SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482906035|ref|YP_007904595.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482906035|ref|YP_007904595.1|
Domain Number 1 Region: 19-401
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.78e-126
Family GABA-aminotransferase-like 0.000000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|482906035|ref|YP_007904595.1|
Sequence length 405
Comment bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MATEQTAITRATFDEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCH
PALVEALKSQGETLWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLAR
HYACVRHSPFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVK
AVMDDHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFA
YMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFD
IINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARDFLYA
GAEAGVMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAVGKVVA
Download sequence
Identical sequences A0A0D6I7N6 A0A0F7JB35 A0A0H3BR71 A0A0M0QDP0 A0A0R9PF40 A0A0T9XYK6 A0A0U1JIY3 A0A1S1AHT0 A0A221Z7X0 A0A249UTA9 A0A2C6G342 A0A2D3AHC8 A0A2G1P0N0 A0A2I6NZ29 A0A2K2ZHD3 C0Q0E3 G5LUM7 G5NJ14 G5RLN4 P40732 V7V0E3
gi|525840396|ref|YP_008257916.1| gi|194445123|ref|YP_002042719.1| gi|528817136|ref|YP_008358339.1| gi|224585262|ref|YP_002639061.1| gi|525945860|ref|YP_008306871.1| gi|378986063|ref|YP_005249219.1| gi|550902813|ref|YP_008671905.1| NP_462371.1.58477 WP_000190023.1.100010 WP_000190023.1.100115 WP_000190023.1.100165 WP_000190023.1.100234 WP_000190023.1.100258 WP_000190023.1.100376 WP_000190023.1.100413 WP_000190023.1.100424 WP_000190023.1.100432 WP_000190023.1.100436 WP_000190023.1.100502 WP_000190023.1.100584 WP_000190023.1.100589 WP_000190023.1.100597 WP_000190023.1.100707 WP_000190023.1.100711 WP_000190023.1.100750 WP_000190023.1.10076 WP_000190023.1.100781 WP_000190023.1.100793 WP_000190023.1.100869 WP_000190023.1.100870 WP_000190023.1.100871 WP_000190023.1.100882 WP_000190023.1.100948 WP_000190023.1.101007 WP_000190023.1.101020 WP_000190023.1.101074 WP_000190023.1.101078 WP_000190023.1.101180 WP_000190023.1.101185 WP_000190023.1.101223 WP_000190023.1.101259 WP_000190023.1.101284 WP_000190023.1.101291 WP_000190023.1.101320 WP_000190023.1.101353 WP_000190023.1.101386 WP_000190023.1.101404 WP_000190023.1.101420 WP_000190023.1.101589 WP_000190023.1.101707 WP_000190023.1.101734 WP_000190023.1.101878 WP_000190023.1.101953 WP_000190023.1.102103 WP_000190023.1.10220 WP_000190023.1.10266 WP_000190023.1.10310 WP_000190023.1.10429 WP_000190023.1.10439 WP_000190023.1.10463 WP_000190023.1.10465 WP_000190023.1.10675 WP_000190023.1.10678 WP_000190023.1.10753 WP_000190023.1.10992 WP_000190023.1.11000 WP_000190023.1.11024 WP_000190023.1.11031 WP_000190023.1.11098 WP_000190023.1.11168 WP_000190023.1.11190 WP_000190023.1.11295 WP_000190023.1.11304 WP_000190023.1.11405 WP_000190023.1.11455 WP_000190023.1.11458 WP_000190023.1.11518 WP_000190023.1.11532 WP_000190023.1.11543 WP_000190023.1.11544 WP_000190023.1.11763 WP_000190023.1.11772 WP_000190023.1.11865 WP_000190023.1.11897 WP_000190023.1.12025 WP_000190023.1.12114 WP_000190023.1.12160 WP_000190023.1.12244 WP_000190023.1.12280 WP_000190023.1.12351 WP_000190023.1.12546 WP_000190023.1.12584 WP_000190023.1.1264 WP_000190023.1.12718 WP_000190023.1.12728 WP_000190023.1.12879 WP_000190023.1.12936 WP_000190023.1.12995 WP_000190023.1.13027 WP_000190023.1.13106 WP_000190023.1.13130 WP_000190023.1.1326 WP_000190023.1.13311 WP_000190023.1.13334 WP_000190023.1.13414 WP_000190023.1.13488 WP_000190023.1.13509 WP_000190023.1.13669 WP_000190023.1.13677 WP_000190023.1.13741 WP_000190023.1.13819 WP_000190023.1.1387 WP_000190023.1.13908 WP_000190023.1.13932 WP_000190023.1.13968 WP_000190023.1.14001 WP_000190023.1.14041 WP_000190023.1.14151 WP_000190023.1.14239 WP_000190023.1.14286 WP_000190023.1.14320 WP_000190023.1.14379 WP_000190023.1.14406 WP_000190023.1.14410 WP_000190023.1.14466 WP_000190023.1.14516 WP_000190023.1.14524 WP_000190023.1.14554 WP_000190023.1.14688 WP_000190023.1.14706 WP_000190023.1.14725 WP_000190023.1.14737 WP_000190023.1.14808 WP_000190023.1.14932 WP_000190023.1.15055 WP_000190023.1.15124 WP_000190023.1.15226 WP_000190023.1.15316 WP_000190023.1.15353 WP_000190023.1.15369 WP_000190023.1.1540 WP_000190023.1.15483 WP_000190023.1.15508 WP_000190023.1.15612 WP_000190023.1.15625 WP_000190023.1.15637 WP_000190023.1.15644 WP_000190023.1.15708 WP_000190023.1.15784 WP_000190023.1.15830 WP_000190023.1.15835 WP_000190023.1.15881 WP_000190023.1.16032 WP_000190023.1.16062 WP_000190023.1.16063 WP_000190023.1.16103 WP_000190023.1.16125 WP_000190023.1.16166 WP_000190023.1.16226 WP_000190023.1.16233 WP_000190023.1.16284 WP_000190023.1.16328 WP_000190023.1.1635 WP_000190023.1.16468 WP_000190023.1.16614 WP_000190023.1.16650 WP_000190023.1.16686 WP_000190023.1.16691 