SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482906230|ref|YP_007904790.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482906230|ref|YP_007904790.1|
Domain Number 1 Region: 16-412
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.44e-57
Family AAT-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|482906230|ref|YP_007904790.1|
Sequence length 416
Comment valine--pyruvate transaminase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MTFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPAHIPAMQDYFQTLLTDMVES
GKAADALCNYDGPQGKTALLNALAVLLRETLGWDIEPQNIALTNGSQSAFFYLFNLFAGR
RADGSTKKVLFPLAPEYIGYADSGLEDDLFVSARPNIELLPEGQFKYHVDFEHLHIGEET
GMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVPFPGIIFSEARPLWNPN
IILCMSLSKLGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMCEMIKRNDLLR
LSETVIKPFYYQRVQQTIAIIRRYLSEERCLIHKPEGAIFLWLWFKDLPITTELLYQRLK
ARGVLMVPGHYFFPGLDKPWPHTHQCMRMNYVPEPDKIEAGVKILAEEIERAWREG
Download sequence
Identical sequences A0A0D6I5R8 A0A0F6B8F7 A0A0F7JCX2 A0A0H3NMV3 A0A0T7RUD7 A0A0T9W4F5 A0A0W4CKN4 A0A1R2HVV0 A0A1Z3Q8N9 A0A221Z7E6 A0A249USZ6 A0A2C6FY80 A0A2D3TQM7 A0A2G1NMC5 A0A2H9YLT0 A0A2I6NYJ5 E8XFX9 Q8ZL86 V1W1K0
gi|198242924|ref|YP_002217625.1| gi|526218436|ref|YP_008263592.1| gi|525945709|ref|YP_008306680.1| gi|379702926|ref|YP_005244654.1| gi|383498298|ref|YP_005398987.1| gi|378447034|ref|YP_005234666.1| gi|549726216|ref|YP_008646406.1| gi|537439048|ref|YP_008483425.1| gi|378957480|ref|YP_005214967.1| 391498 gi|378452541|ref|YP_005239901.1| NP_462565.1.58477 WP_000144381.1.100010 WP_000144381.1.100017 WP_000144381.1.100115 WP_000144381.1.100149 WP_000144381.1.100165 WP_000144381.1.100191 WP_000144381.1.100234 WP_000144381.1.100258 WP_000144381.1.100288 WP_000144381.1.100376 WP_000144381.1.100413 WP_000144381.1.100424 WP_000144381.1.100436 WP_000144381.1.100484 WP_000144381.1.100488 WP_000144381.1.100584 WP_000144381.1.100597 WP_000144381.1.100642 WP_000144381.1.100650 WP_000144381.1.100707 WP_000144381.1.10076 WP_000144381.1.100781 WP_000144381.1.100793 WP_000144381.1.100869 WP_000144381.1.100882 WP_000144381.1.100886 WP_000144381.1.101007 WP_000144381.1.101020 WP_000144381.1.101074 WP_000144381.1.101078 WP_000144381.1.101091 WP_000144381.1.101123 WP_000144381.1.101180 WP_000144381.1.101259 WP_000144381.1.101284 WP_000144381.1.101291 WP_000144381.1.101320 WP_000144381.1.101353 WP_000144381.1.101386 WP_000144381.1.101404 WP_000144381.1.101420 WP_000144381.1.101520 WP_000144381.1.101589 WP_000144381.1.101612 WP_000144381.1.101634 WP_000144381.1.101674 WP_000144381.1.101707 WP_000144381.1.101734 WP_000144381.1.101832 WP_000144381.1.101878 WP_000144381.1.101927 WP_000144381.1.101953 WP_000144381.1.10220 WP_000144381.1.10237 WP_000144381.1.10266 WP_000144381.1.10310 WP_000144381.1.10429 WP_000144381.1.10439 WP_000144381.1.10463 WP_000144381.1.10498 WP_000144381.1.10631 WP_000144381.1.10678 WP_000144381.1.10720 WP_000144381.1.10753 WP_000144381.1.10755 WP_000144381.1.10868 WP_000144381.1.10898 WP_000144381.1.10992 WP_000144381.1.11000 WP_000144381.1.11024 WP_000144381.1.11031 WP_000144381.1.11098 WP_000144381.1.11168 WP_000144381.1.11190 WP_000144381.1.11295 WP_000144381.1.11304 WP_000144381.1.11405 WP_000144381.1.11455 WP_000144381.1.11458 WP_000144381.1.11518 WP_000144381.1.11526 WP_000144381.1.11532 WP_000144381.1.11543 WP_000144381.1.11544 WP_000144381.1.1169 WP_000144381.1.1174 WP_000144381.1.11763 WP_000144381.1.11772 WP_000144381.1.11824 WP_000144381.1.11841 WP_000144381.1.11897 WP_000144381.1.12025 WP_000144381.1.12106 WP_000144381.1.12114 WP_000144381.1.12160 WP_000144381.1.12168 WP_000144381.1.12244 WP_000144381.1.12280 WP_000144381.1.12340 WP_000144381.1.12351 WP_000144381.1.12370 WP_000144381.1.12374 WP_000144381.1.1239 WP_000144381.1.12485 WP_000144381.1.12546 WP_000144381.1.12569 WP_000144381.1.12584 WP_000144381.1.12585 WP_000144381.1.1264 WP_000144381.1.12728 WP_000144381.1.12879 WP_000144381.1.12936 WP_000144381.1.12995 WP_000144381.1.13027 WP_000144381.1.13076 WP_000144381.1.13130 WP_000144381.1.13247 WP_000144381.1.13334 WP_000144381.1.13367 WP_000144381.1.13414 WP_000144381.1.13446 WP_000144381.1.13488 WP_000144381.1.13509 WP_000144381.1.13573 WP_000144381.1.13669 WP_000144381.1.13677 WP_000144381.1.13691 WP_000144381.1.13741 WP_000144381.1.13819 WP_000144381.1.1387 WP_000144381.1.13908 WP_000144381.1.13932 WP_000144381.1.13968 WP_000144381.1.14001 WP_000144381.1.14151 WP_000144381.1.14212 WP_000144381.1.14239 WP_000144381.1.14286 WP_000144381.1.14320 WP_000144381.1.14379 WP_000144381.1.14406 WP_000144381.1.14410 WP_000144381.1.14466 WP_000144381.1.14516 WP_000144381.1.14524 WP_000144381.1.14554 WP_000144381.1.146 WP_000144381.1.14688 WP_000144381.1.14706 WP_000144381.1.14708 WP_000144381.1.14725 WP_000144381.1.14819 WP_000144381.1.14852 WP_000144381.1.1489 WP_000144381.1.14913 WP_000144381.1.14932 WP_000144381.1.14936 WP_000144381.1.15046 WP_000144381.1.15055 WP_000144381.1.15067 WP_000144381.1.15079 WP_000144381.1.15124 WP_000144381.1.15214 WP_000144381.1.15223 WP_000144381.1.15226 WP_000144381.1.15316 WP_000144381.1.15318 WP_000144381.1.15369 WP_000144381.1.1540 WP_000144381.1.15508 WP_000144381.1.15612 WP_000144381.1.15644 WP_000144381.1.1568 WP_000144381.1.15777 WP_000144381.1.15784 WP_000144381.1.158 WP_000144381.1.15830 WP_000144381.1.15881 WP_000144381.1.15909 WP_000144381.1.15995 WP_000144381.1.16028 WP_000144381.1.16032 WP_000144381.1.16062 WP_000144381.1.16063 WP_000144381.1.16103 WP_000144381.1.16166 WP_000144381.1.16226 WP_000144381.1.16233 WP_000144381.1.16284 WP_000144381.1.16328 WP_000144381.1.1635 WP_000144381.1.16365 WP_000144381.1.16453 WP_000144381.1.16468 WP_000144381.1.16614 WP_000144381.1.16650 WP_000144381.1.16686 WP_000144381.1.16691 WP_000144381.1.167 WP_000144381.1.16729 WP_000144381.1.16732 WP_000144381.1.16735 WP_000144381.1.16786 WP_000144381.1.16819 WP_000144381.1.16858 WP_000144381.1.16896 WP_000144381.1.16916 