SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482905728|ref|YP_007904288.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482905728|ref|YP_007904288.1|
Domain Number 1 Region: 25-393
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.84e-88
Family Cystathionine synthase-like 0.0000000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|482905728|ref|YP_007904288.1|
Sequence length 395
Comment cystathionine beta-lyase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MTDKQLDTKLVNAGRSKKYTLGSVNSVIQRASSLVFDTVEAKKHATRNLANGELFYGRRG
TLTHFSLQEAMCELEGGAGCALFPCGAAAVANTILAFVEQGDHILMTNTAYEPSQDFCSK
ILGKLGVTTSWFDPLIGADITQHIQPNTKVVFLESPGSITMEVHDIPSIVSAVRRVAPEA
VIMIDNTWAAGVLFKALEFDIDISIQAGTKYLIGHSDAMVGTAVANARCWEQLRENAYLM
GQMLDADTAYMTSRGLRTLGVRLRQHQESSLKIAAWLANHPQVARVNHPALPGSKGHAFW
KRDFTGSSGLFSFVLNKKLTEAELSAYLDNFSLFSMAYSWGGYESLIIANQPEQIAAIRP
AGGVDFTGTLVRVHIGLESVDDLIADLAAGFARIV
Download sequence
Identical sequences A0A0D6ID98 A0A0F7JA17 A0A0H3NHX7 A0A0U0WRI3 A0A0U1GGD5 A0A0W4Z412 A0A221Z8R6 A0A2C6FP08 A0A2D3AGE6 A0A2I6NZY2 P18949 Q3YEA9 V1WV36
99287.STM3161 gi|538363759|ref|YP_008507044.1| ABAO01000002|CDS_141090-139903 ABEW01000002|CDS_243807-242620 ABFG01000007|CDS_279321-278134 AE006468|CDS_3320995-3322182 FN424405|CDS_3312236-3313423 gi|526221522|ref|YP_008267365.1| gi|378446512|ref|YP_005234144.1| gi|16766461|ref|NP_462076.1| gi|525836985|ref|YP_008253656.1| NP_462076.1.58477 WP_000130262.1.100010 WP_000130262.1.100115 WP_000130262.1.100165 WP_000130262.1.100234 WP_000130262.1.100266 WP_000130262.1.100288 WP_000130262.1.100376 WP_000130262.1.100413 WP_000130262.1.100424 WP_000130262.1.100436 WP_000130262.1.100484 WP_000130262.1.100488 WP_000130262.1.100521 WP_000130262.1.100597 WP_000130262.1.10076 WP_000130262.1.100781 WP_000130262.1.100793 WP_000130262.1.100869 WP_000130262.1.100870 WP_000130262.1.100871 WP_000130262.1.100882 WP_000130262.1.101007 WP_000130262.1.101020 WP_000130262.1.101074 WP_000130262.1.101078 WP_000130262.1.101091 WP_000130262.1.101123 WP_000130262.1.101180 WP_000130262.1.101223 WP_000130262.1.101259 WP_000130262.1.101284 WP_000130262.1.101291 WP_000130262.1.101353 WP_000130262.1.101386 WP_000130262.1.101404 WP_000130262.1.101420 WP_000130262.1.101589 WP_000130262.1.101612 WP_000130262.1.101707 WP_000130262.1.101724 WP_000130262.1.101734 WP_000130262.1.101741 WP_000130262.1.101878 WP_000130262.1.101953 WP_000130262.1.10220 WP_000130262.1.10237 WP_000130262.1.10266 WP_000130262.1.10439 WP_000130262.1.10463 WP_000130262.1.10678 WP_000130262.1.10720 WP_000130262.1.10753 WP_000130262.1.10992 WP_000130262.1.11024 WP_000130262.1.11031 WP_000130262.1.11098 WP_000130262.1.11168 WP_000130262.1.11190 WP_000130262.1.11254 WP_000130262.1.11295 WP_000130262.1.11362 WP_000130262.1.11405 WP_000130262.1.11455 WP_000130262.1.11458 WP_000130262.1.11518 WP_000130262.1.11532 WP_000130262.1.11543 WP_000130262.1.11544 WP_000130262.1.11565 WP_000130262.1.11763 WP_000130262.1.11772 WP_000130262.1.11875 WP_000130262.1.11897 WP_000130262.1.12114 WP_000130262.1.12160 WP_000130262.1.12244 WP_000130262.1.12280 WP_000130262.1.12351 WP_000130262.1.12370 WP_000130262.1.12397 WP_000130262.1.12546 WP_000130262.1.12584 WP_000130262.1.1264 WP_000130262.1.12728 WP_000130262.1.12879 WP_000130262.1.12936 WP_000130262.1.12995 WP_000130262.1.13027 WP_000130262.1.13106 WP_000130262.1.13130 WP_000130262.1.13414 WP_000130262.1.13446 WP_000130262.1.13488 WP_000130262.1.13509 WP_000130262.1.13669 WP_000130262.1.13741 WP_000130262.1.13819 WP_000130262.1.1387 WP_000130262.1.13908 WP_000130262.1.13932 WP_000130262.1.13968 WP_000130262.1.14001 WP_000130262.1.14151 WP_000130262.1.14239 WP_000130262.1.14286 WP_000130262.1.14320 WP_000130262.1.14379 WP_000130262.1.14406 WP_000130262.1.14410 WP_000130262.1.14466 WP_000130262.1.14505 WP_000130262.1.14516 WP_000130262.1.14524 WP_000130262.1.14554 WP_000130262.1.14706 WP_000130262.1.14725 WP_000130262.1.14789 WP_000130262.1.14852 WP_000130262.1.1489 WP_000130262.1.14932 WP_000130262.1.14936 WP_000130262.1.15055 WP_000130262.1.15079 WP_000130262.1.15102 WP_000130262.1.15124 WP_000130262.1.15223 WP_000130262.1.15226 WP_000130262.1.15316 WP_000130262.1.15369 WP_000130262.1.1540 WP_000130262.1.15508 WP_000130262.1.15644 WP_000130262.1.15784 WP_000130262.1.158 WP_000130262.1.15830 WP_000130262.1.15881 WP_000130262.1.15909 WP_000130262.1.15995 WP_000130262.1.1601 WP_000130262.1.16028 WP_000130262.1.16062 WP_000130262.1.16063 WP_000130262.1.16103 WP_000130262.1.16166 WP_000130262.1.16172 WP_000130262.1.16226 WP_000130262.1.16233 WP_000130262.1.16284 WP_000130262.1.16328 WP_000130262.1.1635 WP_000130262.1.16468 WP_000130262.1.16614 WP_000130262.1.16650 WP_000130262.1.16686 