WP_000190023.1.167 WP_000190023.1.16732 WP_000190023.1.16735 WP_000190023.1.16736 WP_000190023.1.16786 WP_000190023.1.16819 WP_000190023.1.16858 WP_000190023.1.1689 WP_000190023.1.16896 WP_000190023.1.16916 WP_000190023.1.16941 WP_000190023.1.16965 WP_000190023.1.1700 WP_000190023.1.17285 WP_000190023.1.17307 WP_000190023.1.17390 WP_000190023.1.174 WP_000190023.1.17439 WP_000190023.1.17447 WP_000190023.1.17546 WP_000190023.1.17560 WP_000190023.1.17702 WP_000190023.1.17705 WP_000190023.1.17747 WP_000190023.1.17755 WP_000190023.1.17865 WP_000190023.1.17901 WP_000190023.1.17919 WP_000190023.1.17991 WP_000190023.1.18019 WP_000190023.1.1807 WP_000190023.1.18111 WP_000190023.1.18163 WP_000190023.1.18249 WP_000190023.1.18265 WP_000190023.1.18267 WP_000190023.1.18281 WP_000190023.1.18282 WP_000190023.1.18441 WP_000190023.1.18468 WP_000190023.1.18607 WP_000190023.1.18692 WP_000190023.1.18705 WP_000190023.1.18715 WP_000190023.1.18776 WP_000190023.1.18822 WP_000190023.1.18881 WP_000190023.1.18940 WP_000190023.1.18949 WP_000190023.1.1897 WP_000190023.1.19053 WP_000190023.1.19163 WP_000190023.1.19240 WP_000190023.1.19458 WP_000190023.1.19460 WP_000190023.1.19461 WP_000190023.1.19614 WP_000190023.1.19642 WP_000190023.1.19702 WP_000190023.1.19706 WP_000190023.1.19723 WP_000190023.1.19724 WP_000190023.1.19749 WP_000190023.1.19784 WP_000190023.1.19809 WP_000190023.1.19823 WP_000190023.1.19867 WP_000190023.1.1998 WP_000190023.1.20 WP_000190023.1.20034 WP_000190023.1.2010 WP_000190023.1.20119 WP_000190023.1.20212 WP_000190023.1.20266 WP_000190023.1.20271 WP_000190023.1.20330 WP_000190023.1.20362 WP_000190023.1.20391 WP_000190023.1.20418 WP_000190023.1.20425 WP_000190023.1.20443 WP_000190023.1.20525 WP_000190023.1.2054 WP_000190023.1.20553 WP_000190023.1.20573 WP_000190023.1.20626 WP_000190023.1.20631 WP_000190023.1.20646 WP_000190023.1.20695 WP_000190023.1.20700 WP_000190023.1.20721 WP_000190023.1.20789 WP_000190023.1.20886 WP_000190023.1.2101 WP_000190023.1.21049 WP_000190023.1.21086 WP_000190023.1.21146 WP_000190023.1.21165 WP_000190023.1.21245 WP_000190023.1.21246 WP_000190023.1.21269 WP_000190023.1.21309 WP_000190023.1.21326 WP_000190023.1.21400 WP_000190023.1.21497 WP_000190023.1.21499 WP_000190023.1.21548 WP_000190023.1.21750 WP_000190023.1.21751 WP_000190023.1.21757 WP_000190023.1.21792 WP_000190023.1.22024 WP_000190023.1.2205 WP_000190023.1.22062 WP_000190023.1.22067 WP_000190023.1.22169 WP_000190023.1.2221 WP_000190023.1.2224 WP_000190023.1.22315 WP_000190023.1.22337 WP_000190023.1.2235 WP_000190023.1.22379 WP_000190023.1.22427 WP_000190023.1.22453 WP_000190023.1.2246 WP_000190023.1.22485 WP_000190023.1.22514 WP_000190023.1.22537 WP_000190023.1.22604 WP_000190023.1.22620 WP_000190023.1.22870 WP_000190023.1.22979 WP_000190023.1.23010 WP_000190023.1.23114 WP_000190023.1.2314 WP_000190023.1.23155 WP_000190023.1.23172 WP_000190023.1.23192 WP_000190023.1.23246 WP_000190023.1.23259 WP_000190023.1.23309 WP_000190023.1.2342 WP_000190023.1.23460 WP_000190023.1.23466 WP_000190023.1.23472 WP_000190023.1.23482 WP_000190023.1.23485 WP_000190023.1.23587 WP_000190023.1.23629 WP_000190023.1.23634 WP_000190023.1.2364 WP_000190023.1.23643 WP_000190023.1.23670 WP_000190023.1.23685 WP_000190023.1.23707 WP_000190023.1.23736 WP_000190023.1.23819 WP_000190023.1.23932 WP_000190023.1.24017 WP_000190023.1.24158 WP_000190023.1.24206 WP_000190023.1.24325 WP_000190023.1.24419 WP_000190023.1.24444 WP_000190023.1.24567 WP_000190023.1.24578 WP_000190023.1.2467 WP_000190023.1.24723 WP_000190023.1.24737 WP_000190023.1.24873 WP_000190023.1.25008 WP_000190023.1.25015 WP_000190023.1.25036 WP_000190023.1.25072 WP_000190023.1.25206 WP_000190023.1.25405 WP_000190023.1.25454 WP_000190023.1.25493 WP_000190023.1.25498 WP_000190023.1.2554 WP_000190023.1.25668 WP_000190023.1.25690 WP_000190023.1.2570 WP_000190023.1.25700 WP_000190023.1.25740 WP_000190023.1.25793 WP_000190023.1.25814 WP_000190023.1.25932 WP_000190023.1.26030 WP_000190023.1.26093 WP_000190023.1.26129 WP_000190023.1.26224 WP_000190023.1.26269 WP_000190023.1.26282 WP_000190023.1.26311 WP_000190023.1.26319 WP_000190023.1.2634 WP_000190023.1.26363 WP_000190023.1.26426 WP_000190023.1.26429 WP_000190023.1.26440 WP_000190023.1.26493 WP_000190023.1.26567 WP_000190023.1.26582 WP_000190023.1.2660 WP_000190023.1.26709 WP_000190023.1.26856 WP_000190023.1.26924 WP_000190023.1.27206 WP_000190023.1.27279 WP_000190023.1.27419 WP_000190023.1.27423 WP_000190023.1.27556 WP_000190023.1.27561 WP_000190023.1.27665 WP_000190023.1.27679 WP_000190023.1.27707 WP_000190023.1.27755 WP_000190023.1.27761 WP_000190023.1.2777 WP_000190023.1.27857 WP_000190023.1.27977 WP_000190023.1.28094 WP_000190023.1.28126 WP_000190023.1.28302 WP_000190023.1.2835 WP_000190023.1.28370 WP_000190023.1.28504 WP_000190023.1.28538 WP_000190023.1.28575 