WP_000144381.1.16944 WP_000144381.1.16965 WP_000144381.1.16972 WP_000144381.1.1700 WP_000144381.1.17096 WP_000144381.1.17098 WP_000144381.1.17105 WP_000144381.1.17307 WP_000144381.1.1733 WP_000144381.1.174 WP_000144381.1.17480 WP_000144381.1.17482 WP_000144381.1.17504 WP_000144381.1.17546 WP_000144381.1.17702 WP_000144381.1.17705 WP_000144381.1.17732 WP_000144381.1.17747 WP_000144381.1.17865 WP_000144381.1.17914 WP_000144381.1.17919 WP_000144381.1.18019 WP_000144381.1.18061 WP_000144381.1.1807 WP_000144381.1.18109 WP_000144381.1.18111 WP_000144381.1.18163 WP_000144381.1.18178 WP_000144381.1.18265 WP_000144381.1.18267 WP_000144381.1.18281 WP_000144381.1.18282 WP_000144381.1.18468 WP_000144381.1.18607 WP_000144381.1.18692 WP_000144381.1.18705 WP_000144381.1.18715 WP_000144381.1.18776 WP_000144381.1.18822 WP_000144381.1.18881 WP_000144381.1.18940 WP_000144381.1.18949 WP_000144381.1.1895 WP_000144381.1.19053 WP_000144381.1.19055 WP_000144381.1.19093 WP_000144381.1.19320 WP_000144381.1.19373 WP_000144381.1.19433 WP_000144381.1.19458 WP_000144381.1.19460 WP_000144381.1.19461 WP_000144381.1.1955 WP_000144381.1.19614 WP_000144381.1.19642 WP_000144381.1.19656 WP_000144381.1.19702 WP_000144381.1.19706 WP_000144381.1.19724 WP_000144381.1.19749 WP_000144381.1.19784 WP_000144381.1.19802 WP_000144381.1.19809 WP_000144381.1.19823 WP_000144381.1.19834 WP_000144381.1.19851 WP_000144381.1.19867 WP_000144381.1.1998 WP_000144381.1.20 WP_000144381.1.20086 WP_000144381.1.20089 WP_000144381.1.2010 WP_000144381.1.20119 WP_000144381.1.20212 WP_000144381.1.20261 WP_000144381.1.20266 WP_000144381.1.20271 WP_000144381.1.20330 WP_000144381.1.20362 WP_000144381.1.2041 WP_000144381.1.20418 WP_000144381.1.20437 WP_000144381.1.20443 WP_000144381.1.20525 WP_000144381.1.2054 WP_000144381.1.20573 WP_000144381.1.20626 WP_000144381.1.20646 WP_000144381.1.20700 WP_000144381.1.20721 WP_000144381.1.20767 WP_000144381.1.20789 WP_000144381.1.20839 WP_000144381.1.20886 WP_000144381.1.20908 WP_000144381.1.2101 WP_000144381.1.21049 WP_000144381.1.2107 WP_000144381.1.21086 WP_000144381.1.21146 WP_000144381.1.21165 WP_000144381.1.21194 WP_000144381.1.21202 WP_000144381.1.21241 WP_000144381.1.21245 WP_000144381.1.21246 WP_000144381.1.21269 WP_000144381.1.21332 WP_000144381.1.21400 WP_000144381.1.21497 WP_000144381.1.21499 WP_000144381.1.21548 WP_000144381.1.21603 WP_000144381.1.21616 WP_000144381.1.21715 WP_000144381.1.21750 WP_000144381.1.21751 WP_000144381.1.21757 WP_000144381.1.21845 WP_000144381.1.21909 WP_000144381.1.22019 WP_000144381.1.22024 WP_000144381.1.2205 WP_000144381.1.22062 WP_000144381.1.22067 WP_000144381.1.22117 WP_000144381.1.22158 WP_000144381.1.22162 WP_000144381.1.2221 WP_000144381.1.22315 WP_000144381.1.22337 WP_000144381.1.2235 WP_000144381.1.22379 WP_000144381.1.22427 WP_000144381.1.22453 WP_000144381.1.22454 WP_000144381.1.2246 WP_000144381.1.22485 WP_000144381.1.22537 WP_000144381.1.22582 WP_000144381.1.22590 WP_000144381.1.22604 WP_000144381.1.22605 WP_000144381.1.22620 WP_000144381.1.22857 WP_000144381.1.22870 WP_000144381.1.22880 WP_000144381.1.22902 WP_000144381.1.22947 WP_000144381.1.22979 WP_000144381.1.23010 WP_000144381.1.23102 WP_000144381.1.23114 WP_000144381.1.2314 WP_000144381.1.23155 WP_000144381.1.23169 WP_000144381.1.23192 WP_000144381.1.23259 WP_000144381.1.23309 WP_000144381.1.23409 WP_000144381.1.23460 WP_000144381.1.23472 WP_000144381.1.23482 WP_000144381.1.23485 WP_000144381.1.23503 WP_000144381.1.23587 WP_000144381.1.23629 WP_000144381.1.23631 WP_000144381.1.23634 WP_000144381.1.2364 WP_000144381.1.23643 WP_000144381.1.23670 WP_000144381.1.23685 WP_000144381.1.23746 WP_000144381.1.23819 WP_000144381.1.23932 WP_000144381.1.24017 WP_000144381.1.24158 WP_000144381.1.24206 WP_000144381.1.24214 WP_000144381.1.24250 WP_000144381.1.24308 WP_000144381.1.24361 WP_000144381.1.24408 WP_000144381.1.24409 WP_000144381.1.24444 WP_000144381.1.24476 WP_000144381.1.24578 WP_000144381.1.24673 WP_000144381.1.24737 WP_000144381.1.24779 WP_000144381.1.24803 WP_000144381.1.24873 WP_000144381.1.24944 WP_000144381.1.25008 WP_000144381.1.25015 WP_000144381.1.25036 WP_000144381.1.25072 WP_000144381.1.25175 WP_000144381.1.25206 WP_000144381.1.2525 WP_000144381.1.25354 WP_000144381.1.25405 WP_000144381.1.25421 WP_000144381.1.25454 WP_000144381.1.25493 WP_000144381.1.25564 WP_000144381.1.25618 WP_000144381.1.25668 WP_000144381.1.2568 WP_000144381.1.25690 WP_000144381.1.2570 WP_000144381.1.25700 WP_000144381.1.25709 WP_000144381.1.25740 WP_000144381.1.25793 WP_000144381.1.25814 WP_000144381.1.25932 WP_000144381.1.25988 WP_000144381.1.26030 WP_000144381.1.26034 WP_000144381.1.26093 WP_000144381.1.26123 WP_000144381.1.26129 WP_000144381.1.26224 WP_000144381.1.26282 WP_000144381.1.26311 WP_000144381.1.26319 WP_000144381.1.2634 WP_000144381.1.26429 WP_000144381.1.26440 WP_000144381.1.26493 WP_000144381.1.26532 WP_000144381.1.26551 WP_000144381.1.26567 WP_000144381.1.26582 WP_000144381.1.26587 WP_000144381.1.2660 WP_000144381.1.26646 WP_000144381.1.26709 WP_000144381.1.2672 WP_000144381.1.26856 WP_000144381.1.27010 WP_000144381.1.27173 WP_000144381.1.27206 WP_000144381.1.27423 WP_000144381.1.27522 WP_000144381.1.27547 WP_000144381.1.27556 WP_000144381.1.27561 WP_000144381.1.2763 WP_000144381.1.27665 WP_000144381.1.27707 WP_000144381.1.27761 WP_000144381.1.2777 WP_000144381.1.27833 WP_000144381.1.27857 WP_000144381.1.27977 WP_000144381.1.27997 WP_000144381.1.28094 WP_000144381.1.28126 WP_000144381.1.28139 WP_000144381.1.28170 WP_000144381.1.28235 WP_000144381.1.28302 WP_000144381.1.2835 WP_000144381.1.28370 WP_000144381.1.28538 WP_000144381.1.28575 WP_000144381.1.28655 WP_000144381.1.28694 WP_000144381.1.287 WP_000144381.1.28773 WP_000144381.1.2879 WP_000144381.1.2890 WP_000144381.1.28938 WP_000144381.1.28946 WP_000144381.1.29006 WP_000144381.1.29010 WP_000144381.1.2910 WP_000144381.1.29168 WP_000144381.1.29190 