WP_000130262.1.16691 WP_000130262.1.16732 WP_000130262.1.16735 WP_000130262.1.16786 WP_000130262.1.16819 WP_000130262.1.16858 WP_000130262.1.16896 WP_000130262.1.16916 WP_000130262.1.16965 WP_000130262.1.1700 WP_000130262.1.17098 WP_000130262.1.17307 WP_000130262.1.1737 WP_000130262.1.17390 WP_000130262.1.174 WP_000130262.1.17480 WP_000130262.1.17546 WP_000130262.1.17693 WP_000130262.1.17702 WP_000130262.1.17705 WP_000130262.1.17865 WP_000130262.1.18019 WP_000130262.1.1807 WP_000130262.1.18089 WP_000130262.1.18111 WP_000130262.1.18163 WP_000130262.1.18178 WP_000130262.1.18265 WP_000130262.1.18267 WP_000130262.1.18468 WP_000130262.1.18607 WP_000130262.1.18705 WP_000130262.1.18715 WP_000130262.1.18776 WP_000130262.1.18822 WP_000130262.1.18881 WP_000130262.1.18940 WP_000130262.1.18949 WP_000130262.1.19053 WP_000130262.1.19055 WP_000130262.1.19320 WP_000130262.1.19458 WP_000130262.1.19460 WP_000130262.1.19461 WP_000130262.1.19614 WP_000130262.1.19702 WP_000130262.1.19706 WP_000130262.1.19724 WP_000130262.1.19749 WP_000130262.1.19784 WP_000130262.1.19802 WP_000130262.1.19809 WP_000130262.1.19823 WP_000130262.1.19851 WP_000130262.1.19867 WP_000130262.1.1990 WP_000130262.1.1998 WP_000130262.1.20 WP_000130262.1.20034 WP_000130262.1.20089 WP_000130262.1.2010 WP_000130262.1.20119 WP_000130262.1.20212 WP_000130262.1.20266 WP_000130262.1.20271 WP_000130262.1.20362 WP_000130262.1.20418 WP_000130262.1.20443 WP_000130262.1.20503 WP_000130262.1.20525 WP_000130262.1.2054 WP_000130262.1.20553 WP_000130262.1.20573 WP_000130262.1.20626 WP_000130262.1.20646 WP_000130262.1.20721 WP_000130262.1.20839 WP_000130262.1.20886 WP_000130262.1.2101 WP_000130262.1.21049 WP_000130262.1.21086 WP_000130262.1.21146 WP_000130262.1.21165 WP_000130262.1.21245 WP_000130262.1.21246 WP_000130262.1.21269 WP_000130262.1.21400 WP_000130262.1.21404 WP_000130262.1.21497 WP_000130262.1.21499 WP_000130262.1.21603 WP_000130262.1.21750 WP_000130262.1.21751 WP_000130262.1.21757 WP_000130262.1.21825 WP_000130262.1.22019 WP_000130262.1.22024 WP_000130262.1.2205 WP_000130262.1.22062 WP_000130262.1.22067 WP_000130262.1.22117 WP_000130262.1.2221 WP_000130262.1.2224 WP_000130262.1.22315 WP_000130262.1.22337 WP_000130262.1.2235 WP_000130262.1.22379 WP_000130262.1.22427 WP_000130262.1.22453 WP_000130262.1.2246 WP_000130262.1.22485 WP_000130262.1.22575 WP_000130262.1.22582 WP_000130262.1.22604 WP_000130262.1.22620 WP_000130262.1.22845 WP_000130262.1.22870 WP_000130262.1.22979 WP_000130262.1.23010 WP_000130262.1.23102 WP_000130262.1.23114 WP_000130262.1.2314 WP_000130262.1.23148 WP_000130262.1.23192 WP_000130262.1.23259 WP_000130262.1.23460 WP_000130262.1.23466 WP_000130262.1.23472 WP_000130262.1.23482 WP_000130262.1.23485 WP_000130262.1.23503 WP_000130262.1.23513 WP_000130262.1.23587 WP_000130262.1.23621 WP_000130262.1.23629 WP_000130262.1.23634 WP_000130262.1.2364 WP_000130262.1.23643 WP_000130262.1.23685 WP_000130262.1.2376 WP_000130262.1.23932 WP_000130262.1.24017 WP_000130262.1.24158 WP_000130262.1.24206 WP_000130262.1.24308 WP_000130262.1.24325 WP_000130262.1.24392 WP_000130262.1.24567 WP_000130262.1.24578 WP_000130262.1.24737 WP_000130262.1.24873 WP_000130262.1.25008 WP_000130262.1.25015 WP_000130262.1.25036 WP_000130262.1.2525 WP_000130262.1.25405 WP_000130262.1.25454 WP_000130262.1.25493 WP_000130262.1.25498 WP_000130262.1.2554 WP_000130262.1.25564 WP_000130262.1.25668 WP_000130262.1.25690 WP_000130262.1.2570 WP_000130262.1.25700 WP_000130262.1.25740 WP_000130262.1.25793 WP_000130262.1.25814 WP_000130262.1.25988 WP_000130262.1.26030 WP_000130262.1.26093 WP_000130262.1.26123 WP_000130262.1.26129 WP_000130262.1.26224 WP_000130262.1.26282 WP_000130262.1.26311 WP_000130262.1.26319 WP_000130262.1.2634 WP_000130262.1.26429 WP_000130262.1.26440 WP_000130262.1.26493 WP_000130262.1.26567 WP_000130262.1.2660 WP_000130262.1.26646 WP_000130262.1.26709 WP_000130262.1.26856 WP_000130262.1.26980 WP_000130262.1.27010 WP_000130262.1.27173 WP_000130262.1.27206 WP_000130262.1.27255 WP_000130262.1.27279 WP_000130262.1.27342 WP_000130262.1.27423 WP_000130262.1.27513 WP_000130262.1.27522 WP_000130262.1.27523 WP_000130262.1.27556 WP_000130262.1.27561 WP_000130262.1.27616 WP_000130262.1.2763 WP_000130262.1.27665 WP_000130262.1.27707 WP_000130262.1.27761 WP_000130262.1.2777 WP_000130262.1.27857 WP_000130262.1.27977 WP_000130262.1.28094 WP_000130262.1.28170 WP_000130262.1.28235 WP_000130262.1.2825 WP_000130262.1.28301 WP_000130262.1.28302 WP_000130262.1.2835 WP_000130262.1.28370 WP_000130262.1.28538 WP_000130262.1.28575 WP_000130262.1.28625 WP_000130262.1.28655 WP_000130262.1.28694 WP_000130262.1.2879 WP_000130262.1.2890 WP_000130262.1.28938 