WP_000190023.1.28612 WP_000190023.1.28625 WP_000190023.1.28655 WP_000190023.1.28694 WP_000190023.1.287 WP_000190023.1.2879 WP_000190023.1.2890 WP_000190023.1.28902 WP_000190023.1.28938 WP_000190023.1.28946 WP_000190023.1.29006 WP_000190023.1.29010 WP_000190023.1.2910 WP_000190023.1.29174 WP_000190023.1.29190 WP_000190023.1.29530 WP_000190023.1.29588 WP_000190023.1.29601 WP_000190023.1.29606 WP_000190023.1.29615 WP_000190023.1.29682 WP_000190023.1.29704 WP_000190023.1.29768 WP_000190023.1.29775 WP_000190023.1.2984 WP_000190023.1.29845 WP_000190023.1.29898 WP_000190023.1.29924 WP_000190023.1.29969 WP_000190023.1.30006 WP_000190023.1.30027 WP_000190023.1.30086 WP_000190023.1.30093 WP_000190023.1.3017 WP_000190023.1.30180 WP_000190023.1.30246 WP_000190023.1.30437 WP_000190023.1.30469 WP_000190023.1.30505 WP_000190023.1.30507 WP_000190023.1.30535 WP_000190023.1.30547 WP_000190023.1.30573 WP_000190023.1.30602 WP_000190023.1.3076 WP_000190023.1.30794 WP_000190023.1.30833 WP_000190023.1.30835 WP_000190023.1.30909 WP_000190023.1.31 WP_000190023.1.31107 WP_000190023.1.3113 WP_000190023.1.31171 WP_000190023.1.31185 WP_000190023.1.31190 WP_000190023.1.31196 WP_000190023.1.31210 WP_000190023.1.31219 WP_000190023.1.3124 WP_000190023.1.31251 WP_000190023.1.31281 WP_000190023.1.31362 WP_000190023.1.31476 WP_000190023.1.31504 WP_000190023.1.31515 WP_000190023.1.31658 WP_000190023.1.31762 WP_000190023.1.31782 WP_000190023.1.31854 WP_000190023.1.31940 WP_000190023.1.31967 WP_000190023.1.31972 WP_000190023.1.32192 WP_000190023.1.32206 WP_000190023.1.32408 WP_000190023.1.32515 WP_000190023.1.32527 WP_000190023.1.32660 WP_000190023.1.32702 WP_000190023.1.32714 WP_000190023.1.32747 WP_000190023.1.32750 WP_000190023.1.32786 WP_000190023.1.32804 WP_000190023.1.32860 WP_000190023.1.32900 WP_000190023.1.32907 WP_000190023.1.33030 WP_000190023.1.33078 WP_000190023.1.33127 WP_000190023.1.33143 WP_000190023.1.33160 WP_000190023.1.33248 WP_000190023.1.33261 WP_000190023.1.333 WP_000190023.1.33392 WP_000190023.1.33492 WP_000190023.1.33553 WP_000190023.1.33592 WP_000190023.1.33609 WP_000190023.1.33817 WP_000190023.1.33894 WP_000190023.1.3395 WP_000190023.1.34043 WP_000190023.1.34075 WP_000190023.1.34107 WP_000190023.1.34257 WP_000190023.1.34279 WP_000190023.1.34330 WP_000190023.1.34453 WP_000190023.1.34610 WP_000190023.1.34667 WP_000190023.1.34856 WP_000190023.1.34975 WP_000190023.1.34977 WP_000190023.1.35045 WP_000190023.1.35129 WP_000190023.1.35184 WP_000190023.1.35404 WP_000190023.1.35408 WP_000190023.1.35425 WP_000190023.1.35429 WP_000190023.1.35509 WP_000190023.1.3556 WP_000190023.1.35590 WP_000190023.1.3566 WP_000190023.1.35940 WP_000190023.1.36003 WP_000190023.1.3601 WP_000190023.1.36157 WP_000190023.1.36232 WP_000190023.1.36609 WP_000190023.1.36690 WP_000190023.1.3670 WP_000190023.1.36705 WP_000190023.1.36899 WP_000190023.1.36918 WP_000190023.1.36931 WP_000190023.1.37073 WP_000190023.1.37111 WP_000190023.1.37112 WP_000190023.1.37190 WP_000190023.1.37256 WP_000190023.1.37293 WP_000190023.1.3734 WP_000190023.1.37370 WP_000190023.1.37376 WP_000190023.1.3744 WP_000190023.1.37498 WP_000190023.1.37504 WP_000190023.1.37558 WP_000190023.1.37618 WP_000190023.1.37666 WP_000190023.1.37687 WP_000190023.1.37848 WP_000190023.1.37968 WP_000190023.1.38001 WP_000190023.1.38026 WP_000190023.1.38125 WP_000190023.1.38145 WP_000190023.1.38199 WP_000190023.1.383 WP_000190023.1.38341 WP_000190023.1.38393 WP_000190023.1.3848 WP_000190023.1.38613 WP_000190023.1.38673 WP_000190023.1.3869 WP_000190023.1.38693 WP_000190023.1.38773 WP_000190023.1.38882 WP_000190023.1.38913 WP_000190023.1.38942 WP_000190023.1.39003 WP_000190023.1.39136 WP_000190023.1.39197 WP_000190023.1.39229 WP_000190023.1.39385 WP_000190023.1.39405 WP_000190023.1.39420 WP_000190023.1.39449 WP_000190023.1.39466 WP_000190023.1.39512 WP_000190023.1.39553 WP_000190023.1.39556 WP_000190023.1.39629 WP_000190023.1.39722 WP_000190023.1.39723 WP_000190023.1.39763 WP_000190023.1.39862 WP_000190023.1.39923 WP_000190023.1.40017 WP_000190023.1.40072 WP_000190023.1.40073 WP_000190023.1.4011 WP_000190023.1.40155 WP_000190023.1.40170 WP_000190023.1.40171 WP_000190023.1.40208 WP_000190023.1.40224 WP_000190023.1.40240 WP_000190023.1.40254 WP_000190023.1.40257 WP_000190023.1.40292 WP_000190023.1.40305 WP_000190023.1.40311 WP_000190023.1.40374 WP_000190023.1.40380 WP_000190023.1.40395 WP_000190023.1.40465 WP_000190023.1.40528 WP_000190023.1.40710 WP_000190023.1.4075 WP_000190023.1.40771 WP_000190023.1.40788 WP_000190023.1.4087 WP_000190023.1.40877 WP_000190023.1.41017 WP_000190023.1.41086 WP_000190023.1.41091 WP_000190023.1.41225 WP_000190023.1.41226 WP_000190023.1.41279 WP_000190023.1.41310 WP_000190023.1.41375 WP_000190023.1.41440 WP_000190023.1.41516 WP_000190023.1.41554 WP_000190023.1.41572 WP_000190023.1.41591 WP_000190023.1.41662 