WP_000144381.1.29218 WP_000144381.1.29274 WP_000144381.1.2932 WP_000144381.1.29379 WP_000144381.1.29454 WP_000144381.1.29588 WP_000144381.1.29601 WP_000144381.1.29606 WP_000144381.1.29615 WP_000144381.1.29619 WP_000144381.1.29704 WP_000144381.1.29711 WP_000144381.1.29774 WP_000144381.1.29775 WP_000144381.1.29969 WP_000144381.1.30006 WP_000144381.1.30027 WP_000144381.1.3005 WP_000144381.1.30059 WP_000144381.1.30086 WP_000144381.1.30165 WP_000144381.1.3017 WP_000144381.1.30179 WP_000144381.1.30180 WP_000144381.1.30246 WP_000144381.1.30356 WP_000144381.1.30437 WP_000144381.1.30469 WP_000144381.1.30492 WP_000144381.1.30505 WP_000144381.1.30507 WP_000144381.1.30535 WP_000144381.1.30547 WP_000144381.1.30602 WP_000144381.1.30627 WP_000144381.1.3067 WP_000144381.1.30752 WP_000144381.1.30794 WP_000144381.1.30833 WP_000144381.1.30835 WP_000144381.1.30968 WP_000144381.1.30972 WP_000144381.1.31 WP_000144381.1.3113 WP_000144381.1.31167 WP_000144381.1.31171 WP_000144381.1.31185 WP_000144381.1.3119 WP_000144381.1.31190 WP_000144381.1.31195 WP_000144381.1.31196 WP_000144381.1.31219 WP_000144381.1.31222 WP_000144381.1.31251 WP_000144381.1.31272 WP_000144381.1.31281 WP_000144381.1.31335 WP_000144381.1.31362 WP_000144381.1.31504 WP_000144381.1.31578 WP_000144381.1.31585 WP_000144381.1.31658 WP_000144381.1.3167 WP_000144381.1.31762 WP_000144381.1.31782 WP_000144381.1.31901 WP_000144381.1.31940 WP_000144381.1.31967 WP_000144381.1.31972 WP_000144381.1.31983 WP_000144381.1.32109 WP_000144381.1.32116 WP_000144381.1.32192 WP_000144381.1.32206 WP_000144381.1.32252 WP_000144381.1.32274 WP_000144381.1.32309 WP_000144381.1.32423 WP_000144381.1.32434 WP_000144381.1.32438 WP_000144381.1.32515 WP_000144381.1.32519 WP_000144381.1.32527 WP_000144381.1.32629 WP_000144381.1.32660 WP_000144381.1.32702 WP_000144381.1.32714 WP_000144381.1.32750 WP_000144381.1.32786 WP_000144381.1.32804 WP_000144381.1.32832 WP_000144381.1.32860 WP_000144381.1.32881 WP_000144381.1.32899 WP_000144381.1.32900 WP_000144381.1.32907 WP_000144381.1.33030 WP_000144381.1.33078 WP_000144381.1.33127 WP_000144381.1.33143 WP_000144381.1.33160 WP_000144381.1.33248 WP_000144381.1.33253 WP_000144381.1.33261 WP_000144381.1.333 WP_000144381.1.33392 WP_000144381.1.33409 WP_000144381.1.33492 WP_000144381.1.33499 WP_000144381.1.33553 WP_000144381.1.33586 WP_000144381.1.33592 WP_000144381.1.33629 WP_000144381.1.33865 WP_000144381.1.33894 WP_000144381.1.3396 WP_000144381.1.34 WP_000144381.1.34043 WP_000144381.1.34075 WP_000144381.1.34107 WP_000144381.1.34126 WP_000144381.1.34185 WP_000144381.1.34257 WP_000144381.1.34259 WP_000144381.1.34279 WP_000144381.1.34319 WP_000144381.1.34330 WP_000144381.1.34431 WP_000144381.1.34453 WP_000144381.1.34454 WP_000144381.1.34610 WP_000144381.1.34667 WP_000144381.1.34684 WP_000144381.1.3476 WP_000144381.1.34820 WP_000144381.1.34856 WP_000144381.1.3489 WP_000144381.1.34975 WP_000144381.1.34977 WP_000144381.1.35045 WP_000144381.1.35129 WP_000144381.1.35184 WP_000144381.1.35219 WP_000144381.1.35332 WP_000144381.1.35404 WP_000144381.1.35408 WP_000144381.1.35425 WP_000144381.1.35429 WP_000144381.1.35446 WP_000144381.1.35463 WP_000144381.1.35503 WP_000144381.1.35509 WP_000144381.1.35563 WP_000144381.1.35590 WP_000144381.1.35594 WP_000144381.1.35619 WP_000144381.1.3566 WP_000144381.1.3572 WP_000144381.1.35887 WP_000144381.1.35940 WP_000144381.1.35961 WP_000144381.1.36003 WP_000144381.1.3601 WP_000144381.1.36011 WP_000144381.1.36037 WP_000144381.1.36232 WP_000144381.1.36609 WP_000144381.1.36685 WP_000144381.1.36690 WP_000144381.1.3670 WP_000144381.1.36889 WP_000144381.1.36918 WP_000144381.1.36931 WP_000144381.1.36949 WP_000144381.1.37063 WP_000144381.1.37073 WP_000144381.1.37111 WP_000144381.1.37112 WP_000144381.1.37114 WP_000144381.1.37190 WP_000144381.1.37191 WP_000144381.1.37256 WP_000144381.1.3726 WP_000144381.1.37293 WP_000144381.1.37370 WP_000144381.1.37376 WP_000144381.1.37405 WP_000144381.1.3744 WP_000144381.1.37498 WP_000144381.1.37504 WP_000144381.1.37618 WP_000144381.1.37666 WP_000144381.1.37687 WP_000144381.1.3778 WP_000144381.1.37848 WP_000144381.1.3790 WP_000144381.1.37968 WP_000144381.1.37978 WP_000144381.1.38001 WP_000144381.1.38026 WP_000144381.1.38125 WP_000144381.1.38145 WP_000144381.1.383 WP_000144381.1.38341 WP_000144381.1.38344 WP_000144381.1.3848 WP_000144381.1.38613 WP_000144381.1.38673 WP_000144381.1.3869 WP_000144381.1.38693 WP_000144381.1.38773 WP_000144381.1.38882 WP_000144381.1.3891 WP_000144381.1.39003 WP_000144381.1.39038 WP_000144381.1.39048 WP_000144381.1.39136 WP_000144381.1.39197 WP_000144381.1.39229 WP_000144381.1.39385 WP_000144381.1.39405 WP_000144381.1.39414 WP_000144381.1.39420 WP_000144381.1.39449 WP_000144381.1.39466 WP_000144381.1.39512 WP_000144381.1.39556 WP_000144381.1.39576 WP_000144381.1.39614 WP_000144381.1.39629 WP_000144381.1.39722 WP_000144381.1.39723 WP_000144381.1.39763 WP_000144381.1.39862 WP_000144381.1.39921 WP_000144381.1.40017 WP_000144381.1.40072 WP_000144381.1.40073 WP_000144381.1.4011 WP_000144381.1.40155 WP_000144381.1.40158 WP_000144381.1.40171 WP_000144381.1.40208 WP_000144381.1.40224 WP_000144381.1.40240 WP_000144381.1.40257 WP_000144381.1.40284 WP_000144381.1.40292 WP_000144381.1.40305 WP_000144381.1.40311 WP_000144381.1.40380 WP_000144381.1.40395 WP_000144381.1.40465 WP_000144381.1.40493 WP_000144381.1.40508 WP_000144381.1.40648 WP_000144381.1.40710 WP_000144381.1.4075 WP_000144381.1.40771 WP_000144381.1.40788 WP_000144381.1.40849 WP_000144381.1.4087 WP_000144381.1.40877 WP_000144381.1.40973 WP_000144381.1.41017 WP_000144381.1.41086 WP_000144381.1.41091 WP_000144381.1.41225 WP_000144381.1.41226 WP_000144381.1.41279 WP_000144381.1.41310 WP_000144381.1.41375 WP_000144381.1.4141 WP_000144381.1.41434 WP_000144381.1.41438 WP_000144381.1.41440 WP_000144381.1.41516 WP_000144381.1.41554 WP_000144381.1.41572 WP_000144381.1.41591 WP_000144381.1.41610 WP_000144381.1.41662 WP_000144381.1.41688 