WP_000130262.1.28946 WP_000130262.1.29006 WP_000130262.1.29010 WP_000130262.1.2910 WP_000130262.1.29130 WP_000130262.1.29190 WP_000130262.1.29454 WP_000130262.1.29588 WP_000130262.1.29601 WP_000130262.1.29606 WP_000130262.1.29615 WP_000130262.1.29619 WP_000130262.1.29704 WP_000130262.1.29774 WP_000130262.1.29923 WP_000130262.1.29924 WP_000130262.1.29969 WP_000130262.1.30006 WP_000130262.1.30027 WP_000130262.1.30086 WP_000130262.1.30179 WP_000130262.1.30180 WP_000130262.1.30246 WP_000130262.1.30356 WP_000130262.1.30469 WP_000130262.1.30505 WP_000130262.1.30507 WP_000130262.1.30535 WP_000130262.1.30547 WP_000130262.1.30573 WP_000130262.1.30794 WP_000130262.1.3080 WP_000130262.1.30833 WP_000130262.1.30835 WP_000130262.1.31 WP_000130262.1.31107 WP_000130262.1.3113 WP_000130262.1.31185 WP_000130262.1.3119 WP_000130262.1.31190 WP_000130262.1.31195 WP_000130262.1.31196 WP_000130262.1.31251 WP_000130262.1.31281 WP_000130262.1.31362 WP_000130262.1.31504 WP_000130262.1.31515 WP_000130262.1.31578 WP_000130262.1.31658 WP_000130262.1.31725 WP_000130262.1.31762 WP_000130262.1.31782 WP_000130262.1.31845 WP_000130262.1.31940 WP_000130262.1.31967 WP_000130262.1.31972 WP_000130262.1.32192 WP_000130262.1.32206 WP_000130262.1.32423 WP_000130262.1.32438 WP_000130262.1.32515 WP_000130262.1.32660 WP_000130262.1.32702 WP_000130262.1.32714 WP_000130262.1.32747 WP_000130262.1.32750 WP_000130262.1.32786 WP_000130262.1.32804 WP_000130262.1.32900 WP_000130262.1.32902 WP_000130262.1.32907 WP_000130262.1.32961 WP_000130262.1.33030 WP_000130262.1.33078 WP_000130262.1.33127 WP_000130262.1.33143 WP_000130262.1.33248 WP_000130262.1.33261 WP_000130262.1.333 WP_000130262.1.33392 WP_000130262.1.33492 WP_000130262.1.33499 WP_000130262.1.33553 WP_000130262.1.33592 WP_000130262.1.33609 WP_000130262.1.33629 WP_000130262.1.33825 WP_000130262.1.33894 WP_000130262.1.34043 WP_000130262.1.34075 WP_000130262.1.34126 WP_000130262.1.34257 WP_000130262.1.34259 WP_000130262.1.34279 WP_000130262.1.34330 WP_000130262.1.34453 WP_000130262.1.34610 WP_000130262.1.34667 WP_000130262.1.34856 WP_000130262.1.34975 WP_000130262.1.35045 WP_000130262.1.35129 WP_000130262.1.35184 WP_000130262.1.35404 WP_000130262.1.35408 WP_000130262.1.35425 WP_000130262.1.35446 WP_000130262.1.35460 WP_000130262.1.35463 WP_000130262.1.35503 WP_000130262.1.35509 WP_000130262.1.35590 WP_000130262.1.35648 WP_000130262.1.3566 WP_000130262.1.35777 WP_000130262.1.35940 WP_000130262.1.36003 WP_000130262.1.3601 WP_000130262.1.36011 WP_000130262.1.36232 WP_000130262.1.36542 WP_000130262.1.36609 WP_000130262.1.36690 WP_000130262.1.3670 WP_000130262.1.36705 WP_000130262.1.36918 WP_000130262.1.36931 WP_000130262.1.36949 WP_000130262.1.36978 WP_000130262.1.37013 WP_000130262.1.37063 WP_000130262.1.37073 WP_000130262.1.37111 WP_000130262.1.37112 WP_000130262.1.37256 WP_000130262.1.37293 WP_000130262.1.37320 WP_000130262.1.37370 WP_000130262.1.37376 WP_000130262.1.3744 WP_000130262.1.37498 WP_000130262.1.37504 WP_000130262.1.37618 WP_000130262.1.37848 WP_000130262.1.37968 WP_000130262.1.37978 WP_000130262.1.38001 WP_000130262.1.38125 WP_000130262.1.38145 WP_000130262.1.383 WP_000130262.1.38341 WP_000130262.1.38408 WP_000130262.1.3848 WP_000130262.1.38613 WP_000130262.1.38673 WP_000130262.1.38693 WP_000130262.1.38740 WP_000130262.1.38773 WP_000130262.1.38881 WP_000130262.1.38882 WP_000130262.1.38895 WP_000130262.1.38913 WP_000130262.1.39003 WP_000130262.1.39113 WP_000130262.1.39136 WP_000130262.1.39197 WP_000130262.1.39229 WP_000130262.1.39385 WP_000130262.1.39405 WP_000130262.1.39420 WP_000130262.1.39449 WP_000130262.1.39466 WP_000130262.1.39471 WP_000130262.1.39497 WP_000130262.1.39512 WP_000130262.1.39576 WP_000130262.1.39629 WP_000130262.1.39722 WP_000130262.1.39723 WP_000130262.1.39763 WP_000130262.1.39862 WP_000130262.1.39921 WP_000130262.1.39923 WP_000130262.1.40017 WP_000130262.1.40072 WP_000130262.1.40073 WP_000130262.1.4011 WP_000130262.1.40155 WP_000130262.1.40171 WP_000130262.1.40208 WP_000130262.1.40240 WP_000130262.1.40257 WP_000130262.1.40292 WP_000130262.1.40305 WP_000130262.1.40311 WP_000130262.1.40380 WP_000130262.1.40395 WP_000130262.1.40465 WP_000130262.1.40508 WP_000130262.1.40528 WP_000130262.1.40648 WP_000130262.1.40710 WP_000130262.1.4075 WP_000130262.1.40771 WP_000130262.1.4087 WP_000130262.1.40877 WP_000130262.1.40979 WP_000130262.1.41017 WP_000130262.1.41086 WP_000130262.1.41091 WP_000130262.1.41225 WP_000130262.1.41226 WP_000130262.1.41279 WP_000130262.1.41310 WP_000130262.1.41345 WP_000130262.1.41375 WP_000130262.1.41438 WP_000130262.1.41440 WP_000130262.1.41516 WP_000130262.1.41554 WP_000130262.1.41572 WP_000130262.1.41591 WP_000130262.1.41662 