SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482905548|ref|YP_007904108.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482905548|ref|YP_007904108.1|
Domain Number 1 Region: 5-397
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.35e-108
Family Cystathionine synthase-like 0.000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|482905548|ref|YP_007904108.1|
Sequence length 401
Comment cysteine sulfinate desulfinase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MNAFNPTQFRAQFPALADAGVYLDSAATALKPQAVIDATHQFYCLSAGNVHRSQFAQAQR
LTAQYEAARAKAARLLNAPDEKSIVWTRGTTEAINMVAQCYARPRLRPGDEIIVSVAEHH
ANLVPWLMVAQQTGAQVIKLPLNDRRLPDVERLPELITSRSRILALGQMSNVTGGCPDLA
SAISAAHAAGMVVMVDGAQGAVHFPADVQQLDIDFYAFSAHKLYGPTGIGVLYGKPELLE
AMSPWLGGGKMIRDVSFEGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLSDIDIEQAENW
SRGLATLAEDALAKRPGFRSFRCQDSSLLAFDFVGVHHGDMVTLLAEYGIALRAGQHCAQ
PLLAELGVTGTLRASFAPYNTQHDVDALVNAVDRALELLVD
Download sequence
Identical sequences A0A0D6IG21 A0A0F6B662 A0A0F7DJE2 A0A0H3NHB4 A0A0M0QKA9 A0A0U1F275 A0A1X2RM14 A0A1X2V208 A0A1X2Y798 A0A265B2N1 A0A267SLD1 A0A271CWY6 A0A2C6FP42 A0A2D1XAP3 A0A2D3AFW8 A0A2H9YFC8 A0A2I6P0F0 B5F4T1 E8X8R9 Q8ZMC3 S5HZ32 V7IIS2
NP_461903.1.58477 WP_000991053.1.100010 WP_000991053.1.100129 WP_000991053.1.10013 WP_000991053.1.100165 WP_000991053.1.1002 WP_000991053.1.100234 WP_000991053.1.100376 WP_000991053.1.100413 WP_000991053.1.100424 WP_000991053.1.100436 WP_000991053.1.100438 WP_000991053.1.100484 WP_000991053.1.100488 WP_000991053.1.100597 WP_000991053.1.10065 WP_000991053.1.100721 WP_000991053.1.100730 WP_000991053.1.10076 WP_000991053.1.100773 WP_000991053.1.100781 WP_000991053.1.100790 WP_000991053.1.100793 WP_000991053.1.100869 WP_000991053.1.100870 WP_000991053.1.100871 WP_000991053.1.100882 WP_000991053.1.100932 WP_000991053.1.100948 WP_000991053.1.101007 WP_000991053.1.101020 WP_000991053.1.101074 WP_000991053.1.101078 WP_000991053.1.101094 WP_000991053.1.101123 WP_000991053.1.101126 WP_000991053.1.101180 WP_000991053.1.101223 WP_000991053.1.101259 WP_000991053.1.101284 WP_000991053.1.101291 WP_000991053.1.1013 WP_000991053.1.101353 WP_000991053.1.101386 WP_000991053.1.101404 WP_000991053.1.101420 WP_000991053.1.101454 WP_000991053.1.101473 WP_000991053.1.101589 WP_000991053.1.101609 WP_000991053.1.101636 WP_000991053.1.101639 WP_000991053.1.101707 WP_000991053.1.101724 WP_000991053.1.101734 WP_000991053.1.101741 WP_000991053.1.101815 WP_000991053.1.101878 WP_000991053.1.101953 WP_000991053.1.101975 WP_000991053.1.10220 WP_000991053.1.10231 WP_000991053.1.10237 WP_000991053.1.10266 WP_000991053.1.10429 WP_000991053.1.10439 WP_000991053.1.10463 WP_000991053.1.10465 WP_000991053.1.10507 WP_000991053.1.10566 WP_000991053.1.10678 WP_000991053.1.10711 WP_000991053.1.10753 WP_000991053.1.10797 WP_000991053.1.10992 WP_000991053.1.11024 WP_000991053.1.11031 WP_000991053.1.11098 WP_000991053.1.1110 WP_000991053.1.11156 WP_000991053.1.11168 WP_000991053.1.11190 WP_000991053.1.11213 WP_000991053.1.11254 WP_000991053.1.11295 WP_000991053.1.1135 WP_000991053.1.11369 WP_000991053.1.1137 WP_000991053.1.11405 WP_000991053.1.11455 WP_000991053.1.11458 WP_000991053.1.11518 WP_000991053.1.11532 WP_000991053.1.11543 WP_000991053.1.11544 WP_000991053.1.11588 WP_000991053.1.11621 WP_000991053.1.11677 WP_000991053.1.11687 WP_000991053.1.11735 WP_000991053.1.11763 WP_000991053.1.11772 WP_000991053.1.11834 WP_000991053.1.11865 WP_000991053.1.11875 WP_000991053.1.11897 WP_000991053.1.11936 WP_000991053.1.11964 WP_000991053.1.12017 WP_000991053.1.12059 WP_000991053.1.12063 WP_000991053.1.12114 WP_000991053.1.12160 WP_000991053.1.12351 WP_000991053.1.12370 WP_000991053.1.12396 WP_000991053.1.12397 WP_000991053.1.12484 WP_000991053.1.1250 WP_000991053.1.12546 WP_000991053.1.1264 WP_000991053.1.12650 WP_000991053.1.12701 WP_000991053.1.12728 WP_000991053.1.12879 WP_000991053.1.12936 WP_000991053.1.12995 WP_000991053.1.13027 WP_000991053.1.13101 WP_000991053.1.13106 WP_000991053.1.13130 WP_000991053.1.13207 WP_000991053.1.13311 WP_000991053.1.13414 WP_000991053.1.13488 WP_000991053.1.13509 WP_000991053.1.13661 WP_000991053.1.13669 WP_000991053.1.13741 WP_000991053.1.13750 WP_000991053.1.13819 WP_000991053.1.13829 WP_000991053.1.1387 WP_000991053.1.13908 WP_000991053.1.13932 WP_000991053.1.13968 WP_000991053.1.14001 WP_000991053.1.14050 WP_000991053.1.14056 WP_000991053.1.14111 WP_000991053.1.14151 WP_000991053.1.14239 WP_000991053.1.14320 WP_000991053.1.14379 WP_000991053.1.14406 WP_000991053.1.14410 WP_000991053.1.14436 WP_000991053.1.14458 WP_000991053.1.14466 WP_000991053.1.14505 WP_000991053.1.14524 WP_000991053.1.14528 WP_000991053.1.14554 WP_000991053.1.14618 WP_000991053.1.14706 WP_000991053.1.14725 WP_000991053.1.14737 WP_000991053.1.14789 WP_000991053.1.14852 WP_000991053.1.14876 WP_000991053.1.1489 WP_000991053.1.14932 WP_000991053.1.15046 WP_000991053.1.15055 WP_000991053.1.15059 WP_000991053.1.15100 WP_000991053.1.15102 WP_000991053.1.15124 WP_000991053.1.15223 WP_000991053.1.15226 WP_000991053.1.15316 WP_000991053.1.15369 WP_000991053.1.1540 WP_000991053.1.15479 WP_000991053.1.15508 WP_000991053.1.15586 WP_000991053.1.15627 WP_000991053.1.15644 WP_000991053.1.15784 WP_000991053.1.15795 WP_000991053.1.158 WP_000991053.1.15830 WP_000991053.1.15862 WP_000991053.1.15881 WP_000991053.1.15910 WP_000991053.1.1592 WP_000991053.1.15978 WP_000991053.1.15986 WP_000991053.1.16004 WP_000991053.1.1601 WP_000991053.1.16047 WP_000991053.1.16052 WP_000991053.1.16062 WP_000991053.1.16063 WP_000991053.1.16103 WP_000991053.1.16158 WP_000991053.1.16166 WP_000991053.1.16172 WP_000991053.1.16226 WP_000991053.1.16233 WP_000991053.1.16284 WP_000991053.1.16328 WP_000991053.1.1635 WP_000991053.1.16361 WP_000991053.1.16468 WP_000991053.1.16508 WP_000991053.1.16525 WP_000991053.1.16551 WP_000991053.1.16565 WP_000991053.1.16581 WP_000991053.1.16614 WP_000991053.1.16650 WP_000991053.1.16656 WP_000991053.1.1668 WP_000991053.1.16686 WP_000991053.1.16691 WP_000991053.1.16732 WP_000991053.1.16735 WP_000991053.1.16786 WP_000991053.1.16826 WP_000991053.1.16855 WP_000991053.1.16858 WP_000991053.1.16873 WP_000991053.1.16896 WP_000991053.1.16903 WP_000991053.1.16910 WP_000991053.1.16916 WP_000991053.1.16965 WP_000991053.1.1700 WP_000991053.1.17093 WP_000991053.1.17098 