WP_000144381.1.41708 WP_000144381.1.41761 WP_000144381.1.41789 WP_000144381.1.41799 WP_000144381.1.41802 WP_000144381.1.41859 WP_000144381.1.41882 WP_000144381.1.41911 WP_000144381.1.41949 WP_000144381.1.41978 WP_000144381.1.41979 WP_000144381.1.41985 WP_000144381.1.42104 WP_000144381.1.42136 WP_000144381.1.42248 WP_000144381.1.42263 WP_000144381.1.42320 WP_000144381.1.42322 WP_000144381.1.42342 WP_000144381.1.42392 WP_000144381.1.42422 WP_000144381.1.42595 WP_000144381.1.42605 WP_000144381.1.42685 WP_000144381.1.4276 WP_000144381.1.42767 WP_000144381.1.42864 WP_000144381.1.4288 WP_000144381.1.42923 WP_000144381.1.42932 WP_000144381.1.42957 WP_000144381.1.43018 WP_000144381.1.43041 WP_000144381.1.43086 WP_000144381.1.43244 WP_000144381.1.43312 WP_000144381.1.43334 WP_000144381.1.43351 WP_000144381.1.43437 WP_000144381.1.43522 WP_000144381.1.43606 WP_000144381.1.43613 WP_000144381.1.43668 WP_000144381.1.43685 WP_000144381.1.43886 WP_000144381.1.44005 WP_000144381.1.4404 WP_000144381.1.44043 WP_000144381.1.44099 WP_000144381.1.44121 WP_000144381.1.44187 WP_000144381.1.44250 WP_000144381.1.44310 WP_000144381.1.44386 WP_000144381.1.44397 WP_000144381.1.4440 WP_000144381.1.44443 WP_000144381.1.44474 WP_000144381.1.44479 WP_000144381.1.44607 WP_000144381.1.44633 WP_000144381.1.44640 WP_000144381.1.4467 WP_000144381.1.44678 WP_000144381.1.44747 WP_000144381.1.44781 WP_000144381.1.44791 WP_000144381.1.44833 WP_000144381.1.4485 WP_000144381.1.44877 WP_000144381.1.44927 WP_000144381.1.44950 WP_000144381.1.44971 WP_000144381.1.45067 WP_000144381.1.45074 WP_000144381.1.45079 WP_000144381.1.45098 WP_000144381.1.45138 WP_000144381.1.45177 WP_000144381.1.45184 WP_000144381.1.45259 WP_000144381.1.45344 WP_000144381.1.45349 WP_000144381.1.45351 WP_000144381.1.45365 WP_000144381.1.45432 WP_000144381.1.45535 WP_000144381.1.45544 WP_000144381.1.45549 WP_000144381.1.45550 WP_000144381.1.45585 WP_000144381.1.45660 WP_000144381.1.45690 WP_000144381.1.45797 WP_000144381.1.458 WP_000144381.1.45844 WP_000144381.1.4592 WP_000144381.1.46011 WP_000144381.1.46069 WP_000144381.1.46112 WP_000144381.1.46173 WP_000144381.1.46174 WP_000144381.1.46187 WP_000144381.1.46203 WP_000144381.1.46215 WP_000144381.1.46232 WP_000144381.1.46286 WP_000144381.1.46406 WP_000144381.1.46444 WP_000144381.1.46574 WP_000144381.1.46578 WP_000144381.1.46595 WP_000144381.1.46620 WP_000144381.1.46666 WP_000144381.1.46675 WP_000144381.1.4671 WP_000144381.1.4674 WP_000144381.1.46749 WP_000144381.1.46930 WP_000144381.1.46967 WP_000144381.1.47057 WP_000144381.1.47067 WP_000144381.1.47214 WP_000144381.1.47257 WP_000144381.1.47429 WP_000144381.1.47448 WP_000144381.1.4747 WP_000144381.1.47472 WP_000144381.1.47478 WP_000144381.1.47576 WP_000144381.1.4758 WP_000144381.1.47621 WP_000144381.1.4769 WP_000144381.1.47799 WP_000144381.1.47814 WP_000144381.1.47829 WP_000144381.1.47902 WP_000144381.1.47928 WP_000144381.1.4795 WP_000144381.1.47988 WP_000144381.1.48209 WP_000144381.1.48242 WP_000144381.1.48244 WP_000144381.1.48253 WP_000144381.1.48268 WP_000144381.1.483 WP_000144381.1.48367 WP_000144381.1.48377 WP_000144381.1.48399 WP_000144381.1.48455 WP_000144381.1.48524 WP_000144381.1.4853 WP_000144381.1.48570 WP_000144381.1.48788 WP_000144381.1.48797 WP_000144381.1.4885 WP_000144381.1.48894 WP_000144381.1.48896 WP_000144381.1.48919 WP_000144381.1.48985 WP_000144381.1.49084 WP_000144381.1.49155 WP_000144381.1.49204 WP_000144381.1.49239 WP_000144381.1.49256 WP_000144381.1.49276 WP_000144381.1.49290 WP_000144381.1.49309 WP_000144381.1.49311 WP_000144381.1.49334 WP_000144381.1.49340 WP_000144381.1.49366 WP_000144381.1.49472 WP_000144381.1.49490 WP_000144381.1.49515 WP_000144381.1.49572 WP_000144381.1.49595 WP_000144381.1.49630 WP_000144381.1.49770 WP_000144381.1.4979 WP_000144381.1.49803 WP_000144381.1.49805 WP_000144381.1.49929 WP_000144381.1.50003 WP_000144381.1.50161 WP_000144381.1.50211 WP_000144381.1.50239 WP_000144381.1.50285 WP_000144381.1.50332 WP_000144381.1.50374 WP_000144381.1.50376 WP_000144381.1.50389 WP_000144381.1.50480 WP_000144381.1.5058 WP_000144381.1.50652 WP_000144381.1.50676 WP_000144381.1.50684 WP_000144381.1.50774 WP_000144381.1.50804 WP_000144381.1.50808 WP_000144381.1.5088 WP_000144381.1.50905 WP_000144381.1.50908 WP_000144381.1.50941 WP_000144381.1.51014 WP_000144381.1.51022 WP_000144381.1.51131 WP_000144381.1.51179 WP_000144381.1.51182 WP_000144381.1.51186 WP_000144381.1.51285 WP_000144381.1.51308 WP_000144381.1.5138 WP_000144381.1.51487 WP_000144381.1.51488 WP_000144381.1.51514 WP_000144381.1.51518 WP_000144381.1.51555 WP_000144381.1.51634 WP_000144381.1.51649 WP_000144381.1.51686 WP_000144381.1.51700 WP_000144381.1.51810 WP_000144381.1.51911 WP_000144381.1.51930 WP_000144381.1.51932 WP_000144381.1.51989 WP_000144381.1.52121 WP_000144381.1.52148 WP_000144381.1.52346 WP_000144381.1.52353 WP_000144381.1.52361 WP_000144381.1.52438 WP_000144381.1.52446 WP_000144381.1.52528 WP_000144381.1.52582 WP_000144381.1.52586 WP_000144381.1.52637 WP_000144381.1.52653 WP_000144381.1.52656 WP_000144381.1.52675 WP_000144381.1.52738 WP_000144381.1.52743 WP_000144381.1.52748 WP_000144381.1.52851 WP_000144381.1.52857 WP_000144381.1.52858 WP_000144381.1.52898 WP_000144381.1.52915 WP_000144381.1.53107 WP_000144381.1.53119 WP_000144381.1.5316 WP_000144381.1.53190 WP_000144381.1.53198 WP_000144381.1.53234 WP_000144381.1.53406 WP_000144381.1.53436 WP_000144381.1.53466 WP_000144381.1.53529 WP_000144381.1.53534 WP_000144381.1.53543 WP_000144381.1.53696 WP_000144381.1.53757 WP_000144381.1.53772 WP_000144381.1.53781 WP_000144381.1.53790 WP_000144381.1.53812 WP_000144381.1.53896 WP_000144381.1.53935 WP_000144381.1.53961 WP_000144381.1.54033 WP_000144381.1.54068 WP_000144381.1.54075 WP_000144381.1.54085 WP_000144381.1.54196 WP_000144381.1.542 WP_000144381.1.54209 WP_000144381.1.54271 WP_000144381.1.54273 WP_000144381.1.54274 WP_000144381.1.54283 WP_000144381.1.54319 