WP_000190023.1.41708 WP_000190023.1.41761 WP_000190023.1.41859 WP_000190023.1.41882 WP_000190023.1.41979 WP_000190023.1.41985 WP_000190023.1.42104 WP_000190023.1.42320 WP_000190023.1.42342 WP_000190023.1.4239 WP_000190023.1.42422 WP_000190023.1.42489 WP_000190023.1.4276 WP_000190023.1.42767 WP_000190023.1.42797 WP_000190023.1.42829 WP_000190023.1.42861 WP_000190023.1.4288 WP_000190023.1.42887 WP_000190023.1.42957 WP_000190023.1.43018 WP_000190023.1.43041 WP_000190023.1.43244 WP_000190023.1.43334 WP_000190023.1.43351 WP_000190023.1.43437 WP_000190023.1.43522 WP_000190023.1.43613 WP_000190023.1.43668 WP_000190023.1.4373 WP_000190023.1.43875 WP_000190023.1.43886 WP_000190023.1.4404 WP_000190023.1.44043 WP_000190023.1.4405 WP_000190023.1.44113 WP_000190023.1.44121 WP_000190023.1.44250 WP_000190023.1.44291 WP_000190023.1.44310 WP_000190023.1.44386 WP_000190023.1.4440 WP_000190023.1.44438 WP_000190023.1.44440 WP_000190023.1.44479 WP_000190023.1.44578 WP_000190023.1.44607 WP_000190023.1.44747 WP_000190023.1.44781 WP_000190023.1.44791 WP_000190023.1.4485 WP_000190023.1.44877 WP_000190023.1.44927 WP_000190023.1.45045 WP_000190023.1.45074 WP_000190023.1.45079 WP_000190023.1.45098 WP_000190023.1.45138 WP_000190023.1.45177 WP_000190023.1.45259 WP_000190023.1.45344 WP_000190023.1.45349 WP_000190023.1.45351 WP_000190023.1.45365 WP_000190023.1.45468 WP_000190023.1.45522 WP_000190023.1.45535 WP_000190023.1.45544 WP_000190023.1.45550 WP_000190023.1.45585 WP_000190023.1.45660 WP_000190023.1.45690 WP_000190023.1.45797 WP_000190023.1.458 WP_000190023.1.46011 WP_000190023.1.46028 WP_000190023.1.46069 WP_000190023.1.46173 WP_000190023.1.46174 WP_000190023.1.46187 WP_000190023.1.46203 WP_000190023.1.46232 WP_000190023.1.46250 WP_000190023.1.46286 WP_000190023.1.46303 WP_000190023.1.46322 WP_000190023.1.46345 WP_000190023.1.46574 WP_000190023.1.46595 WP_000190023.1.46666 WP_000190023.1.46675 WP_000190023.1.46689 WP_000190023.1.46693 WP_000190023.1.46730 WP_000190023.1.46749 WP_000190023.1.46803 WP_000190023.1.46930 WP_000190023.1.46961 WP_000190023.1.47057 WP_000190023.1.47067 WP_000190023.1.47214 WP_000190023.1.47429 WP_000190023.1.47448 WP_000190023.1.4747 WP_000190023.1.47478 WP_000190023.1.47587 WP_000190023.1.47621 WP_000190023.1.47649 WP_000190023.1.4769 WP_000190023.1.47714 WP_000190023.1.47799 WP_000190023.1.47814 WP_000190023.1.48132 WP_000190023.1.48209 WP_000190023.1.48242 WP_000190023.1.48244 WP_000190023.1.48253 WP_000190023.1.483 WP_000190023.1.48367 WP_000190023.1.48377 WP_000190023.1.48399 WP_000190023.1.4853 WP_000190023.1.48570 WP_000190023.1.48788 WP_000190023.1.4885 WP_000190023.1.48886 WP_000190023.1.48894 WP_000190023.1.48896 WP_000190023.1.48919 WP_000190023.1.48985 WP_000190023.1.49084 WP_000190023.1.49102 WP_000190023.1.49155 WP_000190023.1.49175 WP_000190023.1.49204 WP_000190023.1.49226 WP_000190023.1.49239 WP_000190023.1.49256 WP_000190023.1.49276 WP_000190023.1.49290 WP_000190023.1.49304 WP_000190023.1.49309 WP_000190023.1.49340 WP_000190023.1.49366 WP_000190023.1.49472 WP_000190023.1.49490 WP_000190023.1.49515 WP_000190023.1.49550 WP_000190023.1.49572 WP_000190023.1.49590 WP_000190023.1.49595 WP_000190023.1.49630 WP_000190023.1.4979 WP_000190023.1.49803 WP_000190023.1.49805 WP_000190023.1.49827 WP_000190023.1.49929 WP_000190023.1.49931 WP_000190023.1.50007 WP_000190023.1.50080 WP_000190023.1.5009 WP_000190023.1.50161 WP_000190023.1.50211 WP_000190023.1.50285 WP_000190023.1.50374 WP_000190023.1.50376 WP_000190023.1.50389 WP_000190023.1.50469 WP_000190023.1.50517 WP_000190023.1.50563 WP_000190023.1.50576 WP_000190023.1.5058 WP_000190023.1.50676 WP_000190023.1.50774 WP_000190023.1.50782 WP_000190023.1.50804 WP_000190023.1.50808 WP_000190023.1.5088 WP_000190023.1.50908 WP_000190023.1.50941 WP_000190023.1.51014 WP_000190023.1.51022 WP_000190023.1.51162 WP_000190023.1.51179 WP_000190023.1.51182 WP_000190023.1.51186 WP_000190023.1.5138 WP_000190023.1.51464 WP_000190023.1.51487 WP_000190023.1.51488 WP_000190023.1.51555 WP_000190023.1.51594 WP_000190023.1.51611 WP_000190023.1.51634 WP_000190023.1.51649 WP_000190023.1.51686 WP_000190023.1.51700 WP_000190023.1.51756 WP_000190023.1.51841 WP_000190023.1.51888 WP_000190023.1.51911 WP_000190023.1.51932 WP_000190023.1.51989 WP_000190023.1.52121 WP_000190023.1.52148 WP_000190023.1.52255 WP_000190023.1.52353 WP_000190023.1.52356 WP_000190023.1.52361 WP_000190023.1.52438 WP_000190023.1.52446 WP_000190023.1.52637 WP_000190023.1.52653 WP_000190023.1.52656 WP_000190023.1.52738 WP_000190023.1.52743 WP_000190023.1.52748 WP_000190023.1.52857 WP_000190023.1.52898 WP_000190023.1.52915 WP_000190023.1.5316 WP_000190023.1.53190 WP_000190023.1.53286 WP_000190023.1.5333 WP_000190023.1.53436 WP_000190023.1.53466 WP_000190023.1.53529 WP_000190023.1.53543 WP_000190023.1.53688 WP_000190023.1.53757 WP_000190023.1.53790 