SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482906273|ref|YP_007904833.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482906273|ref|YP_007904833.1|
Domain Number 1 Region: 4-396
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.3e-126
Family GABA-aminotransferase-like 0.00000000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|482906273|ref|YP_007904833.1|
Sequence length 398
Comment 2-amino-3-ketobutyrate coenzyme A ligase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MRGDFYKQLTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPE
LINAAKAGMDSHGFGMASVRFICGTQDSHKALEQKLASFLGMEDAILYSSCFDANGGLFE
TLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMAELEARLKEAREAGARHVLIAT
DGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITG
TLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGAELRD
RLWANARQFREQMSAAGFTLAGADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVV
PKGQARIRTQMSAAHTPEQITRAVDAFTRIGKQLGVIA
Download sequence
Identical sequences A0A0D6I360 A0A0F6B8K6 A0A0F7JD01 A0A0H2WU06 A0A0H3BQ01 A0A0H3NMY0 A0A0L5X395 A0A0M0QMY9 A0A0N1QST9 A0A0R9MFA0 A0A0U1IZW8 A0A1C2ZRK4 A0A1M3XT95 A0A1R3CVU6 A0A1S1ARA8 A0A1X2RRN8 A0A1X2TQN3 A0A1X2UXT2 A0A1X2Y6L4 A0A1Z3Q8J3 A0A249UTQ5 A0A265BAR6 A0A267SLJ0 A0A271CH59 A0A271CV82 A0A2C6FQ00 A0A2D1XKX5 A0A2D1XZS0 A0A2H9YLV8 A0A2I6M2F8 A0A2I6MFZ0 A0A2I6MTR1 A0A2I6N7U4 A0A2I6NKI4 A0A2I6NYJ6 A0A2K2S211 A0A2K2SFV4 A0A2K2SM07 A0A2K2T652 A0A2K2T8S7 A9MKQ7 B5EXC4 C0Q1V1 E8XGQ8 G4C821 G5LFX8 G5NJT2 M7SBJ6 P37419 Q57IC4 S4HJB6 V1X8C7 V7UIZ8
gi|525814981|ref|YP_008244999.1| gi|525828584|ref|YP_008251479.1| gi|378701597|ref|YP_005183555.1| gi|379702970|ref|YP_005244698.1| gi|378447078|ref|YP_005234710.1| gi|563655042|ref|YP_008863134.1| gi|194448357|ref|YP_002047740.1| gi|198241773|ref|YP_002217671.1| gi|224585509|ref|YP_002639308.1| gi|378452590|ref|YP_005239950.1| gi|197249715|ref|YP_002148642.1| NP_462609.1.58477 WP_001213790.1.100007 WP_001213790.1.100010 WP_001213790.1.100017 WP_001213790.1.100031 WP_001213790.1.100077 WP_001213790.1.100115 WP_001213790.1.100129 WP_001213790.1.10013 WP_001213790.1.100137 WP_001213790.1.100149 WP_001213790.1.100165 WP_001213790.1.100191 WP_001213790.1.1002 WP_001213790.1.100234 WP_001213790.1.100258 WP_001213790.1.100266 WP_001213790.1.100288 WP_001213790.1.100376 WP_001213790.1.100392 WP_001213790.1.100412 WP_001213790.1.100413 WP_001213790.1.100424 WP_001213790.1.100436 WP_001213790.1.100438 WP_001213790.1.100457 WP_001213790.1.100484 WP_001213790.1.100488 WP_001213790.1.100502 WP_001213790.1.100519 WP_001213790.1.100521 WP_001213790.1.100557 WP_001213790.1.100584 WP_001213790.1.100589 WP_001213790.1.100597 WP_001213790.1.100605 WP_001213790.1.100642 WP_001213790.1.10065 WP_001213790.1.100707 WP_001213790.1.100711 WP_001213790.1.100714 WP_001213790.1.100721 WP_001213790.1.100730 WP_001213790.1.100750 WP_001213790.1.10076 WP_001213790.1.100773 WP_001213790.1.100776 WP_001213790.1.100781 WP_001213790.1.100790 WP_001213790.1.100793 WP_001213790.1.10081 WP_001213790.1.100814 WP_001213790.1.100857 WP_001213790.1.100865 