WP_000144381.1.54324 WP_000144381.1.54364 WP_000144381.1.54366 WP_000144381.1.54400 WP_000144381.1.54469 WP_000144381.1.54569 WP_000144381.1.54615 WP_000144381.1.54644 WP_000144381.1.54662 WP_000144381.1.54722 WP_000144381.1.54749 WP_000144381.1.54764 WP_000144381.1.54774 WP_000144381.1.54833 WP_000144381.1.5485 WP_000144381.1.54936 WP_000144381.1.55008 WP_000144381.1.55152 WP_000144381.1.5523 WP_000144381.1.55285 WP_000144381.1.55294 WP_000144381.1.55475 WP_000144381.1.55477 WP_000144381.1.55496 WP_000144381.1.5552 WP_000144381.1.55528 WP_000144381.1.55545 WP_000144381.1.5555 WP_000144381.1.55559 WP_000144381.1.55623 WP_000144381.1.55640 WP_000144381.1.55718 WP_000144381.1.55743 WP_000144381.1.55768 WP_000144381.1.55782 WP_000144381.1.55796 WP_000144381.1.55853 WP_000144381.1.55948 WP_000144381.1.55993 WP_000144381.1.55995 WP_000144381.1.56002 WP_000144381.1.56012 WP_000144381.1.56097 WP_000144381.1.56105 WP_000144381.1.56238 WP_000144381.1.56286 WP_000144381.1.56303 WP_000144381.1.56304 WP_000144381.1.5633 WP_000144381.1.56370 WP_000144381.1.56389 WP_000144381.1.56396 WP_000144381.1.56414 WP_000144381.1.56438 WP_000144381.1.56560 WP_000144381.1.56597 WP_000144381.1.56601 WP_000144381.1.56614 WP_000144381.1.56671 WP_000144381.1.5668 WP_000144381.1.56682 WP_000144381.1.56824 WP_000144381.1.56851 WP_000144381.1.56853 WP_000144381.1.56875 WP_000144381.1.56877 WP_000144381.1.56893 WP_000144381.1.56898 WP_000144381.1.56905 WP_000144381.1.56950 WP_000144381.1.57039 WP_000144381.1.57056 WP_000144381.1.57168 WP_000144381.1.57187 WP_000144381.1.57232 WP_000144381.1.57296 WP_000144381.1.57307 WP_000144381.1.57362 WP_000144381.1.57377 WP_000144381.1.57418 WP_000144381.1.57433 WP_000144381.1.57515 WP_000144381.1.57529 WP_000144381.1.57555 WP_000144381.1.57576 WP_000144381.1.57601 WP_000144381.1.57607 WP_000144381.1.57631 WP_000144381.1.57763 WP_000144381.1.57797 WP_000144381.1.57862 WP_000144381.1.57890 WP_000144381.1.57891 WP_000144381.1.57978 WP_000144381.1.5801 WP_000144381.1.58040 WP_000144381.1.58041 WP_000144381.1.58144 WP_000144381.1.58290 WP_000144381.1.58418 WP_000144381.1.58442 WP_000144381.1.58486 WP_000144381.1.5854 WP_000144381.1.58548 WP_000144381.1.5858 WP_000144381.1.58604 WP_000144381.1.58662 WP_000144381.1.58669 WP_000144381.1.587 WP_000144381.1.58744 WP_000144381.1.58745 WP_000144381.1.58749 WP_000144381.1.58803 WP_000144381.1.58836 WP_000144381.1.5886 WP_000144381.1.58884 WP_000144381.1.58926 WP_000144381.1.59094 WP_000144381.1.59224 WP_000144381.1.59294 WP_000144381.1.59335 WP_000144381.1.59336 WP_000144381.1.59375 WP_000144381.1.59381 WP_000144381.1.59458 WP_000144381.1.59490 WP_000144381.1.59508 WP_000144381.1.5953 WP_000144381.1.59538 WP_000144381.1.59641 WP_000144381.1.59684 WP_000144381.1.59694 WP_000144381.1.59771 WP_000144381.1.5979 WP_000144381.1.59830 WP_000144381.1.59953 WP_000144381.1.60008 WP_000144381.1.60015 WP_000144381.1.60021 WP_000144381.1.60052 WP_000144381.1.60069 WP_000144381.1.60126 WP_000144381.1.60137 WP_000144381.1.60140 WP_000144381.1.60155 WP_000144381.1.60226 WP_000144381.1.60285 WP_000144381.1.60320 WP_000144381.1.60379 WP_000144381.1.60464 WP_000144381.1.60597 WP_000144381.1.60794 WP_000144381.1.608 WP_000144381.1.60866 WP_000144381.1.60874 WP_000144381.1.60897 WP_000144381.1.60919 WP_000144381.1.60941 WP_000144381.1.61078 WP_000144381.1.6114 WP_000144381.1.61218 WP_000144381.1.61232 WP_000144381.1.6129 WP_000144381.1.61296 WP_000144381.1.61345 WP_000144381.1.61417 WP_000144381.1.61497 WP_000144381.1.61519 WP_000144381.1.61574 WP_000144381.1.61595 WP_000144381.1.61609 WP_000144381.1.6164 WP_000144381.1.61671 WP_000144381.1.61712 WP_000144381.1.61714 WP_000144381.1.61730 WP_000144381.1.61783 WP_000144381.1.61857 WP_000144381.1.61908 WP_000144381.1.61918 WP_000144381.1.61952 WP_000144381.1.62007 WP_000144381.1.62025 WP_000144381.1.62158 WP_000144381.1.62204 WP_000144381.1.62219 WP_000144381.1.62241 WP_000144381.1.62245 WP_000144381.1.62304 WP_000144381.1.62364 WP_000144381.1.62374 WP_000144381.1.62403 WP_000144381.1.62412 WP_000144381.1.6253 WP_000144381.1.62564 WP_000144381.1.62570 WP_000144381.1.62745 WP_000144381.1.62757 WP_000144381.1.62798 WP_000144381.1.62853 WP_000144381.1.62903 WP_000144381.1.62910 WP_000144381.1.6292 WP_000144381.1.62955 WP_000144381.1.62983 WP_000144381.1.63045 WP_000144381.1.63063 WP_000144381.1.63118 WP_000144381.1.63135 WP_000144381.1.63150 WP_000144381.1.63181 WP_000144381.1.63203 WP_000144381.1.63256 WP_000144381.1.63290 WP_000144381.1.63358 WP_000144381.1.63382 WP_000144381.1.63422 WP_000144381.1.63432 WP_000144381.1.63461 WP_000144381.1.63479 WP_000144381.1.63497 WP_000144381.1.63509 WP_000144381.1.63532 WP_000144381.1.63577 WP_000144381.1.63603 WP_000144381.1.63664 WP_000144381.1.63677 WP_000144381.1.63718 WP_000144381.1.63731 WP_000144381.1.6375 WP_000144381.1.63757 WP_000144381.1.63766 WP_000144381.1.63831 WP_000144381.1.63834 WP_000144381.1.63863 WP_000144381.1.63934 WP_000144381.1.64007 WP_000144381.1.64046 WP_000144381.1.64072 WP_000144381.1.64121 WP_000144381.1.64157 WP_000144381.1.64229 WP_000144381.1.6423 WP_000144381.1.64244 WP_000144381.1.64266 WP_000144381.1.64350 WP_000144381.1.6437 WP_000144381.1.64374 WP_000144381.1.64403 WP_000144381.1.64500 WP_000144381.1.64569 WP_000144381.1.64649 WP_000144381.1.64702 WP_000144381.1.64711 WP_000144381.1.64757 WP_000144381.1.64781 WP_000144381.1.64831 WP_000144381.1.6489 WP_000144381.1.65018 WP_000144381.1.65027 WP_000144381.1.65028 WP_000144381.1.65163 WP_000144381.1.65171 WP_000144381.1.65248 WP_000144381.1.6535 WP_000144381.1.65474 WP_000144381.1.65508 WP_000144381.1.65572 WP_000144381.1.65633 WP_000144381.1.6565 WP_000144381.1.65696 WP_000144381.1.6572 WP_000144381.1.6575 WP_000144381.1.65782 WP_000144381.1.65795 WP_000144381.1.65881 WP_000144381.1.6595 WP_000144381.1.66122 WP_000144381.1.66235 WP_000144381.1.66270 WP_000144381.1.66289 WP_000144381.1.6630 