WP_000190023.1.53812 WP_000190023.1.53935 WP_000190023.1.54061 WP_000190023.1.54082 WP_000190023.1.54085 WP_000190023.1.54136 WP_000190023.1.54196 WP_000190023.1.542 WP_000190023.1.54209 WP_000190023.1.54271 WP_000190023.1.54273 WP_000190023.1.54274 WP_000190023.1.54319 WP_000190023.1.54324 WP_000190023.1.54364 WP_000190023.1.54400 WP_000190023.1.54569 WP_000190023.1.54644 WP_000190023.1.54662 WP_000190023.1.54722 WP_000190023.1.54749 WP_000190023.1.54764 WP_000190023.1.54827 WP_000190023.1.55008 WP_000190023.1.55152 WP_000190023.1.55156 WP_000190023.1.5517 WP_000190023.1.55178 WP_000190023.1.55223 WP_000190023.1.5523 WP_000190023.1.55285 WP_000190023.1.55475 WP_000190023.1.55477 WP_000190023.1.55496 WP_000190023.1.5552 WP_000190023.1.55528 WP_000190023.1.5555 WP_000190023.1.55623 WP_000190023.1.55647 WP_000190023.1.55706 WP_000190023.1.55718 WP_000190023.1.55743 WP_000190023.1.55782 WP_000190023.1.55796 WP_000190023.1.55993 WP_000190023.1.55995 WP_000190023.1.56002 WP_000190023.1.56097 WP_000190023.1.56105 WP_000190023.1.56238 WP_000190023.1.56247 WP_000190023.1.56261 WP_000190023.1.56286 WP_000190023.1.56303 WP_000190023.1.56304 WP_000190023.1.5633 WP_000190023.1.56370 WP_000190023.1.56393 WP_000190023.1.56396 WP_000190023.1.56414 WP_000190023.1.56438 WP_000190023.1.56560 WP_000190023.1.56597 WP_000190023.1.56614 WP_000190023.1.56671 WP_000190023.1.56682 WP_000190023.1.56824 WP_000190023.1.56853 WP_000190023.1.56875 WP_000190023.1.56877 WP_000190023.1.56893 WP_000190023.1.57084 WP_000190023.1.57125 WP_000190023.1.57149 WP_000190023.1.57168 WP_000190023.1.57187 WP_000190023.1.57232 WP_000190023.1.57307 WP_000190023.1.57357 WP_000190023.1.57377 WP_000190023.1.57418 WP_000190023.1.57433 WP_000190023.1.57510 WP_000190023.1.57515 WP_000190023.1.57529 WP_000190023.1.57534 WP_000190023.1.57576 WP_000190023.1.57601 WP_000190023.1.57763 WP_000190023.1.57781 WP_000190023.1.57862 WP_000190023.1.57890 WP_000190023.1.57978 WP_000190023.1.5801 WP_000190023.1.58040 WP_000190023.1.58041 WP_000190023.1.58144 WP_000190023.1.58249 WP_000190023.1.58301 WP_000190023.1.58418 WP_000190023.1.58442 WP_000190023.1.5854 WP_000190023.1.58548 WP_000190023.1.5858 WP_000190023.1.58662 WP_000190023.1.58669 WP_000190023.1.58744 WP_000190023.1.58745 WP_000190023.1.5878 WP_000190023.1.58803 WP_000190023.1.58831 WP_000190023.1.58836 WP_000190023.1.59084 WP_000190023.1.59094 WP_000190023.1.59224 WP_000190023.1.59236 WP_000190023.1.59336 WP_000190023.1.59375 WP_000190023.1.59381 WP_000190023.1.59439 WP_000190023.1.59458 WP_000190023.1.59490 WP_000190023.1.59508 WP_000190023.1.5953 WP_000190023.1.59641 WP_000190023.1.59684 WP_000190023.1.59694 WP_000190023.1.59771 WP_000190023.1.5979 WP_000190023.1.59830 WP_000190023.1.59928 WP_000190023.1.59953 WP_000190023.1.60008 WP_000190023.1.60021 WP_000190023.1.60069 WP_000190023.1.60140 WP_000190023.1.60155 WP_000190023.1.60226 WP_000190023.1.60285 WP_000190023.1.60370 WP_000190023.1.60379 WP_000190023.1.60464 WP_000190023.1.6052 WP_000190023.1.60746 WP_000190023.1.60794 WP_000190023.1.60838 WP_000190023.1.60874 WP_000190023.1.60919 WP_000190023.1.60941 WP_000190023.1.61078 WP_000190023.1.6114 WP_000190023.1.61146 WP_000190023.1.61201 WP_000190023.1.61232 WP_000190023.1.61233 WP_000190023.1.6129 WP_000190023.1.61417 WP_000190023.1.61497 WP_000190023.1.61519 WP_000190023.1.61574 WP_000190023.1.61609 WP_000190023.1.6164 WP_000190023.1.61712 WP_000190023.1.61714 WP_000190023.1.61730 WP_000190023.1.61857 WP_000190023.1.61924 WP_000190023.1.61952 WP_000190023.1.62007 WP_000190023.1.62025 WP_000190023.1.6210 WP_000190023.1.62204 WP_000190023.1.62219 WP_000190023.1.62241 WP_000190023.1.62304 WP_000190023.1.62364 WP_000190023.1.62374 WP_000190023.1.62403 WP_000190023.1.62504 WP_000190023.1.6253 WP_000190023.1.62570 WP_000190023.1.62798 WP_000190023.1.62853 WP_000190023.1.62903 WP_000190023.1.62955 WP_000190023.1.63043 WP_000190023.1.63063 WP_000190023.1.63118 WP_000190023.1.63135 WP_000190023.1.63155 WP_000190023.1.63181 WP_000190023.1.63203 WP_000190023.1.63234 WP_000190023.1.63256 WP_000190023.1.63290 WP_000190023.1.63382 WP_000190023.1.63432 WP_000190023.1.63461 WP_000190023.1.63479 WP_000190023.1.63525 WP_000190023.1.63532 WP_000190023.1.63568 WP_000190023.1.63577 WP_000190023.1.63664 WP_000190023.1.63718 WP_000190023.1.63731 WP_000190023.1.6375 WP_000190023.1.63757 WP_000190023.1.63766 WP_000190023.1.63781 WP_000190023.1.63824 WP_000190023.1.63834 WP_000190023.1.63934 WP_000190023.1.63992 WP_000190023.1.64007 WP_000190023.1.64046 WP_000190023.1.64072 WP_000190023.1.6423 WP_000190023.1.64242 WP_000190023.1.64244 WP_000190023.1.64374 WP_000190023.1.64403 WP_000190023.1.64569 WP_000190023.1.64649 WP_000190023.1.64702 WP_000190023.1.64757 WP_000190023.1.64781 WP_000190023.1.64831 WP_000190023.1.6489 WP_000190023.1.64920 