WP_000130262.1.41708 WP_000130262.1.41761 WP_000130262.1.41789 WP_000130262.1.41882 WP_000130262.1.41979 WP_000130262.1.41985 WP_000130262.1.41998 WP_000130262.1.42009 WP_000130262.1.42104 WP_000130262.1.42238 WP_000130262.1.42248 WP_000130262.1.42320 WP_000130262.1.42342 WP_000130262.1.4239 WP_000130262.1.42422 WP_000130262.1.42605 WP_000130262.1.42707 WP_000130262.1.4276 WP_000130262.1.42767 WP_000130262.1.42864 WP_000130262.1.4288 WP_000130262.1.4289 WP_000130262.1.42923 WP_000130262.1.42957 WP_000130262.1.43018 WP_000130262.1.43041 WP_000130262.1.43160 WP_000130262.1.43244 WP_000130262.1.43334 WP_000130262.1.43437 WP_000130262.1.43438 WP_000130262.1.43476 WP_000130262.1.43522 WP_000130262.1.43613 WP_000130262.1.43668 WP_000130262.1.43710 WP_000130262.1.43886 WP_000130262.1.44005 WP_000130262.1.4404 WP_000130262.1.44043 WP_000130262.1.44099 WP_000130262.1.44121 WP_000130262.1.44291 WP_000130262.1.44310 WP_000130262.1.44386 WP_000130262.1.44438 WP_000130262.1.44443 WP_000130262.1.44479 WP_000130262.1.44593 WP_000130262.1.44607 WP_000130262.1.44633 WP_000130262.1.44640 WP_000130262.1.4467 WP_000130262.1.44678 WP_000130262.1.44702 WP_000130262.1.44747 WP_000130262.1.44791 WP_000130262.1.44833 WP_000130262.1.4485 WP_000130262.1.44877 WP_000130262.1.44927 WP_000130262.1.44950 WP_000130262.1.45027 WP_000130262.1.45067 WP_000130262.1.45074 WP_000130262.1.45079 WP_000130262.1.45098 WP_000130262.1.45138 WP_000130262.1.45177 WP_000130262.1.45184 WP_000130262.1.45259 WP_000130262.1.45349 WP_000130262.1.45351 WP_000130262.1.45365 WP_000130262.1.45550 WP_000130262.1.45585 WP_000130262.1.45660 WP_000130262.1.45690 WP_000130262.1.458 WP_000130262.1.46011 WP_000130262.1.46028 WP_000130262.1.46069 WP_000130262.1.46091 WP_000130262.1.46112 WP_000130262.1.46173 WP_000130262.1.46174 WP_000130262.1.46187 WP_000130262.1.46286 WP_000130262.1.46303 WP_000130262.1.46322 WP_000130262.1.46406 WP_000130262.1.46444 WP_000130262.1.46574 WP_000130262.1.46595 WP_000130262.1.46666 WP_000130262.1.46675 WP_000130262.1.46693 WP_000130262.1.4671 WP_000130262.1.46732 WP_000130262.1.46749 WP_000130262.1.47057 WP_000130262.1.47067 WP_000130262.1.47214 WP_000130262.1.47429 WP_000130262.1.47448 WP_000130262.1.4747 WP_000130262.1.47472 WP_000130262.1.47478 WP_000130262.1.47621 WP_000130262.1.47649 WP_000130262.1.4769 WP_000130262.1.47714 WP_000130262.1.47799 WP_000130262.1.47814 WP_000130262.1.47817 WP_000130262.1.47849 WP_000130262.1.47902 WP_000130262.1.47928 WP_000130262.1.47992 WP_000130262.1.48209 WP_000130262.1.48242 WP_000130262.1.48244 WP_000130262.1.48253 WP_000130262.1.483 WP_000130262.1.48367 WP_000130262.1.48377 WP_000130262.1.48399 WP_000130262.1.48493 WP_000130262.1.4853 WP_000130262.1.48570 WP_000130262.1.48755 WP_000130262.1.48788 WP_000130262.1.4885 WP_000130262.1.48876 WP_000130262.1.48886 WP_000130262.1.48894 WP_000130262.1.48896 WP_000130262.1.48919 WP_000130262.1.48985 WP_000130262.1.49084 WP_000130262.1.49155 WP_000130262.1.49204 WP_000130262.1.49239 WP_000130262.1.49256 WP_000130262.1.49276 WP_000130262.1.49290 WP_000130262.1.49304 WP_000130262.1.49340 WP_000130262.1.49366 WP_000130262.1.49472 WP_000130262.1.49490 WP_000130262.1.49515 WP_000130262.1.49572 WP_000130262.1.49595 WP_000130262.1.49630 WP_000130262.1.4979 WP_000130262.1.49803 WP_000130262.1.49805 WP_000130262.1.49929 WP_000130262.1.50003 WP_000130262.1.50080 WP_000130262.1.50161 WP_000130262.1.50211 WP_000130262.1.50374 WP_000130262.1.50376 WP_000130262.1.50389 WP_000130262.1.50469 WP_000130262.1.50563 WP_000130262.1.5058 WP_000130262.1.50676 WP_000130262.1.50800 WP_000130262.1.50804 WP_000130262.1.50808 WP_000130262.1.5088 WP_000130262.1.50908 WP_000130262.1.50941 WP_000130262.1.51014 WP_000130262.1.51022 WP_000130262.1.51131 WP_000130262.1.51179 WP_000130262.1.51182 WP_000130262.1.51186 WP_000130262.1.51285 WP_000130262.1.51308 WP_000130262.1.5138 WP_000130262.1.51394 WP_000130262.1.51414 WP_000130262.1.51487 WP_000130262.1.51488 WP_000130262.1.51514 WP_000130262.1.51613 WP_000130262.1.51634 WP_000130262.1.51649 WP_000130262.1.51686 WP_000130262.1.51700 WP_000130262.1.51756 WP_000130262.1.51911 WP_000130262.1.51932 WP_000130262.1.51989 WP_000130262.1.52121 WP_000130262.1.52161 WP_000130262.1.52346 WP_000130262.1.52353 WP_000130262.1.52361 WP_000130262.1.52438 WP_000130262.1.52446 WP_000130262.1.52528 WP_000130262.1.52637 WP_000130262.1.52653 WP_000130262.1.52656 WP_000130262.1.52738 WP_000130262.1.52743 WP_000130262.1.52857 WP_000130262.1.52898 WP_000130262.1.52915 WP_000130262.1.53190 WP_000130262.1.53466 WP_000130262.1.53529 WP_000130262.1.53534 WP_000130262.1.53543 WP_000130262.1.53675 WP_000130262.1.53696 WP_000130262.1.53757 