WP_000991053.1.17307 WP_000991053.1.17390 WP_000991053.1.174 WP_000991053.1.17439 WP_000991053.1.17480 WP_000991053.1.17546 WP_000991053.1.17560 WP_000991053.1.1757 WP_000991053.1.17693 WP_000991053.1.17702 WP_000991053.1.17703 WP_000991053.1.17705 WP_000991053.1.17743 WP_000991053.1.17891 WP_000991053.1.17901 WP_000991053.1.17949 WP_000991053.1.1798 WP_000991053.1.18019 WP_000991053.1.1807 WP_000991053.1.18111 WP_000991053.1.18122 WP_000991053.1.18163 WP_000991053.1.1818 WP_000991053.1.18192 WP_000991053.1.18249 WP_000991053.1.1825 WP_000991053.1.18254 WP_000991053.1.18265 WP_000991053.1.18267 WP_000991053.1.18426 WP_000991053.1.18445 WP_000991053.1.18468 WP_000991053.1.18485 WP_000991053.1.18489 WP_000991053.1.18607 WP_000991053.1.18705 WP_000991053.1.18715 WP_000991053.1.18776 WP_000991053.1.18822 WP_000991053.1.18881 WP_000991053.1.18919 WP_000991053.1.18940 WP_000991053.1.18949 WP_000991053.1.18972 WP_000991053.1.19030 WP_000991053.1.19053 WP_000991053.1.19055 WP_000991053.1.19273 WP_000991053.1.19320 WP_000991053.1.19357 WP_000991053.1.19458 WP_000991053.1.19460 WP_000991053.1.19461 WP_000991053.1.19469 WP_000991053.1.19588 WP_000991053.1.19614 WP_000991053.1.19616 WP_000991053.1.1968 WP_000991053.1.19702 WP_000991053.1.19706 WP_000991053.1.19723 WP_000991053.1.19724 WP_000991053.1.19740 WP_000991053.1.19749 WP_000991053.1.19784 WP_000991053.1.19793 WP_000991053.1.19802 WP_000991053.1.19809 WP_000991053.1.19823 WP_000991053.1.19867 WP_000991053.1.1990 WP_000991053.1.19975 WP_000991053.1.1998 WP_000991053.1.20 WP_000991053.1.20034 WP_000991053.1.20081 WP_000991053.1.2010 WP_000991053.1.20212 WP_000991053.1.20266 WP_000991053.1.20271 WP_000991053.1.20362 WP_000991053.1.20415 WP_000991053.1.20418 WP_000991053.1.20443 WP_000991053.1.20446 WP_000991053.1.20488 WP_000991053.1.20503 WP_000991053.1.20525 WP_000991053.1.2054 WP_000991053.1.20553 WP_000991053.1.20573 WP_000991053.1.20614 WP_000991053.1.20626 WP_000991053.1.20631 WP_000991053.1.20646 WP_000991053.1.20795 WP_000991053.1.20839 WP_000991053.1.20862 WP_000991053.1.20886 WP_000991053.1.20900 WP_000991053.1.20908 WP_000991053.1.2101 WP_000991053.1.21049 WP_000991053.1.21086 WP_000991053.1.21089 WP_000991053.1.21136 WP_000991053.1.21165 WP_000991053.1.21245 WP_000991053.1.21246 WP_000991053.1.21269 WP_000991053.1.21309 WP_000991053.1.21326 WP_000991053.1.21351 WP_000991053.1.21400 WP_000991053.1.2146 WP_000991053.1.21497 WP_000991053.1.21499 WP_000991053.1.21603 WP_000991053.1.21692 WP_000991053.1.21728 WP_000991053.1.21750 WP_000991053.1.21751 WP_000991053.1.21757 WP_000991053.1.21825 WP_000991053.1.21886 WP_000991053.1.21981 WP_000991053.1.21991 WP_000991053.1.22024 WP_000991053.1.2205 WP_000991053.1.22062 WP_000991053.1.22067 WP_000991053.1.22169 WP_000991053.1.2221 WP_000991053.1.22235 WP_000991053.1.2224 WP_000991053.1.22315 WP_000991053.1.2235 WP_000991053.1.22379 WP_000991053.1.22427 WP_000991053.1.22453 WP_000991053.1.2246 WP_000991053.1.22485 WP_000991053.1.22604 WP_000991053.1.22620 WP_000991053.1.22623 WP_000991053.1.22676 WP_000991053.1.22692 WP_000991053.1.22758 WP_000991053.1.22845 WP_000991053.1.22864 WP_000991053.1.22870 WP_000991053.1.22979 WP_000991053.1.23010 WP_000991053.1.23080 WP_000991053.1.23114 WP_000991053.1.2314 WP_000991053.1.23172 WP_000991053.1.23192 WP_000991053.1.23246 WP_000991053.1.23258 WP_000991053.1.23259 WP_000991053.1.23379 WP_000991053.1.2342 WP_000991053.1.23460 WP_000991053.1.23466 WP_000991053.1.23472 WP_000991053.1.23482 WP_000991053.1.23485 WP_000991053.1.23509 WP_000991053.1.23513 WP_000991053.1.23529 WP_000991053.1.23587 WP_000991053.1.23621 WP_000991053.1.23629 WP_000991053.1.23634 WP_000991053.1.2364 WP_000991053.1.23646 WP_000991053.1.23675 WP_000991053.1.23755 WP_000991053.1.2376 WP_000991053.1.23932 WP_000991053.1.23959 WP_000991053.1.24017 WP_000991053.1.24082 WP_000991053.1.24158 WP_000991053.1.24206 WP_000991053.1.24303 WP_000991053.1.24308 WP_000991053.1.24325 WP_000991053.1.24376 WP_000991053.1.24392 WP_000991053.1.24419 WP_000991053.1.24555 WP_000991053.1.24578 WP_000991053.1.2467 WP_000991053.1.24689 WP_000991053.1.24696 WP_000991053.1.24737 WP_000991053.1.24779 WP_000991053.1.24837 WP_000991053.1.24873 WP_000991053.1.24995 WP_000991053.1.25008 WP_000991053.1.25015 WP_000991053.1.25119 WP_000991053.1.25130 WP_000991053.1.25205 WP_000991053.1.25405 WP_000991053.1.25454 WP_000991053.1.25493 WP_000991053.1.25514 WP_000991053.1.25668 WP_000991053.1.25690 WP_000991053.1.2570 WP_000991053.1.25703 WP_000991053.1.25740 WP_000991053.1.25793 WP_000991053.1.25814 WP_000991053.1.25928 WP_000991053.1.25988 WP_000991053.1.26093 WP_000991053.1.26129 WP_000991053.1.26224 WP_000991053.1.26282 WP_000991053.1.26311 WP_000991053.1.26319 WP_000991053.1.26429 WP_000991053.1.26440 WP_000991053.1.26493 WP_000991053.1.26512 WP_000991053.1.26551 WP_000991053.1.26567 WP_000991053.1.26576 WP_000991053.1.26646 WP_000991053.1.26709 WP_000991053.1.26741 WP_000991053.1.26882 WP_000991053.1.26883 WP_000991053.1.26919 WP_000991053.1.26924 WP_000991053.1.26980 WP_000991053.1.27010 WP_000991053.1.27072 WP_000991053.1.27084 WP_000991053.1.27173 WP_000991053.1.272 WP_000991053.1.27206 WP_000991053.1.27223 WP_000991053.1.2723 WP_000991053.1.27255 WP_000991053.1.27279 WP_000991053.1.27342 WP_000991053.1.27423 WP_000991053.1.27452 WP_000991053.1.27513 WP_000991053.1.27522 WP_000991053.1.27523 WP_000991053.1.27544 WP_000991053.1.27561 WP_000991053.1.27616 WP_000991053.1.2763 WP_000991053.1.27665 WP_000991053.1.27679 WP_000991053.1.27707 WP_000991053.1.27713 WP_000991053.1.27761 WP_000991053.1.2777 WP_000991053.1.27776 WP_000991053.1.27815 WP_000991053.1.27857 WP_000991053.1.27969 WP_000991053.1.27977 WP_000991053.1.28002 WP_000991053.1.28032 WP_000991053.1.28094 WP_000991053.1.28170 WP_000991053.1.28225 WP_000991053.1.2825 WP_000991053.1.28301 WP_000991053.1.28302 WP_000991053.1.2835 WP_000991053.1.28370 WP_000991053.1.28393 WP_000991053.1.28538 WP_000991053.1.28575 WP_000991053.1.28625 WP_000991053.1.28655 WP_000991053.1.28694 WP_000991053.1.28775 WP_000991053.1.2879 WP_000991053.1.28811 WP_000991053.1.2890 WP_000991053.1.28902 WP_000991053.1.28938 WP_000991053.1.28946 WP_000991053.1.28948 WP_000991053.1.28977 WP_000991053.1.29006 WP_000991053.1.29010 WP_000991053.1.29099 