WP_000190023.1.65016 WP_000190023.1.65018 WP_000190023.1.65022 WP_000190023.1.65027 WP_000190023.1.65028 WP_000190023.1.65171 WP_000190023.1.65248 WP_000190023.1.65394 WP_000190023.1.65474 WP_000190023.1.65508 WP_000190023.1.65558 WP_000190023.1.65572 WP_000190023.1.6560 WP_000190023.1.65633 WP_000190023.1.6565 WP_000190023.1.65696 WP_000190023.1.6575 WP_000190023.1.65782 WP_000190023.1.65838 WP_000190023.1.66074 WP_000190023.1.66167 WP_000190023.1.6630 WP_000190023.1.66314 WP_000190023.1.66358 WP_000190023.1.66362 WP_000190023.1.6638 WP_000190023.1.6640 WP_000190023.1.66462 WP_000190023.1.66492 WP_000190023.1.66534 WP_000190023.1.66698 WP_000190023.1.6680 WP_000190023.1.66807 WP_000190023.1.66820 WP_000190023.1.66834 WP_000190023.1.66901 WP_000190023.1.66962 WP_000190023.1.67037 WP_000190023.1.67045 WP_000190023.1.67181 WP_000190023.1.67184 WP_000190023.1.67268 WP_000190023.1.67288 WP_000190023.1.67374 WP_000190023.1.67465 WP_000190023.1.67552 WP_000190023.1.67682 WP_000190023.1.67829 WP_000190023.1.67887 WP_000190023.1.67905 WP_000190023.1.67942 WP_000190023.1.68036 WP_000190023.1.68201 WP_000190023.1.68206 WP_000190023.1.6827 WP_000190023.1.68275 WP_000190023.1.68478 WP_000190023.1.6849 WP_000190023.1.68532 WP_000190023.1.68547 WP_000190023.1.6857 WP_000190023.1.68589 WP_000190023.1.68591 WP_000190023.1.68655 WP_000190023.1.68656 WP_000190023.1.68658 WP_000190023.1.6869 WP_000190023.1.68778 WP_000190023.1.68787 WP_000190023.1.68818 WP_000190023.1.68894 WP_000190023.1.68928 WP_000190023.1.68966 WP_000190023.1.68975 WP_000190023.1.69006 WP_000190023.1.69011 WP_000190023.1.69029 WP_000190023.1.6907 WP_000190023.1.6913 WP_000190023.1.69146 WP_000190023.1.69255 WP_000190023.1.69288 WP_000190023.1.69296 WP_000190023.1.69397 WP_000190023.1.69564 WP_000190023.1.69636 WP_000190023.1.69644 WP_000190023.1.69704 WP_000190023.1.69787 WP_000190023.1.69977 WP_000190023.1.70028 WP_000190023.1.7014 WP_000190023.1.7016 WP_000190023.1.7021 WP_000190023.1.70241 WP_000190023.1.70248 WP_000190023.1.70269 WP_000190023.1.70289 WP_000190023.1.70321 WP_000190023.1.70326 WP_000190023.1.70447 WP_000190023.1.70485 WP_000190023.1.70488 WP_000190023.1.70523 WP_000190023.1.70547 WP_000190023.1.70580 WP_000190023.1.70643 WP_000190023.1.70883 WP_000190023.1.70922 WP_000190023.1.70948 WP_000190023.1.70969 WP_000190023.1.70971 WP_000190023.1.71010 WP_000190023.1.7110 WP_000190023.1.71116 WP_000190023.1.71146 WP_000190023.1.71165 WP_000190023.1.71188 WP_000190023.1.71202 WP_000190023.1.71243 WP_000190023.1.71299 WP_000190023.1.71306 WP_000190023.1.71368 WP_000190023.1.71378 WP_000190023.1.71401 WP_000190023.1.71407 WP_000190023.1.71446 WP_000190023.1.71691 WP_000190023.1.7174 WP_000190023.1.71750 WP_000190023.1.71756 WP_000190023.1.71881 WP_000190023.1.71908 WP_000190023.1.71952 WP_000190023.1.71973 WP_000190023.1.72065 WP_000190023.1.72105 WP_000190023.1.72119 WP_000190023.1.72203 WP_000190023.1.72220 WP_000190023.1.72226 WP_000190023.1.72234 WP_000190023.1.72372 WP_000190023.1.72376 WP_000190023.1.72412 WP_000190023.1.72594 WP_000190023.1.72629 WP_000190023.1.72689 WP_000190023.1.72871 WP_000190023.1.72897 WP_000190023.1.72968 WP_000190023.1.72975 WP_000190023.1.73062 WP_000190023.1.73144 WP_000190023.1.73164 WP_000190023.1.73200 WP_000190023.1.7334 WP_000190023.1.73362 WP_000190023.1.73377 WP_000190023.1.73379 WP_000190023.1.73481 WP_000190023.1.7356 WP_000190023.1.73561 WP_000190023.1.73581 WP_000190023.1.73596 WP_000190023.1.73617 WP_000190023.1.73667 WP_000190023.1.73669 WP_000190023.1.73753 WP_000190023.1.73758 WP_000190023.1.73794 WP_000190023.1.73831 WP_000190023.1.7387 WP_000190023.1.73901 WP_000190023.1.73926 WP_000190023.1.7394 WP_000190023.1.73945 WP_000190023.1.73956 WP_000190023.1.74181 WP_000190023.1.74191 WP_000190023.1.74379 WP_000190023.1.74410 WP_000190023.1.74414 WP_000190023.1.7444 WP_000190023.1.74466 WP_000190023.1.74481 WP_000190023.1.74529 WP_000190023.1.74545 WP_000190023.1.74620 WP_000190023.1.74745 WP_000190023.1.74996 WP_000190023.1.75177 WP_000190023.1.75187 WP_000190023.1.75288 WP_000190023.1.75334 WP_000190023.1.75385 WP_000190023.1.75392 WP_000190023.1.75402 WP_000190023.1.7543 WP_000190023.1.75494 WP_000190023.1.75585 WP_000190023.1.75626 WP_000190023.1.75760 WP_000190023.1.75764 WP_000190023.1.75793 WP_000190023.1.75837 WP_000190023.1.75874 WP_000190023.1.75884 WP_000190023.1.75932 WP_000190023.1.75945 WP_000190023.1.76020 WP_000190023.1.76024 WP_000190023.1.76055 WP_000190023.1.76097 WP_000190023.1.76208 WP_000190023.1.76252 WP_000190023.1.7634 WP_000190023.1.76364 WP_000190023.1.76434 WP_000190023.1.76445 WP_000190023.1.76471 WP_000190023.1.7660 WP_000190023.1.76673 WP_000190023.1.76706 WP_000190023.1.76721 WP_000190023.1.76738 WP_000190023.1.76756 WP_000190023.1.76760 WP_000190023.1.76806 WP_000190023.1.76866 