WP_000130262.1.53772 WP_000130262.1.53790 WP_000130262.1.53812 WP_000130262.1.53935 WP_000130262.1.54033 WP_000130262.1.54075 WP_000130262.1.54085 WP_000130262.1.54196 WP_000130262.1.54209 WP_000130262.1.54271 WP_000130262.1.54274 WP_000130262.1.54319 WP_000130262.1.54324 WP_000130262.1.54364 WP_000130262.1.54400 WP_000130262.1.54569 WP_000130262.1.54644 WP_000130262.1.54662 WP_000130262.1.54694 WP_000130262.1.54722 WP_000130262.1.54749 WP_000130262.1.54764 WP_000130262.1.54774 WP_000130262.1.5485 WP_000130262.1.55008 WP_000130262.1.55152 WP_000130262.1.55156 WP_000130262.1.55223 WP_000130262.1.5523 WP_000130262.1.55285 WP_000130262.1.55294 WP_000130262.1.55418 WP_000130262.1.55475 WP_000130262.1.5552 WP_000130262.1.55528 WP_000130262.1.55545 WP_000130262.1.5555 WP_000130262.1.55647 WP_000130262.1.55743 WP_000130262.1.55768 WP_000130262.1.55782 WP_000130262.1.55796 WP_000130262.1.55995 WP_000130262.1.56002 WP_000130262.1.56059 WP_000130262.1.56105 WP_000130262.1.56238 WP_000130262.1.56286 WP_000130262.1.56304 WP_000130262.1.5633 WP_000130262.1.56368 WP_000130262.1.56389 WP_000130262.1.56396 WP_000130262.1.56414 WP_000130262.1.56438 WP_000130262.1.56512 WP_000130262.1.56560 WP_000130262.1.56601 WP_000130262.1.56614 WP_000130262.1.56651 WP_000130262.1.56671 WP_000130262.1.56682 WP_000130262.1.56824 WP_000130262.1.56853 WP_000130262.1.56875 WP_000130262.1.56877 WP_000130262.1.56893 WP_000130262.1.56905 WP_000130262.1.57168 WP_000130262.1.57187 WP_000130262.1.57307 WP_000130262.1.57377 WP_000130262.1.57418 WP_000130262.1.57433 WP_000130262.1.57515 WP_000130262.1.57529 WP_000130262.1.57555 WP_000130262.1.57576 WP_000130262.1.57601 WP_000130262.1.57607 WP_000130262.1.57763 WP_000130262.1.57797 WP_000130262.1.57862 WP_000130262.1.57890 WP_000130262.1.57978 WP_000130262.1.5801 WP_000130262.1.58040 WP_000130262.1.58041 WP_000130262.1.58144 WP_000130262.1.58157 WP_000130262.1.58418 WP_000130262.1.58442 WP_000130262.1.58548 WP_000130262.1.58564 WP_000130262.1.5858 WP_000130262.1.58604 WP_000130262.1.58662 WP_000130262.1.58669 WP_000130262.1.58744 WP_000130262.1.58745 WP_000130262.1.58803 WP_000130262.1.58836 WP_000130262.1.5886 WP_000130262.1.58861 WP_000130262.1.59094 WP_000130262.1.59097 WP_000130262.1.59136 WP_000130262.1.59224 WP_000130262.1.59294 WP_000130262.1.59336 WP_000130262.1.59375 WP_000130262.1.59381 WP_000130262.1.59458 WP_000130262.1.59490 WP_000130262.1.59508 WP_000130262.1.59512 WP_000130262.1.59641 WP_000130262.1.59684 WP_000130262.1.59694 WP_000130262.1.59771 WP_000130262.1.5979 WP_000130262.1.59830 WP_000130262.1.59953 WP_000130262.1.60008 WP_000130262.1.60015 WP_000130262.1.60021 WP_000130262.1.60052 WP_000130262.1.60069 WP_000130262.1.60140 WP_000130262.1.60155 WP_000130262.1.60285 WP_000130262.1.60370 WP_000130262.1.60379 WP_000130262.1.60464 WP_000130262.1.60597 WP_000130262.1.60608 WP_000130262.1.60794 WP_000130262.1.60874 WP_000130262.1.60919 WP_000130262.1.60941 WP_000130262.1.61078 WP_000130262.1.6108 WP_000130262.1.6114 WP_000130262.1.61218 WP_000130262.1.61232 WP_000130262.1.6129 WP_000130262.1.61296 WP_000130262.1.61345 WP_000130262.1.61417 WP_000130262.1.61509 WP_000130262.1.61519 WP_000130262.1.61574 WP_000130262.1.6164 WP_000130262.1.61662 WP_000130262.1.61712 WP_000130262.1.61714 WP_000130262.1.61730 WP_000130262.1.61783 WP_000130262.1.61857 WP_000130262.1.61918 WP_000130262.1.61952 WP_000130262.1.62007 WP_000130262.1.62025 WP_000130262.1.62204 WP_000130262.1.62222 WP_000130262.1.62304 WP_000130262.1.62364 WP_000130262.1.62374 WP_000130262.1.62403 WP_000130262.1.6253 WP_000130262.1.62564 WP_000130262.1.62853 WP_000130262.1.62903 WP_000130262.1.62910 WP_000130262.1.62955 WP_000130262.1.63181 WP_000130262.1.63203 WP_000130262.1.63243 WP_000130262.1.63250 WP_000130262.1.63256 WP_000130262.1.63290 WP_000130262.1.63382 WP_000130262.1.63461 WP_000130262.1.63479 WP_000130262.1.63568 WP_000130262.1.63577 WP_000130262.1.63664 WP_000130262.1.63718 WP_000130262.1.63731 WP_000130262.1.6375 WP_000130262.1.63757 WP_000130262.1.63831 WP_000130262.1.63834 WP_000130262.1.63934 WP_000130262.1.64007 WP_000130262.1.64046 WP_000130262.1.64072 WP_000130262.1.6423 WP_000130262.1.64244 WP_000130262.1.6437 WP_000130262.1.64403 WP_000130262.1.64645 WP_000130262.1.64649 WP_000130262.1.64674 WP_000130262.1.64702 WP_000130262.1.64757 WP_000130262.1.64781 WP_000130262.1.64831 WP_000130262.1.6489 WP_000130262.1.64919 WP_000130262.1.64977 WP_000130262.1.65016 WP_000130262.1.65018 WP_000130262.1.65027 WP_000130262.1.65028 WP_000130262.1.65168 WP_000130262.1.65171 WP_000130262.1.65185 WP_000130262.1.65248 WP_000130262.1.65474 WP_000130262.1.65508 WP_000130262.1.65633 WP_000130262.1.6565 