WP_000991053.1.2910 WP_000991053.1.29113 WP_000991053.1.29190 WP_000991053.1.29255 WP_000991053.1.29349 WP_000991053.1.29509 WP_000991053.1.29530 WP_000991053.1.29588 WP_000991053.1.29601 WP_000991053.1.29606 WP_000991053.1.29615 WP_000991053.1.29619 WP_000991053.1.29682 WP_000991053.1.29704 WP_000991053.1.29732 WP_000991053.1.29768 WP_000991053.1.29827 WP_000991053.1.29923 WP_000991053.1.29990 WP_000991053.1.30006 WP_000991053.1.30022 WP_000991053.1.30027 WP_000991053.1.30086 WP_000991053.1.30180 WP_000991053.1.30202 WP_000991053.1.30331 WP_000991053.1.30356 WP_000991053.1.30389 WP_000991053.1.30469 WP_000991053.1.30505 WP_000991053.1.30507 WP_000991053.1.30535 WP_000991053.1.30547 WP_000991053.1.30573 WP_000991053.1.30619 WP_000991053.1.3068 WP_000991053.1.30696 WP_000991053.1.3076 WP_000991053.1.30794 WP_000991053.1.3080 WP_000991053.1.30833 WP_000991053.1.30835 WP_000991053.1.30972 WP_000991053.1.31 WP_000991053.1.31092 WP_000991053.1.31107 WP_000991053.1.31111 WP_000991053.1.31122 WP_000991053.1.3113 WP_000991053.1.3114 WP_000991053.1.31155 WP_000991053.1.31185 WP_000991053.1.3119 WP_000991053.1.31190 WP_000991053.1.31195 WP_000991053.1.31196 WP_000991053.1.31214 WP_000991053.1.31262 WP_000991053.1.31281 WP_000991053.1.31362 WP_000991053.1.31451 WP_000991053.1.31504 WP_000991053.1.31515 WP_000991053.1.31578 WP_000991053.1.31658 WP_000991053.1.31665 WP_000991053.1.31725 WP_000991053.1.31782 WP_000991053.1.31845 WP_000991053.1.31927 WP_000991053.1.31940 WP_000991053.1.31952 WP_000991053.1.31967 WP_000991053.1.31972 WP_000991053.1.32192 WP_000991053.1.32206 WP_000991053.1.32260 WP_000991053.1.32277 WP_000991053.1.32424 WP_000991053.1.32491 WP_000991053.1.32515 WP_000991053.1.32660 WP_000991053.1.32702 WP_000991053.1.32714 WP_000991053.1.32747 WP_000991053.1.32750 WP_000991053.1.3278 WP_000991053.1.32786 WP_000991053.1.32804 WP_000991053.1.32900 WP_000991053.1.32902 WP_000991053.1.32907 WP_000991053.1.33030 WP_000991053.1.33106 WP_000991053.1.33127 WP_000991053.1.33143 WP_000991053.1.33248 WP_000991053.1.33261 WP_000991053.1.333 WP_000991053.1.33392 WP_000991053.1.33492 WP_000991053.1.33499 WP_000991053.1.33553 WP_000991053.1.33580 WP_000991053.1.33592 WP_000991053.1.33609 WP_000991053.1.33817 WP_000991053.1.33894 WP_000991053.1.3394 WP_000991053.1.33986 WP_000991053.1.34043 WP_000991053.1.34075 WP_000991053.1.34084 WP_000991053.1.34179 WP_000991053.1.34257 WP_000991053.1.34279 WP_000991053.1.34319 WP_000991053.1.34330 WP_000991053.1.34417 WP_000991053.1.34453 WP_000991053.1.34458 WP_000991053.1.34610 WP_000991053.1.34659 WP_000991053.1.3476 WP_000991053.1.34817 WP_000991053.1.34854 WP_000991053.1.34856 WP_000991053.1.34881 WP_000991053.1.34972 WP_000991053.1.34975 WP_000991053.1.35045 WP_000991053.1.35129 WP_000991053.1.35184 WP_000991053.1.35193 WP_000991053.1.35404 WP_000991053.1.35408 WP_000991053.1.35425 WP_000991053.1.35446 WP_000991053.1.35463 WP_000991053.1.35503 WP_000991053.1.35509 WP_000991053.1.3556 WP_000991053.1.35590 WP_000991053.1.35648 WP_000991053.1.35835 WP_000991053.1.35868 WP_000991053.1.35892 WP_000991053.1.35940 WP_000991053.1.36003 WP_000991053.1.3601 WP_000991053.1.36017 WP_000991053.1.36172 WP_000991053.1.36229 WP_000991053.1.36232 WP_000991053.1.36547 WP_000991053.1.36564 WP_000991053.1.36609 WP_000991053.1.36690 WP_000991053.1.3670 WP_000991053.1.36705 WP_000991053.1.36792 WP_000991053.1.36885 WP_000991053.1.36918 WP_000991053.1.36931 WP_000991053.1.36978 WP_000991053.1.37013 WP_000991053.1.37021 WP_000991053.1.37073 WP_000991053.1.37111 WP_000991053.1.37112 WP_000991053.1.37147 WP_000991053.1.37158 WP_000991053.1.37256 WP_000991053.1.3728 WP_000991053.1.37293 WP_000991053.1.37363 WP_000991053.1.37370 WP_000991053.1.37376 WP_000991053.1.3744 WP_000991053.1.37478 WP_000991053.1.37498 WP_000991053.1.37504 WP_000991053.1.37521 WP_000991053.1.37618 WP_000991053.1.37848 WP_000991053.1.37968 WP_000991053.1.37978 WP_000991053.1.38055 WP_000991053.1.38113 WP_000991053.1.38125 WP_000991053.1.38145 WP_000991053.1.3828 WP_000991053.1.383 WP_000991053.1.38341 WP_000991053.1.3848 WP_000991053.1.38569 WP_000991053.1.38609 WP_000991053.1.38613 WP_000991053.1.38673 WP_000991053.1.38693 WP_000991053.1.38773 WP_000991053.1.38781 WP_000991053.1.38857 WP_000991053.1.38881 WP_000991053.1.38882 WP_000991053.1.38895 WP_000991053.1.3891 WP_000991053.1.38913 WP_000991053.1.38942 WP_000991053.1.38995 WP_000991053.1.39003 WP_000991053.1.39075 WP_000991053.1.39113 WP_000991053.1.39136 WP_000991053.1.39140 WP_000991053.1.39146 WP_000991053.1.39197 WP_000991053.1.39229 WP_000991053.1.39265 WP_000991053.1.39405 WP_000991053.1.39420 WP_000991053.1.39449 WP_000991053.1.39466 WP_000991053.1.39471 WP_000991053.1.39512 WP_000991053.1.39584 WP_000991053.1.39609 WP_000991053.1.39629 WP_000991053.1.39722 WP_000991053.1.39724 WP_000991053.1.39763 WP_000991053.1.39862 WP_000991053.1.39921 WP_000991053.1.39923 WP_000991053.1.40017 WP_000991053.1.40072 WP_000991053.1.40073 WP_000991053.1.4011 WP_000991053.1.40155 WP_000991053.1.40171 WP_000991053.1.40208 WP_000991053.1.40229 WP_000991053.1.40240 WP_000991053.1.40254 WP_000991053.1.40257 WP_000991053.1.40258 WP_000991053.1.40292 WP_000991053.1.40305 WP_000991053.1.40311 WP_000991053.1.40341 WP_000991053.1.40374 WP_000991053.1.40380 WP_000991053.1.40395 WP_000991053.1.40465 WP_000991053.1.40648 WP_000991053.1.40710 WP_000991053.1.4075 WP_000991053.1.4087 WP_000991053.1.40877 WP_000991053.1.40910 WP_000991053.1.40979 WP_000991053.1.40996 WP_000991053.1.41017 WP_000991053.1.41018 WP_000991053.1.41048 WP_000991053.1.41050 WP_000991053.1.41086 WP_000991053.1.4109 WP_000991053.1.41091 WP_000991053.1.41225 WP_000991053.1.41226 WP_000991053.1.41265 WP_000991053.1.41279 WP_000991053.1.41308 WP_000991053.1.41345 WP_000991053.1.41375 WP_000991053.1.41516 WP_000991053.1.41554 WP_000991053.1.41572 WP_000991053.1.41591 WP_000991053.1.41593 WP_000991053.1.41628 WP_000991053.1.41662 WP_000991053.1.41708 WP_000991053.1.41761 WP_000991053.1.4184 WP_000991053.1.41877 WP_000991053.1.41882 WP_000991053.1.41938 WP_000991053.1.41979 WP_000991053.1.41985 WP_000991053.1.42104 WP_000991053.1.42156 WP_000991053.1.4222 WP_000991053.1.42243 WP_000991053.1.42276 WP_000991053.1.42320 WP_000991053.1.42328 WP_000991053.1.42342 WP_000991053.1.42404 