WP_000190023.1.76875 WP_000190023.1.76880 WP_000190023.1.76899 WP_000190023.1.77017 WP_000190023.1.77038 WP_000190023.1.77047 WP_000190023.1.77080 WP_000190023.1.7712 WP_000190023.1.77180 WP_000190023.1.77184 WP_000190023.1.77244 WP_000190023.1.77292 WP_000190023.1.77313 WP_000190023.1.77349 WP_000190023.1.77414 WP_000190023.1.77514 WP_000190023.1.77529 WP_000190023.1.77543 WP_000190023.1.77549 WP_000190023.1.77575 WP_000190023.1.77646 WP_000190023.1.77692 WP_000190023.1.7782 WP_000190023.1.77851 WP_000190023.1.77871 WP_000190023.1.77898 WP_000190023.1.77918 WP_000190023.1.77960 WP_000190023.1.78 WP_000190023.1.78033 WP_000190023.1.78076 WP_000190023.1.78096 WP_000190023.1.78100 WP_000190023.1.78110 WP_000190023.1.78120 WP_000190023.1.78201 WP_000190023.1.78383 WP_000190023.1.78407 WP_000190023.1.78602 WP_000190023.1.7861 WP_000190023.1.78618 WP_000190023.1.78673 WP_000190023.1.78735 WP_000190023.1.78802 WP_000190023.1.78830 WP_000190023.1.78835 WP_000190023.1.78871 WP_000190023.1.78874 WP_000190023.1.78918 WP_000190023.1.78928 WP_000190023.1.78930 WP_000190023.1.79151 WP_000190023.1.79297 WP_000190023.1.79335 WP_000190023.1.79370 WP_000190023.1.794 WP_000190023.1.79462 WP_000190023.1.79472 WP_000190023.1.79495 WP_000190023.1.79529 WP_000190023.1.79570 WP_000190023.1.7964 WP_000190023.1.79642 WP_000190023.1.79668 WP_000190023.1.79708 WP_000190023.1.79738 WP_000190023.1.79845 WP_000190023.1.79892 WP_000190023.1.7994 WP_000190023.1.79996 WP_000190023.1.80077 WP_000190023.1.80182 WP_000190023.1.80293 WP_000190023.1.80296 WP_000190023.1.80366 WP_000190023.1.80443 WP_000190023.1.80529 WP_000190023.1.80542 WP_000190023.1.80586 WP_000190023.1.80725 WP_000190023.1.80757 WP_000190023.1.80780 WP_000190023.1.80831 WP_000190023.1.80850 WP_000190023.1.80881 WP_000190023.1.80939 WP_000190023.1.8096 WP_000190023.1.81037 WP_000190023.1.81069 WP_000190023.1.81149 WP_000190023.1.81175 WP_000190023.1.8119 WP_000190023.1.81193 WP_000190023.1.81354 WP_000190023.1.81404 WP_000190023.1.81410 WP_000190023.1.81425 WP_000190023.1.81667 WP_000190023.1.81750 WP_000190023.1.81760 WP_000190023.1.81785 WP_000190023.1.81795 WP_000190023.1.81902 WP_000190023.1.81941 WP_000190023.1.81965 WP_000190023.1.81974 WP_000190023.1.82337 WP_000190023.1.82395 WP_000190023.1.82479 WP_000190023.1.82503 WP_000190023.1.82515 WP_000190023.1.82529 WP_000190023.1.82761 WP_000190023.1.8282 WP_000190023.1.82841 WP_000190023.1.82843 WP_000190023.1.82867 WP_000190023.1.82895 WP_000190023.1.82908 WP_000190023.1.82944 WP_000190023.1.82956 WP_000190023.1.82964 WP_000190023.1.82992 WP_000190023.1.83061 WP_000190023.1.83092 WP_000190023.1.83139 WP_000190023.1.83163 WP_000190023.1.8322 WP_000190023.1.83301 WP_000190023.1.83305 WP_000190023.1.83365 WP_000190023.1.83407 WP_000190023.1.83413 WP_000190023.1.83491 WP_000190023.1.83523 WP_000190023.1.83598 WP_000190023.1.83650 WP_000190023.1.83721 WP_000190023.1.83739 WP_000190023.1.83759 WP_000190023.1.83760 WP_000190023.1.83979 WP_000190023.1.84100 WP_000190023.1.84103 WP_000190023.1.84179 WP_000190023.1.84283 WP_000190023.1.84355 WP_000190023.1.84359 WP_000190023.1.84373 WP_000190023.1.84392 WP_000190023.1.8441 WP_000190023.1.84459 WP_000190023.1.84475 WP_000190023.1.84532 WP_000190023.1.84554 WP_000190023.1.84644 WP_000190023.1.84659 WP_000190023.1.84693 WP_000190023.1.84899 WP_000190023.1.8497 WP_000190023.1.85014 WP_000190023.1.85040 WP_000190023.1.85120 WP_000190023.1.85147 WP_000190023.1.85178 WP_000190023.1.85180 WP_000190023.1.85190 WP_000190023.1.8533 WP_000190023.1.8537 WP_000190023.1.8545 WP_000190023.1.85456 WP_000190023.1.85481 WP_000190023.1.85483 WP_000190023.1.8552 WP_000190023.1.85541 WP_000190023.1.8556 WP_000190023.1.85615 WP_000190023.1.85617 WP_000190023.1.85663 WP_000190023.1.85671 WP_000190023.1.85672 WP_000190023.1.85777 WP_000190023.1.85780 WP_000190023.1.85855 WP_000190023.1.85886 WP_000190023.1.85900 WP_000190023.1.85904 WP_000190023.1.85976 WP_000190023.1.86017 WP_000190023.1.86224 WP_000190023.1.86306 WP_000190023.1.86356 WP_000190023.1.86450 WP_000190023.1.86453 WP_000190023.1.86469 WP_000190023.1.86580 WP_000190023.1.86588 WP_000190023.1.86593 WP_000190023.1.86634 WP_000190023.1.86661 WP_000190023.1.8672 WP_000190023.1.8678 WP_000190023.1.86810 WP_000190023.1.8684 WP_000190023.1.86859 WP_000190023.1.86895 WP_000190023.1.86906 WP_000190023.1.86982 WP_000190023.1.87219 WP_000190023.1.87323 WP_000190023.1.8736 WP_000190023.1.87365 WP_000190023.1.87460 WP_000190023.1.87493 WP_000190023.1.87626 WP_000190023.1.87779 WP_000190023.1.87875 WP_000190023.1.88019 WP_000190023.1.8809 WP_000190023.1.88244 WP_000190023.1.88291 WP_000190023.1.88293 WP_000190023.1.88303 WP_000190023.1.8837 WP_000190023.1.88393 WP_000190023.1.8849 WP_000190023.1.88624 WP_000190023.1.88703 WP_000190023.1.88762 WP_000190023.1.88792 WP_000190023.1.88902 