095556.1.98022 WP_001095556.1.98107 WP_001095556.1.98110 WP_001095556.1.98146 WP_001095556.1.98170 WP_001095556.1.98219 WP_001095556.1.9826 WP_001095556.1.9841 WP_001095556.1.98495 WP_001095556.1.98531 WP_001095556.1.98577 WP_001095556.1.98676 WP_001095556.1.98677 WP_001095556.1.98760 WP_001095556.1.98843 WP_001095556.1.9898 WP_001095556.1.99098 WP_001095556.1.99184 WP_001095556.1.99197 WP_001095556.1.99267 WP_001095556.1.99276 WP_001095556.1.99339 WP_001095556.1.99426 WP_001095556.1.99626 WP_001095556.1.99646 WP_001095556.1.99657 WP_001095556.1.99660 WP_001095556.1.99712 WP_001095556.1.99813 WP_001095556.1.99858 WP_001095556.1.99889 WP_001095556.1.99958 gi|62181294|ref|YP_217711.1| gi|378451523|ref|YP_005238883.1| gi|550902162|ref|YP_008671254.1| gi|525818585|ref|YP_008248603.1| gi|525837278|ref|YP_008254027.1| gi|383497472|ref|YP_005398161.1| gi|409246461|ref|YP_006887166.1| gi|482905357|ref|YP_007903917.1| gi|378446154|ref|YP_005233786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]