WP_001213790.1.100869 WP_001213790.1.100870 WP_001213790.1.100871 WP_001213790.1.100882 WP_001213790.1.100886 WP_001213790.1.100895 WP_001213790.1.100932 WP_001213790.1.100948 WP_001213790.1.100979 WP_001213790.1.101007 WP_001213790.1.101020 WP_001213790.1.101042 WP_001213790.1.101074 WP_001213790.1.101078 WP_001213790.1.101091 WP_001213790.1.101094 WP_001213790.1.101111 WP_001213790.1.101112 WP_001213790.1.101123 WP_001213790.1.101147 WP_001213790.1.101180 WP_001213790.1.101199 WP_001213790.1.101223 WP_001213790.1.101239 WP_001213790.1.101259 WP_001213790.1.101284 WP_001213790.1.101291 WP_001213790.1.1013 WP_001213790.1.101320 WP_001213790.1.101353 WP_001213790.1.101386 WP_001213790.1.101404 WP_001213790.1.101420 WP_001213790.1.101425 WP_001213790.1.101473 WP_001213790.1.101541 WP_001213790.1.101589 WP_001213790.1.101609 WP_001213790.1.101612 WP_001213790.1.101634 WP_001213790.1.101639 WP_001213790.1.10164 WP_001213790.1.101666 WP_001213790.1.101674 WP_001213790.1.101707 WP_001213790.1.101734 WP_001213790.1.101740 WP_001213790.1.101759 WP_001213790.1.101776 WP_001213790.1.101815 WP_001213790.1.101832 WP_001213790.1.101841 WP_001213790.1.101868 WP_001213790.1.101878 WP_001213790.1.101904 WP_001213790.1.10191 WP_001213790.1.101917 WP_001213790.1.101927 WP_001213790.1.101953 WP_001213790.1.102009 WP_001213790.1.102103 WP_001213790.1.102111 WP_001213790.1.10220 WP_001213790.1.10231 WP_001213790.1.10237 WP_001213790.1.10266 WP_001213790.1.10276 WP_001213790.1.10293 WP_001213790.1.10300 WP_001213790.1.10310 WP_001213790.1.10394 WP_001213790.1.10429 WP_001213790.1.10439 WP_001213790.1.10463 WP_001213790.1.10465 WP_001213790.1.10498 WP_001213790.1.10507 WP_001213790.1.10521 WP_001213790.1.10562 WP_001213790.1.10566 WP_001213790.1.106 WP_001213790.1.10631 WP_001213790.1.10675 WP_001213790.1.10678 WP_001213790.1.10720 WP_001213790.1.10753 WP_001213790.1.10755 WP_001213790.1.10797 WP_001213790.1.10868 WP_001213790.1.10898 WP_001213790.1.10992 WP_001213790.1.11000 WP_001213790.1.11024 WP_001213790.1.11031 WP_001213790.1.11098 WP_001213790.1.1110 WP_001213790.1.11119 WP_001213790.1.11156 WP_001213790.1.11168 WP_001213790.1.11190 WP_001213790.1.11213 WP_001213790.1.11216 WP_001213790.1.11295 WP_001213790.1.11304 WP_001213790.1.1135 WP_001213790.1.11362 WP_001213790.1.11369 WP_001213790.1.1137 WP_001213790.1.11405 WP_001213790.1.11444 WP_001213790.1.11455 WP_001213790.1.11458 WP_001213790.1.11479 WP_001213790.1.1150 WP_001213790.1.11511 WP_001213790.1.11518 WP_001213790.1.11526 WP_001213790.1.11528 WP_001213790.1.11532 WP_001213790.1.11543 WP_001213790.1.11544 WP_001213790.1.1156 WP_001213790.1.11565 WP_001213790.1.11588 WP_001213790.1.11603 WP_001213790.1.11621 WP_001213790.1.11677 WP_001213790.1.11681 WP_001213790.1.11687 WP_001213790.1.1169 WP_001213790.1.11735 WP_001213790.1.1174 WP_001213790.1.11763 WP_001213790.1.11772 WP_001213790.1.11810 WP_001213790.1.11824 WP_001213790.1.11834 WP_001213790.1.11841 WP_001213790.1.11865 WP_001213790.1.11897 WP_001213790.1.11900 WP_001213790.1.11936 