WP_000991053.1.42422 WP_000991053.1.42444 WP_000991053.1.42453 WP_000991053.1.42491 WP_000991053.1.42605 WP_000991053.1.42676 WP_000991053.1.42707 WP_000991053.1.4276 WP_000991053.1.42864 WP_000991053.1.4288 WP_000991053.1.4289 WP_000991053.1.43018 WP_000991053.1.43041 WP_000991053.1.43077 WP_000991053.1.43244 WP_000991053.1.43272 WP_000991053.1.43276 WP_000991053.1.43299 WP_000991053.1.43312 WP_000991053.1.43334 WP_000991053.1.43339 WP_000991053.1.43371 WP_000991053.1.43437 WP_000991053.1.43438 WP_000991053.1.43441 WP_000991053.1.43508 WP_000991053.1.43522 WP_000991053.1.43535 WP_000991053.1.43613 WP_000991053.1.43668 WP_000991053.1.43676 WP_000991053.1.43710 WP_000991053.1.43778 WP_000991053.1.43828 WP_000991053.1.43864 WP_000991053.1.43873 WP_000991053.1.43886 WP_000991053.1.43951 WP_000991053.1.43954 WP_000991053.1.44005 WP_000991053.1.4404 WP_000991053.1.44043 WP_000991053.1.44099 WP_000991053.1.44121 WP_000991053.1.44191 WP_000991053.1.4422 WP_000991053.1.44291 WP_000991053.1.44300 WP_000991053.1.44310 WP_000991053.1.44359 WP_000991053.1.44433 WP_000991053.1.44443 WP_000991053.1.44453 WP_000991053.1.44479 WP_000991053.1.44633 WP_000991053.1.44636 WP_000991053.1.44640 WP_000991053.1.4467 WP_000991053.1.44678 WP_000991053.1.44747 WP_000991053.1.44791 WP_000991053.1.44833 WP_000991053.1.4485 WP_000991053.1.44877 WP_000991053.1.449 WP_000991053.1.44927 WP_000991053.1.44933 WP_000991053.1.44950 WP_000991053.1.44996 WP_000991053.1.45038 WP_000991053.1.45067 WP_000991053.1.45074 WP_000991053.1.45079 WP_000991053.1.45098 WP_000991053.1.45134 WP_000991053.1.45138 WP_000991053.1.45145 WP_000991053.1.45177 WP_000991053.1.45184 WP_000991053.1.45259 WP_000991053.1.45349 WP_000991053.1.45351 WP_000991053.1.45365 WP_000991053.1.4540 WP_000991053.1.45434 WP_000991053.1.45462 WP_000991053.1.45550 WP_000991053.1.45582 WP_000991053.1.45585 WP_000991053.1.45622 WP_000991053.1.45660 WP_000991053.1.45690 WP_000991053.1.45781 WP_000991053.1.458 WP_000991053.1.45848 WP_000991053.1.46011 WP_000991053.1.46028 WP_000991053.1.46069 WP_000991053.1.46112 WP_000991053.1.46173 WP_000991053.1.46174 WP_000991053.1.46187 WP_000991053.1.46205 WP_000991053.1.46243 WP_000991053.1.46278 WP_000991053.1.46299 WP_000991053.1.46303 WP_000991053.1.46323 WP_000991053.1.46345 WP_000991053.1.46358 WP_000991053.1.46406 WP_000991053.1.46444 WP_000991053.1.46572 WP_000991053.1.46595 WP_000991053.1.46637 WP_000991053.1.46675 WP_000991053.1.46689 WP_000991053.1.4671 WP_000991053.1.46732 WP_000991053.1.46803 WP_000991053.1.47008 WP_000991053.1.47014 WP_000991053.1.47057 WP_000991053.1.47214 WP_000991053.1.47389 WP_000991053.1.47429 WP_000991053.1.47448 WP_000991053.1.47460 WP_000991053.1.4747 WP_000991053.1.47472 WP_000991053.1.47478 WP_000991053.1.47492 WP_000991053.1.47506 WP_000991053.1.47579 WP_000991053.1.47587 WP_000991053.1.47614 WP_000991053.1.47621 WP_000991053.1.4769 WP_000991053.1.4770 WP_000991053.1.47767 WP_000991053.1.47799 WP_000991053.1.47817 WP_000991053.1.47849 WP_000991053.1.48132 WP_000991053.1.48242 WP_000991053.1.48244 WP_000991053.1.48253 WP_000991053.1.483 WP_000991053.1.48367 WP_000991053.1.48377 WP_000991053.1.48399 WP_000991053.1.4853 WP_000991053.1.48651 WP_000991053.1.48751 WP_000991053.1.48788 WP_000991053.1.4885 WP_000991053.1.48855 WP_000991053.1.48876 WP_000991053.1.48886 WP_000991053.1.48894 WP_000991053.1.48896 WP_000991053.1.48908 WP_000991053.1.48919 WP_000991053.1.49012 WP_000991053.1.49084 WP_000991053.1.49113 WP_000991053.1.49155 WP_000991053.1.49204 WP_000991053.1.49214 WP_000991053.1.49239 WP_000991053.1.49256 WP_000991053.1.49290 WP_000991053.1.49304 WP_000991053.1.49340 WP_000991053.1.49366 WP_000991053.1.49490 WP_000991053.1.49515 WP_000991053.1.49550 WP_000991053.1.49572 WP_000991053.1.49590 WP_000991053.1.49595 WP_000991053.1.49626 WP_000991053.1.49630 WP_000991053.1.49686 WP_000991053.1.4979 WP_000991053.1.49803 WP_000991053.1.49805 WP_000991053.1.49848 WP_000991053.1.49929 WP_000991053.1.50003 WP_000991053.1.50080 WP_000991053.1.50161 WP_000991053.1.50198 WP_000991053.1.50211 WP_000991053.1.50251 WP_000991053.1.50376 WP_000991053.1.50389 WP_000991053.1.50404 WP_000991053.1.50413 WP_000991053.1.50469 WP_000991053.1.50517 WP_000991053.1.50563 WP_000991053.1.5058 WP_000991053.1.50593 WP_000991053.1.50676 WP_000991053.1.50804 WP_000991053.1.50808 WP_000991053.1.5088 WP_000991053.1.50908 WP_000991053.1.50941 WP_000991053.1.50954 WP_000991053.1.50999 WP_000991053.1.51014 WP_000991053.1.51022 WP_000991053.1.51025 WP_000991053.1.51036 WP_000991053.1.51066 WP_000991053.1.5114 WP_000991053.1.51179 WP_000991053.1.51182 WP_000991053.1.51186 WP_000991053.1.51224 WP_000991053.1.5125 WP_000991053.1.51308 WP_000991053.1.51331 WP_000991053.1.51338 WP_000991053.1.5138 WP_000991053.1.51394 WP_000991053.1.51414 WP_000991053.1.51464 WP_000991053.1.51487 WP_000991053.1.51488 WP_000991053.1.51594 WP_000991053.1.51613 WP_000991053.1.51615 WP_000991053.1.51634 WP_000991053.1.51649 WP_000991053.1.51686 WP_000991053.1.51704 WP_000991053.1.51756 WP_000991053.1.51831 WP_000991053.1.51841 WP_000991053.1.51888 WP_000991053.1.51910 WP_000991053.1.51911 WP_000991053.1.51932 WP_000991053.1.51989 WP_000991053.1.52121 WP_000991053.1.52161 WP_000991053.1.52170 WP_000991053.1.52336 WP_000991053.1.52346 WP_000991053.1.52353 WP_000991053.1.52356 WP_000991053.1.52361 WP_000991053.1.52446 WP_000991053.1.52637 WP_000991053.1.52653 WP_000991053.1.52656 WP_000991053.1.52692 WP_000991053.1.5273 WP_000991053.1.52738 WP_000991053.1.52743 WP_000991053.1.52744 WP_000991053.1.52857 WP_000991053.1.52866 WP_000991053.1.52898 WP_000991053.1.52915 WP_000991053.1.52949 WP_000991053.1.52985 WP_000991053.1.53158 WP_000991053.1.53190 WP_000991053.1.53272 WP_000991053.1.53315 WP_000991053.1.53406 WP_000991053.1.53466 WP_000991053.1.53529 WP_000991053.1.53543 WP_000991053.1.53688 WP_000991053.1.53757 WP_000991053.1.53790 WP_000991053.1.53812 WP_000991053.1.53814 WP_000991053.1.53905 WP_000991053.1.5392 WP_000991053.1.54033 WP_000991053.1.54075 WP_000991053.1.54085 WP_000991053.1.5415 WP_000991053.1.54196 WP_000991053.1.54209 WP_000991053.1.54271 WP_000991053.1.54274 WP_000991053.1.54319 WP_000991053.1.54324 WP_000991053.1.54364 WP_000991053.1.54400 WP_000991053.1.54522 WP_000991053.1.54526 WP_000991053.1.54558 WP_000991053.1.5456 