WP_000144381.1.66314 WP_000144381.1.66358 WP_000144381.1.66362 WP_000144381.1.6638 WP_000144381.1.6640 WP_000144381.1.66400 WP_000144381.1.66428 WP_000144381.1.66492 WP_000144381.1.66600 WP_000144381.1.66698 WP_000144381.1.66733 WP_000144381.1.6680 WP_000144381.1.66834 WP_000144381.1.66876 WP_000144381.1.66901 WP_000144381.1.66937 WP_000144381.1.66962 WP_000144381.1.67037 WP_000144381.1.67045 WP_000144381.1.67075 WP_000144381.1.6710 WP_000144381.1.67181 WP_000144381.1.67268 WP_000144381.1.67288 WP_000144381.1.67347 WP_000144381.1.67465 WP_000144381.1.67552 WP_000144381.1.67682 WP_000144381.1.67829 WP_000144381.1.67887 WP_000144381.1.67924 WP_000144381.1.67932 WP_000144381.1.67977 WP_000144381.1.68036 WP_000144381.1.68073 WP_000144381.1.68140 WP_000144381.1.68159 WP_000144381.1.68201 WP_000144381.1.68206 WP_000144381.1.68210 WP_000144381.1.6827 WP_000144381.1.68275 WP_000144381.1.6849 WP_000144381.1.68532 WP_000144381.1.68547 WP_000144381.1.6857 WP_000144381.1.6858 WP_000144381.1.68589 WP_000144381.1.68591 WP_000144381.1.68655 WP_000144381.1.68656 WP_000144381.1.68658 WP_000144381.1.6869 WP_000144381.1.68778 WP_000144381.1.68787 WP_000144381.1.6882 WP_000144381.1.68894 WP_000144381.1.68895 WP_000144381.1.68928 WP_000144381.1.68966 WP_000144381.1.68975 WP_000144381.1.69006 WP_000144381.1.69029 WP_000144381.1.6907 WP_000144381.1.69080 WP_000144381.1.6913 WP_000144381.1.69146 WP_000144381.1.69255 WP_000144381.1.69296 WP_000144381.1.69357 WP_000144381.1.69397 WP_000144381.1.69465 WP_000144381.1.69485 WP_000144381.1.69515 WP_000144381.1.69564 WP_000144381.1.69616 WP_000144381.1.69636 WP_000144381.1.69644 WP_000144381.1.69704 WP_000144381.1.69754 WP_000144381.1.69785 WP_000144381.1.69787 WP_000144381.1.69817 WP_000144381.1.69977 WP_000144381.1.70028 WP_000144381.1.70088 WP_000144381.1.7021 WP_000144381.1.70241 WP_000144381.1.70269 WP_000144381.1.70289 WP_000144381.1.70303 WP_000144381.1.70321 WP_000144381.1.70447 WP_000144381.1.70485 WP_000144381.1.70643 WP_000144381.1.70678 WP_000144381.1.70683 WP_000144381.1.70685 WP_000144381.1.70732 WP_000144381.1.70785 WP_000144381.1.70883 WP_000144381.1.70922 WP_000144381.1.70929 WP_000144381.1.70948 WP_000144381.1.70977 WP_000144381.1.70985 WP_000144381.1.71116 WP_000144381.1.71146 WP_000144381.1.71165 WP_000144381.1.71171 WP_000144381.1.71188 WP_000144381.1.71202 WP_000144381.1.71243 WP_000144381.1.71305 WP_000144381.1.71306 WP_000144381.1.71337 WP_000144381.1.71368 WP_000144381.1.71378 WP_000144381.1.71401 WP_000144381.1.71446 WP_000144381.1.71481 WP_000144381.1.71600 WP_000144381.1.71649 WP_000144381.1.71691 WP_000144381.1.71702 WP_000144381.1.7174 WP_000144381.1.71750 WP_000144381.1.71756 WP_000144381.1.71845 WP_000144381.1.71881 WP_000144381.1.71908 WP_000144381.1.71952 WP_000144381.1.71973 WP_000144381.1.720 WP_000144381.1.72065 WP_000144381.1.72068 WP_000144381.1.72105 WP_000144381.1.72119 WP_000144381.1.72182 WP_000144381.1.72190 WP_000144381.1.72203 WP_000144381.1.72220 WP_000144381.1.72221 WP_000144381.1.72226 WP_000144381.1.72234 WP_000144381.1.72300 WP_000144381.1.72325 WP_000144381.1.72339 WP_000144381.1.72372 WP_000144381.1.72376 WP_000144381.1.72382 WP_000144381.1.72470 WP_000144381.1.72532 WP_000144381.1.72594 WP_000144381.1.72625 WP_000144381.1.72629 WP_000144381.1.72827 WP_000144381.1.72871 WP_000144381.1.72872 WP_000144381.1.72887 WP_000144381.1.72897 WP_000144381.1.7295 WP_000144381.1.72968 WP_000144381.1.72975 WP_000144381.1.73062 WP_000144381.1.73068 WP_000144381.1.7315 WP_000144381.1.73200 WP_000144381.1.7334 WP_000144381.1.73377 WP_000144381.1.73481 WP_000144381.1.73535 WP_000144381.1.7356 WP_000144381.1.73561 WP_000144381.1.73581 WP_000144381.1.73596 WP_000144381.1.73617 WP_000144381.1.73667 WP_000144381.1.73669 WP_000144381.1.73753 WP_000144381.1.73758 WP_000144381.1.73764 WP_000144381.1.73794 WP_000144381.1.73804 WP_000144381.1.73831 WP_000144381.1.7387 WP_000144381.1.73901 WP_000144381.1.73924 WP_000144381.1.73926 WP_000144381.1.73945 WP_000144381.1.73956 WP_000144381.1.74029 WP_000144381.1.74117 WP_000144381.1.74181 WP_000144381.1.74191 WP_000144381.1.74248 WP_000144381.1.7433 WP_000144381.1.74379 WP_000144381.1.74410 WP_000144381.1.74414 WP_000144381.1.7444 WP_000144381.1.74481 WP_000144381.1.74529 WP_000144381.1.74545 WP_000144381.1.74620 WP_000144381.1.74745 WP_000144381.1.74972 WP_000144381.1.74992 WP_000144381.1.75129 WP_000144381.1.75148 WP_000144381.1.75187 WP_000144381.1.75288 WP_000144381.1.75334 WP_000144381.1.75362 WP_000144381.1.75385 WP_000144381.1.75392 WP_000144381.1.75402 WP_000144381.1.75703 WP_000144381.1.75760 WP_000144381.1.75764 WP_000144381.1.75794 WP_000144381.1.75810 WP_000144381.1.75828 WP_000144381.1.75837 WP_000144381.1.75863 WP_000144381.1.75873 WP_000144381.1.75874 WP_000144381.1.75884 WP_000144381.1.75902 WP_000144381.1.75932 WP_000144381.1.75945 WP_000144381.1.76020 WP_000144381.1.76024 WP_000144381.1.76097 WP_000144381.1.76108 WP_000144381.1.76137 WP_000144381.1.76252 WP_000144381.1.76301 WP_000144381.1.76364 WP_000144381.1.76434 WP_000144381.1.76445 WP_000144381.1.76451 WP_000144381.1.76471 WP_000144381.1.76495 WP_000144381.1.7660 WP_000144381.1.76673 WP_000144381.1.76706 WP_000144381.1.76721 WP_000144381.1.76756 WP_000144381.1.76760 WP_000144381.1.76806 WP_000144381.1.76866 WP_000144381.1.76875 WP_000144381.1.76880 WP_000144381.1.76899 WP_000144381.1.77017 WP_000144381.1.77038 WP_000144381.1.77047 WP_000144381.1.77067 WP_000144381.1.77080 WP_000144381.1.7712 WP_000144381.1.77180 WP_000144381.1.77184 WP_000144381.1.77244 WP_000144381.1.77271 WP_000144381.1.77292 WP_000144381.1.77349 WP_000144381.1.77496 WP_000144381.1.77514 WP_000144381.1.77529 WP_000144381.1.77549 WP_000144381.1.77653 WP_000144381.1.77692 WP_000144381.1.7782 WP_000144381.1.77851 WP_000144381.1.77871 WP_000144381.1.77898 WP_000144381.1.77918 WP_000144381.1.77951 WP_000144381.1.77960 WP_000144381.1.77983 WP_000144381.1.78 