WP_001213790.1.11978 WP_001213790.1.12007 WP_001213790.1.12017 WP_001213790.1.12025 WP_001213790.1.12027 WP_001213790.1.1204 WP_001213790.1.12047 WP_001213790.1.12059 WP_001213790.1.12063 WP_001213790.1.12106 WP_001213790.1.12114 WP_001213790.1.12144 WP_001213790.1.1215 WP_001213790.1.12160 WP_001213790.1.12168 WP_001213790.1.12210 WP_001213790.1.12244 WP_001213790.1.12280 WP_001213790.1.12282 WP_001213790.1.12308 WP_001213790.1.12340 WP_001213790.1.12351 WP_001213790.1.12370 WP_001213790.1.12374 WP_001213790.1.1239 WP_001213790.1.12396 WP_001213790.1.12456 WP_001213790.1.1246 WP_001213790.1.12484 WP_001213790.1.12485 WP_001213790.1.1250 WP_001213790.1.12517 WP_001213790.1.12546 WP_001213790.1.12568 WP_001213790.1.12569 WP_001213790.1.12584 WP_001213790.1.12585 WP_001213790.1.1264 WP_001213790.1.12650 WP_001213790.1.12696 WP_001213790.1.12728 WP_001213790.1.12864 WP_001213790.1.12865 WP_001213790.1.12877 WP_001213790.1.12879 WP_001213790.1.12936 WP_001213790.1.1299 WP_001213790.1.12995 WP_001213790.1.1300 WP_001213790.1.13027 WP_001213790.1.13076 WP_001213790.1.13102 WP_001213790.1.13106 WP_001213790.1.13130 WP_001213790.1.13207 WP_001213790.1.13247 WP_001213790.1.1326 WP_001213790.1.13262 WP_001213790.1.13274 WP_001213790.1.13311 WP_001213790.1.13334 WP_001213790.1.13367 WP_001213790.1.13391 WP_001213790.1.13414 WP_001213790.1.13429 WP_001213790.1.13446 WP_001213790.1.1346 WP_001213790.1.13465 WP_001213790.1.13488 WP_001213790.1.13509 WP_001213790.1.13528 WP_001213790.1.13543 WP_001213790.1.13573 WP_001213790.1.13602 WP_001213790.1.13625 WP_001213790.1.13661 WP_001213790.1.13669 WP_001213790.1.13677 WP_001213790.1.13691 WP_001213790.1.13741 WP_001213790.1.13750 WP_001213790.1.13799 WP_001213790.1.13819 WP_001213790.1.13827 WP_001213790.1.13829 WP_001213790.1.13848 WP_001213790.1.1387 WP_001213790.1.13908 WP_001213790.1.13932 WP_001213790.1.13967 WP_001213790.1.13968 WP_001213790.1.14001 WP_001213790.1.14011 WP_001213790.1.14041 WP_001213790.1.14111 WP_001213790.1.1412 WP_001213790.1.14151 WP_001213790.1.14212 WP_001213790.1.14239 WP_001213790.1.14286 WP_001213790.1.14296 WP_001213790.1.14320 WP_001213790.1.14379 WP_001213790.1.14406 WP_001213790.1.14410 WP_001213790.1.14436 WP_001213790.1.14446 WP_001213790.1.14458 WP_001213790.1.14466 WP_001213790.1.14505 WP_001213790.1.14516 WP_001213790.1.14519 WP_001213790.1.14524 WP_001213790.1.14528 WP_001213790.1.14554 WP_001213790.1.146 WP_001213790.1.14618 WP_001213790.1.14688 WP_001213790.1.14706 WP_001213790.1.14708 WP_001213790.1.14725 WP_001213790.1.14737 WP_001213790.1.14793 WP_001213790.1.14819 WP_001213790.1.14852 WP_001213790.1.14884 WP_001213790.1.1489 WP_001213790.1.14913 WP_001213790.1.14917 WP_001213790.1.14927 WP_001213790.1.14932 WP_001213790.1.14936 WP_001213790.1.15011 WP_001213790.1.15046 WP_001213790.1.15054 WP_001213790.1.15055 WP_001213790.1.15059 WP_001213790.1.15067 WP_001213790.1.15100 WP_001213790.1.15124 WP_001213790.1.15214 WP_001213790.1.15223 WP_001213790.1.15226 WP_001213790.1.15276 WP_001213790.1.15316 WP_001213790.1.15318 