WP_000130262.1.65696 WP_000130262.1.6572 WP_000130262.1.6575 WP_000130262.1.65782 WP_000130262.1.65795 WP_000130262.1.65876 WP_000130262.1.66129 WP_000130262.1.66235 WP_000130262.1.66272 WP_000130262.1.6630 WP_000130262.1.66314 WP_000130262.1.66358 WP_000130262.1.66362 WP_000130262.1.66365 WP_000130262.1.6638 WP_000130262.1.6640 WP_000130262.1.66600 WP_000130262.1.66630 WP_000130262.1.66698 WP_000130262.1.6680 WP_000130262.1.66834 WP_000130262.1.66876 WP_000130262.1.66901 WP_000130262.1.66962 WP_000130262.1.67037 WP_000130262.1.67045 WP_000130262.1.67181 WP_000130262.1.67268 WP_000130262.1.67288 WP_000130262.1.67347 WP_000130262.1.67465 WP_000130262.1.67682 WP_000130262.1.67829 WP_000130262.1.67887 WP_000130262.1.67924 WP_000130262.1.67977 WP_000130262.1.68073 WP_000130262.1.68201 WP_000130262.1.68206 WP_000130262.1.68210 WP_000130262.1.6827 WP_000130262.1.68275 WP_000130262.1.6833 WP_000130262.1.6849 WP_000130262.1.68532 WP_000130262.1.68547 WP_000130262.1.6857 WP_000130262.1.68589 WP_000130262.1.68591 WP_000130262.1.68655 WP_000130262.1.68656 WP_000130262.1.68658 WP_000130262.1.68690 WP_000130262.1.68778 WP_000130262.1.68787 WP_000130262.1.6882 WP_000130262.1.68894 WP_000130262.1.68928 WP_000130262.1.68958 WP_000130262.1.68966 WP_000130262.1.68975 WP_000130262.1.69006 WP_000130262.1.69029 WP_000130262.1.6913 WP_000130262.1.69146 WP_000130262.1.69255 WP_000130262.1.69320 WP_000130262.1.69346 WP_000130262.1.69397 WP_000130262.1.69515 WP_000130262.1.69564 WP_000130262.1.69636 WP_000130262.1.69644 WP_000130262.1.69704 WP_000130262.1.69754 WP_000130262.1.69785 WP_000130262.1.69787 WP_000130262.1.69807 WP_000130262.1.69977 WP_000130262.1.70028 WP_000130262.1.7021 WP_000130262.1.70241 WP_000130262.1.70248 WP_000130262.1.70269 WP_000130262.1.70289 WP_000130262.1.70321 WP_000130262.1.70447 WP_000130262.1.70485 WP_000130262.1.70643 WP_000130262.1.70683 WP_000130262.1.70732 WP_000130262.1.70883 WP_000130262.1.70922 WP_000130262.1.70948 WP_000130262.1.7110 WP_000130262.1.71116 WP_000130262.1.71146 WP_000130262.1.71165 WP_000130262.1.71171 WP_000130262.1.71188 WP_000130262.1.71202 WP_000130262.1.71243 WP_000130262.1.71306 WP_000130262.1.71337 WP_000130262.1.71368 WP_000130262.1.71378 WP_000130262.1.71401 WP_000130262.1.71446 WP_000130262.1.71481 WP_000130262.1.71702 WP_000130262.1.7174 WP_000130262.1.71750 WP_000130262.1.71756 WP_000130262.1.71845 WP_000130262.1.71881 WP_000130262.1.71908 WP_000130262.1.71929 WP_000130262.1.71952 WP_000130262.1.71973 WP_000130262.1.72068 WP_000130262.1.72105 WP_000130262.1.72107 WP_000130262.1.72119 WP_000130262.1.72203 WP_000130262.1.72226 WP_000130262.1.72234 WP_000130262.1.72351 WP_000130262.1.72376 WP_000130262.1.72382 WP_000130262.1.72594 WP_000130262.1.72629 WP_000130262.1.72689 WP_000130262.1.72827 WP_000130262.1.72850 WP_000130262.1.72871 WP_000130262.1.72887 WP_000130262.1.72892 WP_000130262.1.72897 WP_000130262.1.72975 WP_000130262.1.7315 WP_000130262.1.73200 WP_000130262.1.7334 WP_000130262.1.73377 WP_000130262.1.73481 WP_000130262.1.7356 WP_000130262.1.73581 WP_000130262.1.73617 WP_000130262.1.73669 WP_000130262.1.73753 WP_000130262.1.73758 WP_000130262.1.73794 WP_000130262.1.73804 WP_000130262.1.73831 WP_000130262.1.7386 WP_000130262.1.7387 WP_000130262.1.73924 WP_000130262.1.73956 WP_000130262.1.74029 WP_000130262.1.74117 WP_000130262.1.74181 WP_000130262.1.74191 WP_000130262.1.7433 WP_000130262.1.74379 WP_000130262.1.74410 WP_000130262.1.74414 WP_000130262.1.74418 WP_000130262.1.74422 WP_000130262.1.74466 WP_000130262.1.74481 WP_000130262.1.74529 WP_000130262.1.74545 WP_000130262.1.74639 WP_000130262.1.74745 WP_000130262.1.74992 WP_000130262.1.75129 WP_000130262.1.75180 WP_000130262.1.75187 WP_000130262.1.75288 WP_000130262.1.75334 WP_000130262.1.75362 WP_000130262.1.75385 WP_000130262.1.75392 WP_000130262.1.75402 WP_000130262.1.75703 WP_000130262.1.75760 WP_000130262.1.75764 WP_000130262.1.75828 WP_000130262.1.75837 WP_000130262.1.75873 WP_000130262.1.75874 WP_000130262.1.75884 WP_000130262.1.75945 WP_000130262.1.75957 WP_000130262.1.76020 WP_000130262.1.76024 WP_000130262.1.76097 WP_000130262.1.76252 WP_000130262.1.76301 WP_000130262.1.76364 WP_000130262.1.76445 WP_000130262.1.7660 WP_000130262.1.76673 WP_000130262.1.76706 WP_000130262.1.76721 WP_000130262.1.76724 WP_000130262.1.76738 WP_000130262.1.76756 WP_000130262.1.76760 WP_000130262.1.76806 WP_000130262.1.76866 WP_000130262.1.76875 WP_000130262.1.76880 WP_000130262.1.76899 WP_000130262.1.77017 WP_000130262.1.77038 WP_000130262.1.77047 WP_000130262.1.77080 WP_000130262.1.7712 WP_000130262.1.77180 WP_000130262.1.77244 WP_000130262.1.77271 WP_000130262.1.77292 WP_000130262.1.77349 WP_000130262.1.77436 