WP_000991053.1.54607 WP_000991053.1.54644 WP_000991053.1.54662 WP_000991053.1.54694 WP_000991053.1.54722 WP_000991053.1.54749 WP_000991053.1.54764 WP_000991053.1.54814 WP_000991053.1.54822 WP_000991053.1.54845 WP_000991053.1.54992 WP_000991053.1.55008 WP_000991053.1.55073 WP_000991053.1.55152 WP_000991053.1.55156 WP_000991053.1.55166 WP_000991053.1.55285 WP_000991053.1.55325 WP_000991053.1.55430 WP_000991053.1.55475 WP_000991053.1.5552 WP_000991053.1.55528 WP_000991053.1.55545 WP_000991053.1.55554 WP_000991053.1.55557 WP_000991053.1.5560 WP_000991053.1.55614 WP_000991053.1.55647 WP_000991053.1.55743 WP_000991053.1.55768 WP_000991053.1.55782 WP_000991053.1.55796 WP_000991053.1.55803 WP_000991053.1.55973 WP_000991053.1.55995 WP_000991053.1.56002 WP_000991053.1.56004 WP_000991053.1.56012 WP_000991053.1.56026 WP_000991053.1.56105 WP_000991053.1.56222 WP_000991053.1.56238 WP_000991053.1.56244 WP_000991053.1.56286 WP_000991053.1.56304 WP_000991053.1.5633 WP_000991053.1.56354 WP_000991053.1.56368 WP_000991053.1.56396 WP_000991053.1.56414 WP_000991053.1.56438 WP_000991053.1.56468 WP_000991053.1.56559 WP_000991053.1.56560 WP_000991053.1.56601 WP_000991053.1.56614 WP_000991053.1.56615 WP_000991053.1.56647 WP_000991053.1.56651 WP_000991053.1.56660 WP_000991053.1.56671 WP_000991053.1.56682 WP_000991053.1.56824 WP_000991053.1.56875 WP_000991053.1.56877 WP_000991053.1.56905 WP_000991053.1.57000 WP_000991053.1.57076 WP_000991053.1.57168 WP_000991053.1.57187 WP_000991053.1.57233 WP_000991053.1.57344 WP_000991053.1.57356 WP_000991053.1.57377 WP_000991053.1.57418 WP_000991053.1.57433 WP_000991053.1.57510 WP_000991053.1.57515 WP_000991053.1.57521 WP_000991053.1.57529 WP_000991053.1.5753 WP_000991053.1.57576 WP_000991053.1.57601 WP_000991053.1.57607 WP_000991053.1.5774 WP_000991053.1.57763 WP_000991053.1.57781 WP_000991053.1.57862 WP_000991053.1.57890 WP_000991053.1.57891 WP_000991053.1.57978 WP_000991053.1.5801 WP_000991053.1.58041 WP_000991053.1.58131 WP_000991053.1.58157 WP_000991053.1.58239 WP_000991053.1.58357 WP_000991053.1.58358 WP_000991053.1.58372 WP_000991053.1.58407 WP_000991053.1.58416 WP_000991053.1.58418 WP_000991053.1.58451 WP_000991053.1.58548 WP_000991053.1.5858 WP_000991053.1.58662 WP_000991053.1.58669 WP_000991053.1.58698 WP_000991053.1.58744 WP_000991053.1.58745 WP_000991053.1.58803 WP_000991053.1.58834 WP_000991053.1.5886 WP_000991053.1.59006 WP_000991053.1.59012 WP_000991053.1.59094 WP_000991053.1.59097 WP_000991053.1.59136 WP_000991053.1.59224 WP_000991053.1.59236 WP_000991053.1.5929 WP_000991053.1.59294 WP_000991053.1.59375 WP_000991053.1.59420 WP_000991053.1.59439 WP_000991053.1.59458 WP_000991053.1.59490 WP_000991053.1.59508 WP_000991053.1.59512 WP_000991053.1.59521 WP_000991053.1.59636 WP_000991053.1.59684 WP_000991053.1.59694 WP_000991053.1.59710 WP_000991053.1.59771 WP_000991053.1.5979 WP_000991053.1.59953 WP_000991053.1.59979 WP_000991053.1.60008 WP_000991053.1.60021 WP_000991053.1.60069 WP_000991053.1.60140 WP_000991053.1.60155 WP_000991053.1.60209 WP_000991053.1.60213 WP_000991053.1.60285 WP_000991053.1.60330 WP_000991053.1.60370 WP_000991053.1.60379 WP_000991053.1.60464 WP_000991053.1.60507 WP_000991053.1.6052 WP_000991053.1.60545 WP_000991053.1.60561 WP_000991053.1.60608 WP_000991053.1.60622 WP_000991053.1.60760 WP_000991053.1.60772 WP_000991053.1.60863 WP_000991053.1.60874 WP_000991053.1.60926 WP_000991053.1.60941 WP_000991053.1.60990 WP_000991053.1.61045 WP_000991053.1.61078 WP_000991053.1.6108 WP_000991053.1.61087 WP_000991053.1.6114 WP_000991053.1.61184 WP_000991053.1.61232 WP_000991053.1.6129 WP_000991053.1.61296 WP_000991053.1.61345 WP_000991053.1.61417 WP_000991053.1.61434 WP_000991053.1.61509 WP_000991053.1.61519 WP_000991053.1.61574 WP_000991053.1.61662 WP_000991053.1.61712 WP_000991053.1.61714 WP_000991053.1.61730 WP_000991053.1.61732 WP_000991053.1.61857 WP_000991053.1.6190 WP_000991053.1.61918 WP_000991053.1.61952 WP_000991053.1.62007 WP_000991053.1.62020 WP_000991053.1.62025 WP_000991053.1.6209 WP_000991053.1.62144 WP_000991053.1.62204 WP_000991053.1.62222 WP_000991053.1.62257 WP_000991053.1.62271 WP_000991053.1.62304 WP_000991053.1.62339 WP_000991053.1.62344 WP_000991053.1.62364 WP_000991053.1.62374 WP_000991053.1.62403 WP_000991053.1.62486 WP_000991053.1.6253 WP_000991053.1.62648 WP_000991053.1.62677 WP_000991053.1.62693 WP_000991053.1.62725 WP_000991053.1.62853 WP_000991053.1.62903 WP_000991053.1.62910 WP_000991053.1.62955 WP_000991053.1.63129 WP_000991053.1.63181 WP_000991053.1.63186 WP_000991053.1.63203 WP_000991053.1.63243 WP_000991053.1.63250 WP_000991053.1.63256 WP_000991053.1.63290 WP_000991053.1.63382 WP_000991053.1.63432 WP_000991053.1.63461 WP_000991053.1.63479 WP_000991053.1.63499 WP_000991053.1.63568 WP_000991053.1.63577 WP_000991053.1.63633 WP_000991053.1.63664 WP_000991053.1.63690 WP_000991053.1.63718 WP_000991053.1.63731 WP_000991053.1.6375 WP_000991053.1.63757 WP_000991053.1.63797 WP_000991053.1.63834 WP_000991053.1.63860 WP_000991053.1.63864 WP_000991053.1.63866 WP_000991053.1.63903 WP_000991053.1.63912 WP_000991053.1.63958 WP_000991053.1.6399 WP_000991053.1.64018 WP_000991053.1.64034 WP_000991053.1.64046 WP_000991053.1.64072 WP_000991053.1.64208 WP_000991053.1.6423 WP_000991053.1.64244 WP_000991053.1.64266 WP_000991053.1.64387 WP_000991053.1.64403 WP_000991053.1.6451 WP_000991053.1.64645 WP_000991053.1.64649 WP_000991053.1.64690 WP_000991053.1.64702 WP_000991053.1.64757 WP_000991053.1.64781 WP_000991053.1.64798 WP_000991053.1.64831 WP_000991053.1.6489 WP_000991053.1.64894 WP_000991053.1.65016 WP_000991053.1.65018 WP_000991053.1.65022 WP_000991053.1.65028 WP_000991053.1.65168 WP_000991053.1.65171 WP_000991053.1.65238 WP_000991053.1.65248 WP_000991053.1.65269 WP_000991053.1.6535 WP_000991053.1.65474 WP_000991053.1.65508 WP_000991053.1.65558 WP_000991053.1.6560 WP_000991053.1.6561 WP_000991053.1.65633 WP_000991053.1.6565 WP_000991053.1.65696 WP_000991053.1.6575 WP_000991053.1.65782 WP_000991053.1.65795 WP_000991053.1.65849 WP_000991053.1.6594 WP_000991053.1.65940 WP_000991053.1.65956 WP_000991053.1.66049 WP_000991053.1.66085 WP_000991053.1.66129 WP_000991053.1.66235 WP_000991053.1.6630 WP_000991053.1.66314 WP_000991053.1.66330 WP_000991053.1.66358 WP_000991053.1.66362 WP_000991053.1.66365 WP_000991053.1.6638 