WP_000144381.1.7802 WP_000144381.1.78033 WP_000144381.1.78076 WP_000144381.1.78096 WP_000144381.1.78100 WP_000144381.1.78110 WP_000144381.1.78120 WP_000144381.1.78201 WP_000144381.1.78245 WP_000144381.1.78383 WP_000144381.1.78407 WP_000144381.1.78443 WP_000144381.1.78495 WP_000144381.1.78496 WP_000144381.1.7861 WP_000144381.1.78618 WP_000144381.1.78632 WP_000144381.1.78673 WP_000144381.1.78697 WP_000144381.1.78734 WP_000144381.1.78735 WP_000144381.1.7877 WP_000144381.1.78802 WP_000144381.1.78815 WP_000144381.1.78830 WP_000144381.1.78835 WP_000144381.1.78871 WP_000144381.1.78874 WP_000144381.1.78877 WP_000144381.1.78896 WP_000144381.1.78918 WP_000144381.1.78930 WP_000144381.1.79032 WP_000144381.1.79151 WP_000144381.1.79167 WP_000144381.1.79289 WP_000144381.1.79302 WP_000144381.1.79335 WP_000144381.1.79370 WP_000144381.1.794 WP_000144381.1.79462 WP_000144381.1.79468 WP_000144381.1.79472 WP_000144381.1.79490 WP_000144381.1.79495 WP_000144381.1.79529 WP_000144381.1.7956 WP_000144381.1.79570 WP_000144381.1.79580 WP_000144381.1.7964 WP_000144381.1.79642 WP_000144381.1.79659 WP_000144381.1.79668 WP_000144381.1.79708 WP_000144381.1.79738 WP_000144381.1.79757 WP_000144381.1.7979 WP_000144381.1.79845 WP_000144381.1.79910 WP_000144381.1.7994 WP_000144381.1.79966 WP_000144381.1.79996 WP_000144381.1.80077 WP_000144381.1.80137 WP_000144381.1.80182 WP_000144381.1.80229 WP_000144381.1.80254 WP_000144381.1.80296 WP_000144381.1.80366 WP_000144381.1.80380 WP_000144381.1.80443 WP_000144381.1.80529 WP_000144381.1.80542 WP_000144381.1.80609 WP_000144381.1.80629 WP_000144381.1.80667 WP_000144381.1.80674 WP_000144381.1.80750 WP_000144381.1.80757 WP_000144381.1.80780 WP_000144381.1.80831 WP_000144381.1.80850 WP_000144381.1.80857 WP_000144381.1.80876 WP_000144381.1.80881 WP_000144381.1.80939 WP_000144381.1.8096 WP_000144381.1.81037 WP_000144381.1.81069 WP_000144381.1.81109 WP_000144381.1.81149 WP_000144381.1.81175 WP_000144381.1.8119 WP_000144381.1.81193 WP_000144381.1.81197 WP_000144381.1.81275 WP_000144381.1.8130 WP_000144381.1.81302 WP_000144381.1.81321 WP_000144381.1.81354 WP_000144381.1.81404 WP_000144381.1.81410 WP_000144381.1.81425 WP_000144381.1.81455 WP_000144381.1.81472 WP_000144381.1.81750 WP_000144381.1.81785 WP_000144381.1.81795 WP_000144381.1.81941 WP_000144381.1.81974 WP_000144381.1.82337 WP_000144381.1.82474 WP_000144381.1.82479 WP_000144381.1.82503 WP_000144381.1.82515 WP_000144381.1.82570 WP_000144381.1.82584 WP_000144381.1.82648 WP_000144381.1.82676 WP_000144381.1.82761 WP_000144381.1.8282 WP_000144381.1.82841 WP_000144381.1.82908 WP_000144381.1.82944 WP_000144381.1.82956 WP_000144381.1.82964 WP_000144381.1.82992 WP_000144381.1.83092 WP_000144381.1.83119 WP_000144381.1.83163 WP_000144381.1.83305 WP_000144381.1.83354 WP_000144381.1.83365 WP_000144381.1.83407 WP_000144381.1.83413 WP_000144381.1.83491 WP_000144381.1.83523 WP_000144381.1.8354 WP_000144381.1.83650 WP_000144381.1.83651 WP_000144381.1.83721 WP_000144381.1.83739 WP_000144381.1.83760 WP_000144381.1.83854 WP_000144381.1.83897 WP_000144381.1.83960 WP_000144381.1.83995 WP_000144381.1.84001 WP_000144381.1.84075 WP_000144381.1.84083 WP_000144381.1.84086 WP_000144381.1.84100 WP_000144381.1.84103 WP_000144381.1.84154 WP_000144381.1.8425 WP_000144381.1.84283 WP_000144381.1.84300 WP_000144381.1.84355 WP_000144381.1.84373 WP_000144381.1.84392 WP_000144381.1.8441 WP_000144381.1.84459 WP_000144381.1.84532 WP_000144381.1.84554 WP_000144381.1.84644 WP_000144381.1.84659 WP_000144381.1.84683 WP_000144381.1.84693 WP_000144381.1.84876 WP_000144381.1.84899 WP_000144381.1.8497 WP_000144381.1.84983 WP_000144381.1.85040 WP_000144381.1.85134 WP_000144381.1.85178 WP_000144381.1.85180 WP_000144381.1.85190 WP_000144381.1.8526 WP_000144381.1.85271 WP_000144381.1.8533 WP_000144381.1.8537 WP_000144381.1.8545 WP_000144381.1.85456 WP_000144381.1.85481 WP_000144381.1.85483 WP_000144381.1.85541 WP_000144381.1.8556 WP_000144381.1.85615 WP_000144381.1.85617 WP_000144381.1.85663 WP_000144381.1.85671 WP_000144381.1.85672 WP_000144381.1.85723 WP_000144381.1.85777 WP_000144381.1.85780 WP_000144381.1.85855 WP_000144381.1.85886 WP_000144381.1.85900 WP_000144381.1.85904 WP_000144381.1.85976 WP_000144381.1.85982 WP_000144381.1.86010 WP_000144381.1.86138 WP_000144381.1.86157 WP_000144381.1.86159 WP_000144381.1.86206 WP_000144381.1.86224 WP_000144381.1.86240 WP_000144381.1.86306 WP_000144381.1.86335 WP_000144381.1.86356 WP_000144381.1.86450 WP_000144381.1.86453 WP_000144381.1.86469 WP_000144381.1.8647 WP_000144381.1.86514 WP_000144381.1.86580 WP_000144381.1.86588 WP_000144381.1.86593 WP_000144381.1.86601 WP_000144381.1.86661 WP_000144381.1.8672 WP_000144381.1.8678 WP_000144381.1.86810 WP_000144381.1.8684 WP_000144381.1.86895 WP_000144381.1.86906 WP_000144381.1.86915 WP_000144381.1.87038 WP_000144381.1.87095 WP_000144381.1.87187 WP_000144381.1.87323 WP_000144381.1.8736 WP_000144381.1.87365 WP_000144381.1.87460 WP_000144381.1.87484 WP_000144381.1.87493 WP_000144381.1.87552 WP_000144381.1.87712 WP_000144381.1.87760 WP_000144381.1.87779 WP_000144381.1.87875 WP_000144381.1.87936 WP_000144381.1.87945 WP_000144381.1.88019 WP_000144381.1.88052 WP_000144381.1.88073 WP_000144381.1.8809 WP_000144381.1.88185 WP_000144381.1.88291 WP_000144381.1.88293 WP_000144381.1.8837 WP_000144381.1.88393 WP_000144381.1.8849 WP_000144381.1.88624 WP_000144381.1.88703 WP_000144381.1.88762 WP_000144381.1.88792 WP_000144381.1.88902 WP_000144381.1.8891 WP_000144381.1.88966 WP_000144381.1.88968 WP_000144381.1.88981 WP_000144381.1.88982 WP_000144381.1.89008 WP_000144381.1.89116 WP_000144381.1.89138 WP_000144381.1.89221 WP_000144381.1.89304 WP_000144381.1.89362 WP_000144381.1.89408 WP_000144381.1.89425 WP_000144381.1.89452 WP_000144381.1.89512 WP_000144381.1.89527 WP_000144381.1.89570 WP_000144381.1.89604 WP_000144381.1.89622 WP_000144381.1.89634 WP_000144381.1.89659 WP_000144381.1.89680 WP_000144381.1.89789 