WP_000130262.1.77514 WP_000130262.1.77529 WP_000130262.1.77549 WP_000130262.1.77653 WP_000130262.1.77692 WP_000130262.1.77754 WP_000130262.1.7782 WP_000130262.1.77851 WP_000130262.1.77871 WP_000130262.1.77898 WP_000130262.1.77918 WP_000130262.1.77960 WP_000130262.1.78 WP_000130262.1.78033 WP_000130262.1.78076 WP_000130262.1.78096 WP_000130262.1.78100 WP_000130262.1.78110 WP_000130262.1.78120 WP_000130262.1.78201 WP_000130262.1.78245 WP_000130262.1.78383 WP_000130262.1.78407 WP_000130262.1.78495 WP_000130262.1.78496 WP_000130262.1.7861 WP_000130262.1.78618 WP_000130262.1.78673 WP_000130262.1.78735 WP_000130262.1.78802 WP_000130262.1.78830 WP_000130262.1.78835 WP_000130262.1.78862 WP_000130262.1.78871 WP_000130262.1.78874 WP_000130262.1.7891 WP_000130262.1.78918 WP_000130262.1.78930 WP_000130262.1.79032 WP_000130262.1.79151 WP_000130262.1.79167 WP_000130262.1.79297 WP_000130262.1.79302 WP_000130262.1.79335 WP_000130262.1.794 WP_000130262.1.79462 WP_000130262.1.79472 WP_000130262.1.79495 WP_000130262.1.79529 WP_000130262.1.79570 WP_000130262.1.7964 WP_000130262.1.79642 WP_000130262.1.79645 WP_000130262.1.79659 WP_000130262.1.79668 WP_000130262.1.79708 WP_000130262.1.79738 WP_000130262.1.79832 WP_000130262.1.79845 WP_000130262.1.79914 WP_000130262.1.7994 WP_000130262.1.79951 WP_000130262.1.79966 WP_000130262.1.79996 WP_000130262.1.80077 WP_000130262.1.80137 WP_000130262.1.80182 WP_000130262.1.80250 WP_000130262.1.80296 WP_000130262.1.80366 WP_000130262.1.80448 WP_000130262.1.80479 WP_000130262.1.80529 WP_000130262.1.80586 WP_000130262.1.80629 WP_000130262.1.80667 WP_000130262.1.80674 WP_000130262.1.80750 WP_000130262.1.80757 WP_000130262.1.80780 WP_000130262.1.80831 WP_000130262.1.80850 WP_000130262.1.80857 WP_000130262.1.80881 WP_000130262.1.80939 WP_000130262.1.8096 WP_000130262.1.80973 WP_000130262.1.81037 WP_000130262.1.81069 WP_000130262.1.81149 WP_000130262.1.81175 WP_000130262.1.8119 WP_000130262.1.81193 WP_000130262.1.81275 WP_000130262.1.81302 WP_000130262.1.81321 WP_000130262.1.81354 WP_000130262.1.81404 WP_000130262.1.81425 WP_000130262.1.81750 WP_000130262.1.81785 WP_000130262.1.81902 WP_000130262.1.81941 WP_000130262.1.81974 WP_000130262.1.81977 WP_000130262.1.82099 WP_000130262.1.82337 WP_000130262.1.82479 WP_000130262.1.82503 WP_000130262.1.82515 WP_000130262.1.82570 WP_000130262.1.82584 WP_000130262.1.82648 WP_000130262.1.82761 WP_000130262.1.8282 WP_000130262.1.82841 WP_000130262.1.82937 WP_000130262.1.82944 WP_000130262.1.82956 WP_000130262.1.82964 WP_000130262.1.83092 WP_000130262.1.83119 WP_000130262.1.83163 WP_000130262.1.8322 WP_000130262.1.83305 WP_000130262.1.83413 WP_000130262.1.83491 WP_000130262.1.83516 WP_000130262.1.83523 WP_000130262.1.8354 WP_000130262.1.83650 WP_000130262.1.83651 WP_000130262.1.83721 WP_000130262.1.83759 WP_000130262.1.83760 WP_000130262.1.83854 WP_000130262.1.83897 WP_000130262.1.83979 WP_000130262.1.83995 WP_000130262.1.84077 WP_000130262.1.84103 WP_000130262.1.84283 WP_000130262.1.84355 WP_000130262.1.84373 WP_000130262.1.84392 WP_000130262.1.8441 WP_000130262.1.84459 WP_000130262.1.84532 WP_000130262.1.84554 WP_000130262.1.84644 WP_000130262.1.84659 WP_000130262.1.84683 WP_000130262.1.84899 WP_000130262.1.8497 WP_000130262.1.85040 WP_000130262.1.85134 WP_000130262.1.85178 WP_000130262.1.85180 WP_000130262.1.85190 WP_000130262.1.8533 WP_000130262.1.8537 WP_000130262.1.8545 WP_000130262.1.85456 WP_000130262.1.85481 WP_000130262.1.85483 WP_000130262.1.85541 WP_000130262.1.8556 WP_000130262.1.85615 WP_000130262.1.85617 WP_000130262.1.85663 WP_000130262.1.85671 WP_000130262.1.85672 WP_000130262.1.85723 WP_000130262.1.85742 WP_000130262.1.85777 WP_000130262.1.85780 WP_000130262.1.85886 WP_000130262.1.85900 WP_000130262.1.85904 WP_000130262.1.85976 WP_000130262.1.86010 WP_000130262.1.86224 WP_000130262.1.86285 WP_000130262.1.86306 WP_000130262.1.86335 WP_000130262.1.86356 WP_000130262.1.86389 WP_000130262.1.86450 WP_000130262.1.86453 WP_000130262.1.86469 WP_000130262.1.86580 WP_000130262.1.86588 WP_000130262.1.86593 WP_000130262.1.86601 WP_000130262.1.86661 WP_000130262.1.8672 WP_000130262.1.8678 WP_000130262.1.86807 WP_000130262.1.86810 WP_000130262.1.8684 WP_000130262.1.86860 WP_000130262.1.86895 WP_000130262.1.86906 WP_000130262.1.87051 WP_000130262.1.87095 WP_000130262.1.87143 WP_000130262.1.87283 WP_000130262.1.87323 WP_000130262.1.8736 WP_000130262.1.87365 WP_000130262.1.87460 WP_000130262.1.87552 WP_000130262.1.87779 WP_000130262.1.87875 WP_000130262.1.87945 WP_000130262.1.88014 WP_000130262.1.88019 WP_000130262.1.88073 WP_000130262.1.8809 WP_000130262.1.88291 WP_000130262.1.88293 WP_000130262.1.88303 WP_000130262.1.8837 