WP_000991053.1.6640 WP_000991053.1.66462 WP_000991053.1.66678 WP_000991053.1.66698 WP_000991053.1.66779 WP_000991053.1.6680 WP_000991053.1.66807 WP_000991053.1.66834 WP_000991053.1.66901 WP_000991053.1.66962 WP_000991053.1.67 WP_000991053.1.67037 WP_000991053.1.67045 WP_000991053.1.67100 WP_000991053.1.67181 WP_000991053.1.67235 WP_000991053.1.67268 WP_000991053.1.67347 WP_000991053.1.6739 WP_000991053.1.67424 WP_000991053.1.67465 WP_000991053.1.67552 WP_000991053.1.67682 WP_000991053.1.67772 WP_000991053.1.67803 WP_000991053.1.67814 WP_000991053.1.67827 WP_000991053.1.67829 WP_000991053.1.6785 WP_000991053.1.67887 WP_000991053.1.67924 WP_000991053.1.67969 WP_000991053.1.68073 WP_000991053.1.6809 WP_000991053.1.68201 WP_000991053.1.68206 WP_000991053.1.6827 WP_000991053.1.68275 WP_000991053.1.68401 WP_000991053.1.68477 WP_000991053.1.6849 WP_000991053.1.68547 WP_000991053.1.6857 WP_000991053.1.68589 WP_000991053.1.68655 WP_000991053.1.68656 WP_000991053.1.68658 WP_000991053.1.68690 WP_000991053.1.68778 WP_000991053.1.68787 WP_000991053.1.6882 WP_000991053.1.68894 WP_000991053.1.68928 WP_000991053.1.68958 WP_000991053.1.68966 WP_000991053.1.68975 WP_000991053.1.69001 WP_000991053.1.69006 WP_000991053.1.69011 WP_000991053.1.69029 WP_000991053.1.6904 WP_000991053.1.6913 WP_000991053.1.69146 WP_000991053.1.69151 WP_000991053.1.69255 WP_000991053.1.69320 WP_000991053.1.69346 WP_000991053.1.69359 WP_000991053.1.69397 WP_000991053.1.6954 WP_000991053.1.69554 WP_000991053.1.69564 WP_000991053.1.69588 WP_000991053.1.69644 WP_000991053.1.69704 WP_000991053.1.69758 WP_000991053.1.69785 WP_000991053.1.69787 WP_000991053.1.69807 WP_000991053.1.69808 WP_000991053.1.69848 WP_000991053.1.69975 WP_000991053.1.69977 WP_000991053.1.70003 WP_000991053.1.70028 WP_000991053.1.7010 WP_000991053.1.70169 WP_000991053.1.7021 WP_000991053.1.70241 WP_000991053.1.70248 WP_000991053.1.70269 WP_000991053.1.70289 WP_000991053.1.70327 WP_000991053.1.70447 WP_000991053.1.70485 WP_000991053.1.70643 WP_000991053.1.70683 WP_000991053.1.70733 WP_000991053.1.70761 WP_000991053.1.70792 WP_000991053.1.70869 WP_000991053.1.70883 WP_000991053.1.70899 WP_000991053.1.70922 WP_000991053.1.70948 WP_000991053.1.70959 WP_000991053.1.71007 WP_000991053.1.71023 WP_000991053.1.71069 WP_000991053.1.7110 WP_000991053.1.71116 WP_000991053.1.71120 WP_000991053.1.71146 WP_000991053.1.71165 WP_000991053.1.71188 WP_000991053.1.71202 WP_000991053.1.71243 WP_000991053.1.71306 WP_000991053.1.71337 WP_000991053.1.71363 WP_000991053.1.71378 WP_000991053.1.714 WP_000991053.1.71401 WP_000991053.1.7142 WP_000991053.1.71636 WP_000991053.1.71702 WP_000991053.1.71746 WP_000991053.1.71750 WP_000991053.1.71798 WP_000991053.1.71845 WP_000991053.1.71881 WP_000991053.1.71908 WP_000991053.1.71929 WP_000991053.1.71941 WP_000991053.1.71952 WP_000991053.1.71973 WP_000991053.1.72105 WP_000991053.1.72107 WP_000991053.1.72119 WP_000991053.1.72203 WP_000991053.1.72234 WP_000991053.1.72243 WP_000991053.1.72277 WP_000991053.1.72281 WP_000991053.1.72351 WP_000991053.1.72376 WP_000991053.1.72382 WP_000991053.1.72403 WP_000991053.1.72412 WP_000991053.1.72594 WP_000991053.1.72629 WP_000991053.1.72642 WP_000991053.1.72689 WP_000991053.1.72728 WP_000991053.1.72793 WP_000991053.1.72871 WP_000991053.1.72872 WP_000991053.1.72894 WP_000991053.1.72897 WP_000991053.1.72975 WP_000991053.1.7304 WP_000991053.1.73125 WP_000991053.1.7315 WP_000991053.1.73200 WP_000991053.1.7334 WP_000991053.1.73362 WP_000991053.1.73377 WP_000991053.1.73379 WP_000991053.1.7341 WP_000991053.1.73461 WP_000991053.1.73481 WP_000991053.1.7356 WP_000991053.1.73581 WP_000991053.1.73617 WP_000991053.1.73753 WP_000991053.1.73758 WP_000991053.1.73794 WP_000991053.1.73804 WP_000991053.1.73847 WP_000991053.1.7387 WP_000991053.1.73924 WP_000991053.1.73965 WP_000991053.1.74029 WP_000991053.1.74040 WP_000991053.1.7405 WP_000991053.1.74089 WP_000991053.1.74117 WP_000991053.1.74181 WP_000991053.1.74191 WP_000991053.1.74228 WP_000991053.1.7433 WP_000991053.1.74379 WP_000991053.1.74410 WP_000991053.1.74414 WP_000991053.1.74422 WP_000991053.1.74454 WP_000991053.1.74466 WP_000991053.1.74481 WP_000991053.1.745 WP_000991053.1.74529 WP_000991053.1.74545 WP_000991053.1.74570 WP_000991053.1.74620 WP_000991053.1.74639 WP_000991053.1.74661 WP_000991053.1.74745 WP_000991053.1.74806 WP_000991053.1.74826 WP_000991053.1.7491 WP_000991053.1.75009 WP_000991053.1.75114 WP_000991053.1.75129 WP_000991053.1.75134 WP_000991053.1.75177 WP_000991053.1.75180 WP_000991053.1.75187 WP_000991053.1.75288 WP_000991053.1.75301 WP_000991053.1.75334 WP_000991053.1.75362 WP_000991053.1.75385 WP_000991053.1.75392 WP_000991053.1.75609 WP_000991053.1.75740 WP_000991053.1.75760 WP_000991053.1.75764 WP_000991053.1.75837 WP_000991053.1.75874 WP_000991053.1.75945 WP_000991053.1.75957 WP_000991053.1.76020 WP_000991053.1.76102 WP_000991053.1.76156 WP_000991053.1.76170 WP_000991053.1.76252 WP_000991053.1.76301 WP_000991053.1.76327 WP_000991053.1.76445 WP_000991053.1.76471 WP_000991053.1.76532 WP_000991053.1.76548 WP_000991053.1.76576 WP_000991053.1.7660 WP_000991053.1.76673 WP_000991053.1.76706 WP_000991053.1.76721 WP_000991053.1.76724 WP_000991053.1.76756 WP_000991053.1.76760 WP_000991053.1.76799 WP_000991053.1.7684 WP_000991053.1.76866 WP_000991053.1.76875 WP_000991053.1.76880 WP_000991053.1.76899 WP_000991053.1.77017 WP_000991053.1.77033 WP_000991053.1.77038 WP_000991053.1.77047 WP_000991053.1.77080 WP_000991053.1.7712 WP_000991053.1.77177 WP_000991053.1.77180 WP_000991053.1.77193 WP_000991053.1.77241 WP_000991053.1.77244 WP_000991053.1.77267 WP_000991053.1.77271 WP_000991053.1.77292 WP_000991053.1.77349 WP_000991053.1.77390 WP_000991053.1.77436 WP_000991053.1.77514 WP_000991053.1.77529 WP_000991053.1.77549 WP_000991053.1.77575 WP_000991053.1.77596 WP_000991053.1.77692 WP_000991053.1.77710 WP_000991053.1.77754 WP_000991053.1.7782 WP_000991053.1.77851 WP_000991053.1.77871 WP_000991053.1.77898 WP_000991053.1.77918 WP_000991053.1.77960 WP_000991053.1.78 WP_000991053.1.78033 WP_000991053.1.78053 WP_000991053.1.78076 WP_000991053.1.78096 WP_000991053.1.78100 WP_000991053.1.78110 WP_000991053.1.78120 WP_000991053.1.78168 WP_000991053.1.78180 WP_000991053.1.78301 WP_000991053.1.78366 WP_000991053.1.78372 WP_000991053.1.78383 