WP_000144381.1.89815 WP_000144381.1.89870 WP_000144381.1.89902 WP_000144381.1.8996 WP_000144381.1.89965 WP_000144381.1.9003 WP_000144381.1.90097 WP_000144381.1.90108 WP_000144381.1.90193 WP_000144381.1.90252 WP_000144381.1.90348 WP_000144381.1.90363 WP_000144381.1.90417 WP_000144381.1.90421 WP_000144381.1.90453 WP_000144381.1.90458 WP_000144381.1.90540 WP_000144381.1.90557 WP_000144381.1.90585 WP_000144381.1.90641 WP_000144381.1.90734 WP_000144381.1.90814 WP_000144381.1.9093 WP_000144381.1.90973 WP_000144381.1.90983 WP_000144381.1.90984 WP_000144381.1.91003 WP_000144381.1.91069 WP_000144381.1.91156 WP_000144381.1.91189 WP_000144381.1.91278 WP_000144381.1.9131 WP_000144381.1.91424 WP_000144381.1.91470 WP_000144381.1.91474 WP_000144381.1.91512 WP_000144381.1.91524 WP_000144381.1.91564 WP_000144381.1.91628 WP_000144381.1.91655 WP_000144381.1.91724 WP_000144381.1.91732 WP_000144381.1.91736 WP_000144381.1.91772 WP_000144381.1.91788 WP_000144381.1.91795 WP_000144381.1.91974 WP_000144381.1.92013 WP_000144381.1.92060 WP_000144381.1.92067 WP_000144381.1.92082 WP_000144381.1.92093 WP_000144381.1.92108 WP_000144381.1.92122 WP_000144381.1.92129 WP_000144381.1.92171 WP_000144381.1.92183 WP_000144381.1.92208 WP_000144381.1.92268 WP_000144381.1.92310 WP_000144381.1.92318 WP_000144381.1.92408 WP_000144381.1.92443 WP_000144381.1.92482 WP_000144381.1.92531 WP_000144381.1.92669 WP_000144381.1.92671 WP_000144381.1.92729 WP_000144381.1.92738 WP_000144381.1.92754 WP_000144381.1.92806 WP_000144381.1.92832 WP_000144381.1.92883 WP_000144381.1.92929 WP_000144381.1.92975 WP_000144381.1.93061 WP_000144381.1.93076 WP_000144381.1.93086 WP_000144381.1.93101 WP_000144381.1.93136 WP_000144381.1.93155 WP_000144381.1.93275 WP_000144381.1.93350 WP_000144381.1.93365 WP_000144381.1.93376 WP_000144381.1.93410 WP_000144381.1.93543 WP_000144381.1.93650 WP_000144381.1.93656 WP_000144381.1.93662 WP_000144381.1.937 WP_000144381.1.93705 WP_000144381.1.9380 WP_000144381.1.93803 WP_000144381.1.93804 WP_000144381.1.93809 WP_000144381.1.9389 WP_000144381.1.93986 WP_000144381.1.93994 WP_000144381.1.94072 WP_000144381.1.94162 WP_000144381.1.94168 WP_000144381.1.94181 WP_000144381.1.94198 WP_000144381.1.9432 WP_000144381.1.94354 WP_000144381.1.94380 WP_000144381.1.9440 WP_000144381.1.94412 WP_000144381.1.94458 WP_000144381.1.94565 WP_000144381.1.94584 WP_000144381.1.94622 WP_000144381.1.94669 WP_000144381.1.94670 WP_000144381.1.94674 WP_000144381.1.94785 WP_000144381.1.94796 WP_000144381.1.9481 WP_000144381.1.94959 WP_000144381.1.94967 WP_000144381.1.94983 WP_000144381.1.94987 WP_000144381.1.95051 WP_000144381.1.95085 WP_000144381.1.95121 WP_000144381.1.95282 WP_000144381.1.95434 WP_000144381.1.95447 WP_000144381.1.95546 WP_000144381.1.95558 WP_000144381.1.95579 WP_000144381.1.95630 WP_000144381.1.95656 WP_000144381.1.95703 WP_000144381.1.95744 WP_000144381.1.95757 WP_000144381.1.95840 WP_000144381.1.95911 WP_000144381.1.95963 WP_000144381.1.9609 WP_000144381.1.96139 WP_000144381.1.96172 WP_000144381.1.96206 WP_000144381.1.9624 WP_000144381.1.96260 WP_000144381.1.9627 WP_000144381.1.96317 WP_000144381.1.96335 WP_000144381.1.96340 WP_000144381.1.96343 WP_000144381.1.96348 WP_000144381.1.96349 WP_000144381.1.96380 WP_000144381.1.9644 WP_000144381.1.96469 WP_000144381.1.96490 WP_000144381.1.96497 WP_000144381.1.96500 WP_000144381.1.96555 WP_000144381.1.96563 WP_000144381.1.96584 WP_000144381.1.96588 WP_000144381.1.96600 WP_000144381.1.96732 WP_000144381.1.96771 WP_000144381.1.9686 WP_000144381.1.96902 WP_000144381.1.97015 WP_000144381.1.97043 WP_000144381.1.97103 WP_000144381.1.97109 WP_000144381.1.97145 WP_000144381.1.97190 WP_000144381.1.97224 WP_000144381.1.97318 WP_000144381.1.97328 WP_000144381.1.97369 WP_000144381.1.97547 WP_000144381.1.97594 WP_000144381.1.97597 WP_000144381.1.97613 WP_000144381.1.97620 WP_000144381.1.97640 WP_000144381.1.97648 WP_000144381.1.97656 WP_000144381.1.97726 WP_000144381.1.97727 WP_000144381.1.97732 WP_000144381.1.97736 WP_000144381.1.9774 WP_000144381.1.9775 WP_000144381.1.97846 WP_000144381.1.97873 WP_000144381.1.9793 WP_000144381.1.97991 WP_000144381.1.98006 WP_000144381.1.98019 WP_000144381.1.98022 WP_000144381.1.98110 WP_000144381.1.98119 WP_000144381.1.98124 WP_000144381.1.98146 WP_000144381.1.98219 WP_000144381.1.98236 WP_000144381.1.98250 WP_000144381.1.98338 WP_000144381.1.98402 WP_000144381.1.9841 WP_000144381.1.98446 WP_000144381.1.98472 WP_000144381.1.98495 WP_000144381.1.98531 WP_000144381.1.98551 WP_000144381.1.98577 WP_000144381.1.98627 WP_000144381.1.98634 WP_000144381.1.98676 WP_000144381.1.98677 WP_000144381.1.98726 WP_000144381.1.98760 WP_000144381.1.98779 WP_000144381.1.98843 WP_000144381.1.98899 WP_000144381.1.98947 WP_000144381.1.9898 WP_000144381.1.9899 WP_000144381.1.99040 WP_000144381.1.99057 WP_000144381.1.99072 WP_000144381.1.99098 WP_000144381.1.99164 WP_000144381.1.99184 WP_000144381.1.99267 WP_000144381.1.99276 WP_000144381.1.99490 WP_000144381.1.99561 WP_000144381.1.99577 WP_000144381.1.99613 WP_000144381.1.99630 WP_000144381.1.99646 WP_000144381.1.99657 WP_000144381.1.99660 WP_000144381.1.99712 WP_000144381.1.99747 WP_000144381.1.99783 WP_000144381.1.99813 WP_000144381.1.99824 WP_000144381.1.99858 WP_000144381.1.99889 WP_000144381.1.99958 WP_000144381.1.99961 gi|525840243|ref|YP_008257721.1| gi|550903007|ref|YP_008672099.1| ABAM02000001|CDS_4225355-4226605 ABAN01000001|CDS_210637-209387 ABAO01000004|CDS_210453-211703 AE006468|CDS_3852732-3853982 AM933172|CDS_3734071-3735321 CP001144|CDS_3892980-3894230 CP001363|CDS_3866423-3867673 FN424405|CDS_3875609-3876859 gi|207858902|ref|YP_002245553.1| gi|529221527|ref|YP_008383066.1| 439851.SeD_A4049 550537.SEN3487 99287.STM3665 gi|378990968|ref|YP_005254132.1| gi|16766950|ref|NP_462565.1| gi|378986262|ref|YP_005249418.1| gi|482906230|ref|YP_007904790.1| gi|378701552|ref|YP_005183510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]