WP_000190023.1.8891 WP_000190023.1.88942 WP_000190023.1.88981 WP_000190023.1.89116 WP_000190023.1.89291 WP_000190023.1.89512 WP_000190023.1.89527 WP_000190023.1.89604 WP_000190023.1.89622 WP_000190023.1.89659 WP_000190023.1.89789 WP_000190023.1.89815 WP_000190023.1.89870 WP_000190023.1.89902 WP_000190023.1.89940 WP_000190023.1.8996 WP_000190023.1.89975 WP_000190023.1.9002 WP_000190023.1.90084 WP_000190023.1.90097 WP_000190023.1.90252 WP_000190023.1.90409 WP_000190023.1.90417 WP_000190023.1.90453 WP_000190023.1.90458 WP_000190023.1.90472 WP_000190023.1.90557 WP_000190023.1.90585 WP_000190023.1.90641 WP_000190023.1.90734 WP_000190023.1.90814 WP_000190023.1.90866 WP_000190023.1.9093 WP_000190023.1.91003 WP_000190023.1.91049 WP_000190023.1.91069 WP_000190023.1.91156 WP_000190023.1.91189 WP_000190023.1.91278 WP_000190023.1.9131 WP_000190023.1.91470 WP_000190023.1.91512 WP_000190023.1.91528 WP_000190023.1.91628 WP_000190023.1.91655 WP_000190023.1.91724 WP_000190023.1.91732 WP_000190023.1.91788 WP_000190023.1.91806 WP_000190023.1.91903 WP_000190023.1.92013 WP_000190023.1.92047 WP_000190023.1.92060 WP_000190023.1.92093 WP_000190023.1.92108 WP_000190023.1.92122 WP_000190023.1.92171 WP_000190023.1.92183 WP_000190023.1.92208 WP_000190023.1.92268 WP_000190023.1.92310 WP_000190023.1.92318 WP_000190023.1.92375 WP_000190023.1.92408 WP_000190023.1.92439 WP_000190023.1.92482 WP_000190023.1.92529 WP_000190023.1.92531 WP_000190023.1.92669 WP_000190023.1.92671 WP_000190023.1.92729 WP_000190023.1.92738 WP_000190023.1.92832 WP_000190023.1.92975 WP_000190023.1.92988 WP_000190023.1.93061 WP_000190023.1.93086 WP_000190023.1.93136 WP_000190023.1.93155 WP_000190023.1.93275 WP_000190023.1.93365 WP_000190023.1.93376 WP_000190023.1.93543 WP_000190023.1.93596 WP_000190023.1.93650 WP_000190023.1.93656 WP_000190023.1.93662 WP_000190023.1.937 WP_000190023.1.93705 WP_000190023.1.93761 WP_000190023.1.93803 WP_000190023.1.93804 WP_000190023.1.9389 WP_000190023.1.93956 WP_000190023.1.93994 WP_000190023.1.94072 WP_000190023.1.94132 WP_000190023.1.94162 WP_000190023.1.94168 WP_000190023.1.94198 WP_000190023.1.9432 WP_000190023.1.94354 WP_000190023.1.94380 WP_000190023.1.94412 WP_000190023.1.94565 WP_000190023.1.94622 WP_000190023.1.94674 WP_000190023.1.94796 WP_000190023.1.9481 WP_000190023.1.94959 WP_000190023.1.94967 WP_000190023.1.94987 WP_000190023.1.95085 WP_000190023.1.95121 WP_000190023.1.9516 WP_000190023.1.95282 WP_000190023.1.95546 WP_000190023.1.95579 WP_000190023.1.95641 WP_000190023.1.95703 WP_000190023.1.95744 WP_000190023.1.95840 WP_000190023.1.95911 WP_000190023.1.95940 WP_000190023.1.9609 WP_000190023.1.96139 WP_000190023.1.96172 WP_000190023.1.96260 WP_000190023.1.96317 WP_000190023.1.96335 WP_000190023.1.96343 WP_000190023.1.9644 WP_000190023.1.96469 WP_000190023.1.96497 WP_000190023.1.96500 WP_000190023.1.96555 WP_000190023.1.96563 WP_000190023.1.96590 WP_000190023.1.96732 WP_000190023.1.96771 WP_000190023.1.96798 WP_000190023.1.96902 WP_000190023.1.96917 WP_000190023.1.97015 WP_000190023.1.97190 WP_000190023.1.97318 WP_000190023.1.97337 WP_000190023.1.97368 WP_000190023.1.97369 WP_000190023.1.97594 WP_000190023.1.97597 WP_000190023.1.97613 WP_000190023.1.97620 WP_000190023.1.97640 WP_000190023.1.97726 WP_000190023.1.97727 WP_000190023.1.97732 WP_000190023.1.97736 WP_000190023.1.9775 WP_000190023.1.97772 WP_000190023.1.97846 WP_000190023.1.97873 WP_000190023.1.98006 WP_000190023.1.98019 WP_000190023.1.98022 WP_000190023.1.98110 WP_000190023.1.98124 WP_000190023.1.98146 WP_000190023.1.98219 WP_000190023.1.98236 WP_000190023.1.98314 WP_000190023.1.98402 WP_000190023.1.9841 WP_000190023.1.98446 WP_000190023.1.98495 WP_000190023.1.98513 WP_000190023.1.98531 WP_000190023.1.98577 WP_000190023.1.98608 WP_000190023.1.98627 WP_000190023.1.98676 WP_000190023.1.98677 WP_000190023.1.98760 WP_000190023.1.98763 WP_000190023.1.98899 WP_000190023.1.9898 WP_000190023.1.99098 WP_000190023.1.99184 WP_000190023.1.9919 WP_000190023.1.99267 WP_000190023.1.99276 WP_000190023.1.9954 WP_000190023.1.99561 WP_000190023.1.99646 WP_000190023.1.99657 WP_000190023.1.99660 WP_000190023.1.99725 WP_000190023.1.99747 WP_000190023.1.99813 WP_000190023.1.99824 WP_000190023.1.99858 WP_000190023.1.99889 WP_000190023.1.99958 gi|16766756|ref|NP_462371.1| gi|378990773|ref|YP_005253937.1| gi|526218589|ref|YP_008263784.1| ABAM02000001|CDS_3992974-3991757 ABAN01000001|CDS_443762-444979 ABAO01000042|CDS_17404-16187 ABFH02000001|CDS_1551382-1552599 AE006468|CDS_3619673-3618456 CP000857|CDS_3552585-3551368 CP001113|CDS_3601691-3600474 FN424405|CDS_3642772-3641555 gi|378446844|ref|YP_005234476.1| 423368.SNSL254_A3739 476213.SPC_3537 99287.STM3468 gi|538364065|ref|YP_008507350.1| gi|482906035|ref|YP_007904595.1| gi|549726023|ref|YP_008646213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]