WP_000991053.1.78407 WP_000991053.1.7861 WP_000991053.1.78618 WP_000991053.1.78673 WP_000991053.1.78735 WP_000991053.1.78738 WP_000991053.1.78771 WP_000991053.1.78802 WP_000991053.1.78830 WP_000991053.1.78835 WP_000991053.1.78838 WP_000991053.1.78862 WP_000991053.1.78871 WP_000991053.1.78874 WP_000991053.1.78881 WP_000991053.1.7891 WP_000991053.1.78918 WP_000991053.1.78928 WP_000991053.1.78930 WP_000991053.1.78951 WP_000991053.1.79011 WP_000991053.1.79032 WP_000991053.1.79151 WP_000991053.1.79167 WP_000991053.1.79203 WP_000991053.1.79302 WP_000991053.1.79335 WP_000991053.1.794 WP_000991053.1.79427 WP_000991053.1.79462 WP_000991053.1.79466 WP_000991053.1.79472 WP_000991053.1.79490 WP_000991053.1.79495 WP_000991053.1.79529 WP_000991053.1.79570 WP_000991053.1.7964 WP_000991053.1.79659 WP_000991053.1.79668 WP_000991053.1.79708 WP_000991053.1.79734 WP_000991053.1.79738 WP_000991053.1.79832 WP_000991053.1.79845 WP_000991053.1.79867 WP_000991053.1.79892 WP_000991053.1.79914 WP_000991053.1.79934 WP_000991053.1.7994 WP_000991053.1.79966 WP_000991053.1.79974 WP_000991053.1.79996 WP_000991053.1.80077 WP_000991053.1.80137 WP_000991053.1.80182 WP_000991053.1.80296 WP_000991053.1.80307 WP_000991053.1.80366 WP_000991053.1.80448 WP_000991053.1.80473 WP_000991053.1.80479 WP_000991053.1.80586 WP_000991053.1.80651 WP_000991053.1.80667 WP_000991053.1.80674 WP_000991053.1.80707 WP_000991053.1.80741 WP_000991053.1.80750 WP_000991053.1.80757 WP_000991053.1.80780 WP_000991053.1.80831 WP_000991053.1.80850 WP_000991053.1.80868 WP_000991053.1.80881 WP_000991053.1.80913 WP_000991053.1.80939 WP_000991053.1.8096 WP_000991053.1.81037 WP_000991053.1.81069 WP_000991053.1.81149 WP_000991053.1.81175 WP_000991053.1.8119 WP_000991053.1.81193 WP_000991053.1.81305 WP_000991053.1.81321 WP_000991053.1.81328 WP_000991053.1.81354 WP_000991053.1.81404 WP_000991053.1.81425 WP_000991053.1.81504 WP_000991053.1.81528 WP_000991053.1.81727 WP_000991053.1.81735 WP_000991053.1.81736 WP_000991053.1.81750 WP_000991053.1.81760 WP_000991053.1.81785 WP_000991053.1.81902 WP_000991053.1.81941 WP_000991053.1.8196 WP_000991053.1.81965 WP_000991053.1.81974 WP_000991053.1.81995 WP_000991053.1.82037 WP_000991053.1.82099 WP_000991053.1.82141 WP_000991053.1.82192 WP_000991053.1.82232 WP_000991053.1.82269 WP_000991053.1.82337 WP_000991053.1.82347 WP_000991053.1.82395 WP_000991053.1.82464 WP_000991053.1.82479 WP_000991053.1.82503 WP_000991053.1.82515 WP_000991053.1.82676 WP_000991053.1.82761 WP_000991053.1.82763 WP_000991053.1.8282 WP_000991053.1.82843 WP_000991053.1.82867 WP_000991053.1.82886 WP_000991053.1.82937 WP_000991053.1.82944 WP_000991053.1.82946 WP_000991053.1.82956 WP_000991053.1.82964 WP_000991053.1.83092 WP_000991053.1.83119 WP_000991053.1.83163 WP_000991053.1.83258 WP_000991053.1.83301 WP_000991053.1.83305 WP_000991053.1.83378 WP_000991053.1.83413 WP_000991053.1.83491 WP_000991053.1.83510 WP_000991053.1.83516 WP_000991053.1.83523 WP_000991053.1.8354 WP_000991053.1.83710 WP_000991053.1.83721 WP_000991053.1.83760 WP_000991053.1.83897 WP_000991053.1.83979 WP_000991053.1.83995 WP_000991053.1.84077 WP_000991053.1.84103 WP_000991053.1.84106 WP_000991053.1.84168 WP_000991053.1.84198 WP_000991053.1.84209 WP_000991053.1.84283 WP_000991053.1.84291 WP_000991053.1.84373 WP_000991053.1.84392 WP_000991053.1.84397 WP_000991053.1.8441 WP_000991053.1.84459 WP_000991053.1.84461 WP_000991053.1.84475 WP_000991053.1.84532 WP_000991053.1.84551 WP_000991053.1.84644 WP_000991053.1.84659 WP_000991053.1.84711 WP_000991053.1.84745 WP_000991053.1.84899 WP_000991053.1.849 WP_000991053.1.8497 WP_000991053.1.85014 WP_000991053.1.85040 WP_000991053.1.85134 WP_000991053.1.85147 WP_000991053.1.85178 WP_000991053.1.85180 WP_000991053.1.85190 WP_000991053.1.85217 WP_000991053.1.8533 WP_000991053.1.8537 WP_000991053.1.85408 WP_000991053.1.8545 WP_000991053.1.85456 WP_000991053.1.85481 WP_000991053.1.85483 WP_000991053.1.85541 WP_000991053.1.8556 WP_000991053.1.85568 WP_000991053.1.85615 WP_000991053.1.85617 WP_000991053.1.85663 WP_000991053.1.85671 WP_000991053.1.85672 WP_000991053.1.85675 WP_000991053.1.85742 WP_000991053.1.85777 WP_000991053.1.85780 WP_000991053.1.85854 WP_000991053.1.85864 WP_000991053.1.85886 WP_000991053.1.85900 WP_000991053.1.85904 WP_000991053.1.85943 WP_000991053.1.85976 WP_000991053.1.86007 WP_000991053.1.86017 WP_000991053.1.86043 WP_000991053.1.86173 WP_000991053.1.86224 WP_000991053.1.86259 WP_000991053.1.86284 WP_000991053.1.86285 WP_000991053.1.86306 WP_000991053.1.86335 WP_000991053.1.86356 WP_000991053.1.86389 WP_000991053.1.86450 WP_000991053.1.86469 WP_000991053.1.86580 WP_000991053.1.86588 WP_000991053.1.86593 WP_000991053.1.86601 WP_000991053.1.86634 WP_000991053.1.86656 WP_000991053.1.86661 WP_000991053.1.8671 WP_000991053.1.8672 WP_000991053.1.8678 WP_000991053.1.86807 WP_000991053.1.86810 WP_000991053.1.8684 WP_000991053.1.86860 WP_000991053.1.86895 WP_000991053.1.86906 WP_000991053.1.8691 WP_000991053.1.87051 WP_000991053.1.87095 WP_000991053.1.8722 WP_000991053.1.87282 WP_000991053.1.8736 WP_000991053.1.87365 WP_000991053.1.87460 WP_000991053.1.87552 WP_000991053.1.87695 WP_000991053.1.87779 WP_000991053.1.87899 WP_000991053.1.8792 WP_000991053.1.87945 WP_000991053.1.8800 WP_000991053.1.88019 WP_000991053.1.88073 WP_000991053.1.8809 WP_000991053.1.88136 WP_000991053.1.88174 WP_000991053.1.88214 WP_000991053.1.88222 WP_000991053.1.88264 WP_000991053.1.88291 WP_000991053.1.88293 WP_000991053.1.88303 WP_000991053.1.8837 WP_000991053.1.88393 WP_000991053.1.88423 WP_000991053.1.8849 WP_000991053.1.88683 WP_000991053.1.88698 WP_000991053.1.88703 WP_000991053.1.88792 WP_000991053.1.88845 WP_000991053.1.88902 WP_000991053.1.8891 WP_000991053.1.88942 WP_000991053.1.88957 WP_000991053.1.88967 WP_000991053.1.88970 WP_000991053.1.88980 WP_000991053.1.88995 WP_000991053.1.89008 WP_000991053.1.89054 WP_000991053.1.89114 WP_000991053.1.89116 WP_000991053.1.89119 WP_000991053.1.89138 WP_000991053.1.89188 WP_000991053.1.89215 WP_000991053.1.89304 WP_000991053.1.89311 WP_000991053.1.89452 WP_000991053.1.89462 WP_000991053.1.89512 WP_000991053.1.89527 WP_000991053.1.89570 WP_000991053.1.8958 WP_000991053.1.89604 WP_000991053.1.89622 WP_000991053.1.89632 WP_000991053.1.89657 WP_000991053.1.89659 WP_000991053.1.89765 WP_000991053.1.89789 