WP_000130262.1.88393 WP_000130262.1.8849 WP_000130262.1.88651 WP_000130262.1.88698 WP_000130262.1.88703 WP_000130262.1.88792 WP_000130262.1.88902 WP_000130262.1.8891 WP_000130262.1.88967 WP_000130262.1.88981 WP_000130262.1.89008 WP_000130262.1.89116 WP_000130262.1.89138 WP_000130262.1.89304 WP_000130262.1.89452 WP_000130262.1.89512 WP_000130262.1.89527 WP_000130262.1.89570 WP_000130262.1.89604 WP_000130262.1.89622 WP_000130262.1.89632 WP_000130262.1.89659 WP_000130262.1.89789 WP_000130262.1.89870 WP_000130262.1.89902 WP_000130262.1.8996 WP_000130262.1.89965 WP_000130262.1.90097 WP_000130262.1.90193 WP_000130262.1.90252 WP_000130262.1.90417 WP_000130262.1.90440 WP_000130262.1.90453 WP_000130262.1.90458 WP_000130262.1.90472 WP_000130262.1.90557 WP_000130262.1.90585 WP_000130262.1.9064 WP_000130262.1.90641 WP_000130262.1.90734 WP_000130262.1.90814 WP_000130262.1.90866 WP_000130262.1.9093 WP_000130262.1.90984 WP_000130262.1.91003 WP_000130262.1.91069 WP_000130262.1.91156 WP_000130262.1.91189 WP_000130262.1.91278 WP_000130262.1.91470 WP_000130262.1.91512 WP_000130262.1.91524 WP_000130262.1.91564 WP_000130262.1.91580 WP_000130262.1.91628 WP_000130262.1.91655 WP_000130262.1.91724 WP_000130262.1.91732 WP_000130262.1.91788 WP_000130262.1.91903 WP_000130262.1.92013 WP_000130262.1.92067 WP_000130262.1.92093 WP_000130262.1.92108 WP_000130262.1.92122 WP_000130262.1.92183 WP_000130262.1.92208 WP_000130262.1.92268 WP_000130262.1.92310 WP_000130262.1.92408 WP_000130262.1.92443 WP_000130262.1.92482 WP_000130262.1.92531 WP_000130262.1.92669 WP_000130262.1.92671 WP_000130262.1.92729 WP_000130262.1.92738 WP_000130262.1.92832 WP_000130262.1.92975 WP_000130262.1.93086 WP_000130262.1.93101 WP_000130262.1.93136 WP_000130262.1.93155 WP_000130262.1.93365 WP_000130262.1.93543 WP_000130262.1.93650 WP_000130262.1.93656 WP_000130262.1.93662 WP_000130262.1.93691 WP_000130262.1.937 WP_000130262.1.93705 WP_000130262.1.93741 WP_000130262.1.93761 WP_000130262.1.93804 WP_000130262.1.9389 WP_000130262.1.93986 WP_000130262.1.93994 WP_000130262.1.94039 WP_000130262.1.94072 WP_000130262.1.94162 WP_000130262.1.94168 WP_000130262.1.94181 WP_000130262.1.94198 WP_000130262.1.9432 WP_000130262.1.94354 WP_000130262.1.94380 WP_000130262.1.94458 WP_000130262.1.94565 WP_000130262.1.94584 WP_000130262.1.94622 WP_000130262.1.94669 WP_000130262.1.94674 WP_000130262.1.94785 WP_000130262.1.94796 WP_000130262.1.9481 WP_000130262.1.94959 WP_000130262.1.94967 WP_000130262.1.94982 WP_000130262.1.94987 WP_000130262.1.95051 WP_000130262.1.95085 WP_000130262.1.95121 WP_000130262.1.95249 WP_000130262.1.95282 WP_000130262.1.95320 WP_000130262.1.95546 WP_000130262.1.95703 WP_000130262.1.95840 WP_000130262.1.95911 WP_000130262.1.9609 WP_000130262.1.96139 WP_000130262.1.96172 WP_000130262.1.96206 WP_000130262.1.96260 WP_000130262.1.96317 WP_000130262.1.96335 WP_000130262.1.96343 WP_000130262.1.9644 WP_000130262.1.96469 WP_000130262.1.96500 WP_000130262.1.96555 WP_000130262.1.96563 WP_000130262.1.96600 WP_000130262.1.96732 WP_000130262.1.96771 WP_000130262.1.96902 WP_000130262.1.97015 WP_000130262.1.97043 WP_000130262.1.97109 WP_000130262.1.97145 WP_000130262.1.97190 WP_000130262.1.97224 WP_000130262.1.97318 WP_000130262.1.97369 WP_000130262.1.97480 WP_000130262.1.97594 WP_000130262.1.97597 WP_000130262.1.97613 WP_000130262.1.97620 WP_000130262.1.97626 WP_000130262.1.97640 WP_000130262.1.97691 WP_000130262.1.97726 WP_000130262.1.97727 WP_000130262.1.97732 WP_000130262.1.97736 WP_000130262.1.9775 WP_000130262.1.97846 WP_000130262.1.97873 WP_000130262.1.98006 WP_000130262.1.98019 WP_000130262.1.98022 WP_000130262.1.98110 WP_000130262.1.98124 WP_000130262.1.98146 WP_000130262.1.98219 WP_000130262.1.9841 WP_000130262.1.98446 WP_000130262.1.98495 WP_000130262.1.98531 WP_000130262.1.98551 WP_000130262.1.98577 WP_000130262.1.98627 WP_000130262.1.98634 WP_000130262.1.98676 WP_000130262.1.98677 WP_000130262.1.98760 WP_000130262.1.98779 WP_000130262.1.98843 WP_000130262.1.98899 WP_000130262.1.98947 WP_000130262.1.9898 WP_000130262.1.99040 WP_000130262.1.99072 WP_000130262.1.99098 WP_000130262.1.99184 WP_000130262.1.99267 WP_000130262.1.99276 WP_000130262.1.99561 WP_000130262.1.99646 WP_000130262.1.99657 WP_000130262.1.99660 WP_000130262.1.99712 WP_000130262.1.99725 WP_000130262.1.99813 WP_000130262.1.99858 WP_000130262.1.99889 WP_000130262.1.99958 gi|378990479|ref|YP_005253643.1| gi|378985756|ref|YP_005248912.1| gi|550902521|ref|YP_008671613.1| gi|549725724|ref|YP_008645914.1| gi|482905728|ref|YP_007904288.1| gi|525946117|ref|YP_008307170.1| gi|549480545|ref|YP_008614809.1| gi|378701067|ref|YP_005183024.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]