WP_000991053.1.89817 WP_000991053.1.89870 WP_000991053.1.89902 WP_000991053.1.8996 WP_000991053.1.89965 WP_000991053.1.90033 WP_000991053.1.90084 WP_000991053.1.90097 WP_000991053.1.90211 WP_000991053.1.90252 WP_000991053.1.90311 WP_000991053.1.90409 WP_000991053.1.90417 WP_000991053.1.90440 WP_000991053.1.90453 WP_000991053.1.90458 WP_000991053.1.90557 WP_000991053.1.90585 WP_000991053.1.9064 WP_000991053.1.90641 WP_000991053.1.90734 WP_000991053.1.90814 WP_000991053.1.9093 WP_000991053.1.91003 WP_000991053.1.91049 WP_000991053.1.91056 WP_000991053.1.91069 WP_000991053.1.91107 WP_000991053.1.91156 WP_000991053.1.91179 WP_000991053.1.91189 WP_000991053.1.91278 WP_000991053.1.91334 WP_000991053.1.91459 WP_000991053.1.91493 WP_000991053.1.91512 WP_000991053.1.91564 WP_000991053.1.91621 WP_000991053.1.91625 WP_000991053.1.91628 WP_000991053.1.91655 WP_000991053.1.91702 WP_000991053.1.91724 WP_000991053.1.91732 WP_000991053.1.91788 WP_000991053.1.91864 WP_000991053.1.91880 WP_000991053.1.91903 WP_000991053.1.92013 WP_000991053.1.92044 WP_000991053.1.92093 WP_000991053.1.92099 WP_000991053.1.92108 WP_000991053.1.92122 WP_000991053.1.92165 WP_000991053.1.92183 WP_000991053.1.92208 WP_000991053.1.92213 WP_000991053.1.92268 WP_000991053.1.92310 WP_000991053.1.92375 WP_000991053.1.92394 WP_000991053.1.92408 WP_000991053.1.92411 WP_000991053.1.92443 WP_000991053.1.92482 WP_000991053.1.92531 WP_000991053.1.92575 WP_000991053.1.92659 WP_000991053.1.92669 WP_000991053.1.92671 WP_000991053.1.92738 WP_000991053.1.92758 WP_000991053.1.92827 WP_000991053.1.92832 WP_000991053.1.92879 WP_000991053.1.92893 WP_000991053.1.92895 WP_000991053.1.92939 WP_000991053.1.92988 WP_000991053.1.93059 WP_000991053.1.93086 WP_000991053.1.93101 WP_000991053.1.93136 WP_000991053.1.93155 WP_000991053.1.93339 WP_000991053.1.93365 WP_000991053.1.93543 WP_000991053.1.93650 WP_000991053.1.93656 WP_000991053.1.93662 WP_000991053.1.93671 WP_000991053.1.93691 WP_000991053.1.937 WP_000991053.1.93705 WP_000991053.1.93741 WP_000991053.1.93804 WP_000991053.1.9389 WP_000991053.1.93937 WP_000991053.1.93956 WP_000991053.1.93994 WP_000991053.1.94039 WP_000991053.1.94056 WP_000991053.1.94072 WP_000991053.1.94162 WP_000991053.1.94168 WP_000991053.1.94198 WP_000991053.1.9432 WP_000991053.1.94354 WP_000991053.1.94379 WP_000991053.1.94380 WP_000991053.1.94458 WP_000991053.1.94562 WP_000991053.1.94565 WP_000991053.1.94584 WP_000991053.1.94622 WP_000991053.1.94655 WP_000991053.1.94674 WP_000991053.1.94717 WP_000991053.1.94796 WP_000991053.1.9481 WP_000991053.1.94959 WP_000991053.1.94982 WP_000991053.1.94987 WP_000991053.1.95051 WP_000991053.1.95085 WP_000991053.1.95121 WP_000991053.1.95152 WP_000991053.1.95235 WP_000991053.1.95248 WP_000991053.1.95249 WP_000991053.1.95277 WP_000991053.1.95282 WP_000991053.1.9530 WP_000991053.1.95388 WP_000991053.1.95404 WP_000991053.1.95546 WP_000991053.1.95623 WP_000991053.1.95630 WP_000991053.1.95670 WP_000991053.1.95691 WP_000991053.1.95701 WP_000991053.1.95703 WP_000991053.1.95729 WP_000991053.1.95826 WP_000991053.1.95911 WP_000991053.1.95939 WP_000991053.1.96004 WP_000991053.1.96139 WP_000991053.1.96162 WP_000991053.1.96172 WP_000991053.1.96190 WP_000991053.1.96206 WP_000991053.1.96260 WP_000991053.1.96317 WP_000991053.1.96343 WP_000991053.1.96429 WP_000991053.1.9644 WP_000991053.1.96469 WP_000991053.1.96500 WP_000991053.1.96555 WP_000991053.1.96563 WP_000991053.1.96590 WP_000991053.1.96642 WP_000991053.1.96662 WP_000991053.1.96732 WP_000991053.1.9674 WP_000991053.1.96758 WP_000991053.1.96761 WP_000991053.1.96771 WP_000991053.1.96890 WP_000991053.1.96917 WP_000991053.1.97015 WP_000991053.1.97047 WP_000991053.1.97089 WP_000991053.1.97143 WP_000991053.1.97145 WP_000991053.1.97190 WP_000991053.1.97297 WP_000991053.1.97318 WP_000991053.1.97368 WP_000991053.1.97369 WP_000991053.1.97386 WP_000991053.1.97413 WP_000991053.1.97477 WP_000991053.1.97480 WP_000991053.1.97487 WP_000991053.1.97534 WP_000991053.1.97594 WP_000991053.1.97597 WP_000991053.1.97613 WP_000991053.1.97620 WP_000991053.1.97631 WP_000991053.1.97640 WP_000991053.1.97726 WP_000991053.1.97727 WP_000991053.1.97732 WP_000991053.1.97736 WP_000991053.1.9775 WP_000991053.1.97846 WP_000991053.1.97983 WP_000991053.1.9799 WP_000991053.1.98006 WP_000991053.1.98019 WP_000991053.1.98022 WP_000991053.1.98107 WP_000991053.1.98110 WP_000991053.1.98124 WP_000991053.1.98146 WP_000991053.1.98170 WP_000991053.1.98201 WP_000991053.1.98219 WP_000991053.1.9826 WP_000991053.1.98392 WP_000991053.1.9841 WP_000991053.1.98495 WP_000991053.1.98531 WP_000991053.1.98577 WP_000991053.1.98627 WP_000991053.1.9863 WP_000991053.1.98634 WP_000991053.1.98676 WP_000991053.1.98677 WP_000991053.1.98760 WP_000991053.1.98843 WP_000991053.1.9898 WP_000991053.1.99040 WP_000991053.1.99098 WP_000991053.1.99184 WP_000991053.1.99197 WP_000991053.1.99267 WP_000991053.1.99276 WP_000991053.1.99278 WP_000991053.1.99339 WP_000991053.1.99561 WP_000991053.1.99626 WP_000991053.1.99646 WP_000991053.1.99657 WP_000991053.1.99660 WP_000991053.1.99712 WP_000991053.1.99813 WP_000991053.1.99858 WP_000991053.1.99889 WP_000991053.1.99958 gi|549480404|ref|YP_008614632.1| gi|378990307|ref|YP_005253471.1| gi|563654336|ref|YP_008862420.1| gi|386592677|ref|YP_006089077.1| gi|526221382|ref|YP_008267189.1| gi|525829175|ref|YP_008252220.1| IDP01912 454166.SeAg_B3130 454169.SeHA_C3195 99287.STM2984 gi|194451539|ref|YP_002046956.1| gi|16766288|ref|NP_461903.1| gi|378446341|ref|YP_005233973.1| gi|378985576|ref|YP_005248732.1| gi|409246675|ref|YP_006887379.1| gi|379702243|ref|YP_005243971.1| gi|525814257|ref|YP_008244275.1| gi|383497654|ref|YP_005398343.1| gi|550902349|ref|YP_008671441.1| gi|549725554|ref|YP_008645744.1| gi|482905548|ref|YP_007904108.1| gi|378451745|ref|YP_005239105.1| gi|525858758|ref|YP_008262126.1| gi|197247530|ref|YP_002147896.1| gi|378700896|ref|YP_005182853.1| ABAO01000025|CDS_38031-39236 ABEL01000005|CDS_163171-164376 ABEW01000002|CDS_428054-426849 ABFF01000007|CDS_56293-55088 ABFG01000005|CDS_81153-79948 AE006468|CDS_3135956-3137161 CP001120|CDS_3118595-3119800 CP001138|CDS_3053385-3054590 CP001363|CDS_3155765-3156970 FN424405|CDS_3127966-3129171 NZ_ACBF01000001|CDS_278772-279977 gi|525837126|ref|YP_008253839.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]