WP_001213790.1.15353 WP_001213790.1.15369 WP_001213790.1.1540 WP_001213790.1.15468 WP_001213790.1.15479 WP_001213790.1.15483 WP_001213790.1.15508 WP_001213790.1.1551 WP_001213790.1.15585 WP_001213790.1.15586 WP_001213790.1.15612 WP_001213790.1.15616 WP_001213790.1.15625 WP_001213790.1.15637 WP_001213790.1.15644 WP_001213790.1.1568 WP_001213790.1.15708 WP_001213790.1.15775 WP_001213790.1.15777 WP_001213790.1.15784 WP_001213790.1.15795 WP_001213790.1.158 WP_001213790.1.15830 WP_001213790.1.15862 WP_001213790.1.15881 WP_001213790.1.15910 WP_001213790.1.1592 WP_001213790.1.15922 WP_001213790.1.15938 WP_001213790.1.15978 WP_001213790.1.15986 WP_001213790.1.15995 WP_001213790.1.16004 WP_001213790.1.16028 WP_001213790.1.16032 WP_001213790.1.16047 WP_001213790.1.16052 WP_001213790.1.16062 WP_001213790.1.16063 WP_001213790.1.16103 WP_001213790.1.1611 WP_001213790.1.16125 WP_001213790.1.16158 WP_001213790.1.16166 WP_001213790.1.16226 WP_001213790.1.16233 WP_001213790.1.16244 WP_001213790.1.16273 WP_001213790.1.16284 WP_001213790.1.16328 WP_001213790.1.16331 WP_001213790.1.1635 WP_001213790.1.16361 WP_001213790.1.16363 WP_001213790.1.16365 WP_001213790.1.16366 WP_001213790.1.16394 WP_001213790.1.16453 WP_001213790.1.16468 WP_001213790.1.16474 WP_001213790.1.16508 WP_001213790.1.16525 WP_001213790.1.16565 WP_001213790.1.16581 WP_001213790.1.16614 WP_001213790.1.16650 WP_001213790.1.16656 WP_001213790.1.1668 WP_001213790.1.16686 WP_001213790.1.16691 WP_001213790.1.167 WP_001213790.1.16710 WP_001213790.1.16729 WP_001213790.1.16732 WP_001213790.1.16735 WP_001213790.1.16736 WP_001213790.1.16786 WP_001213790.1.16804 WP_001213790.1.16817 WP_001213790.1.16819 WP_001213790.1.16826 WP_001213790.1.16855 WP_001213790.1.16858 WP_001213790.1.16873 WP_001213790.1.1689 WP_001213790.1.16896 WP_001213790.1.16903 WP_001213790.1.16910 WP_001213790.1.16916 WP_001213790.1.16941 WP_001213790.1.16949 WP_001213790.1.16965 WP_001213790.1.16972 WP_001213790.1.16998 WP_001213790.1.1700 WP_001213790.1.17031 WP_001213790.1.17060 WP_001213790.1.17093 WP_001213790.1.17096 WP_001213790.1.17098 WP_001213790.1.17105 WP_001213790.1.17188 WP_001213790.1.17270 WP_001213790.1.17285 WP_001213790.1.17307 WP_001213790.1.1733 WP_001213790.1.1737 WP_001213790.1.17390 WP_001213790.1.174 WP_001213790.1.17439 WP_001213790.1.17447 WP_001213790.1.17480 WP_001213790.1.17482 WP_001213790.1.17504 WP_001213790.1.17525 WP_001213790.1.17546 WP_001213790.1.17560 WP_001213790.1.17583 WP_001213790.1.17694 WP_001213790.1.17703 WP_001213790.1.17705 WP_001213790.1.17732 WP_001213790.1.17743 WP_001213790.1.17747 WP_001213790.1.17755 WP_001213790.1.17758 WP_001213790.1.17865 WP_001213790.1.17886 WP_001213790.1.17891 WP_001213790.1.17901 WP_001213790.1.17914 WP_001213790.1.17919 WP_001213790.1.17936 WP_001213790.1.17949 WP_001213790.1.1798 WP_001213790.1.17991 WP_001213790.1.18019 WP_001213790.1.18022 WP_001213790.1.18056 WP_001213790.1.18061 WP_001213790.1.1807 WP_001213790.1.18089 WP_001213790.1.18092 WP_001213790.1.18103 WP_001213790.1.18109 WP_001213790.1.18111 WP_001213790.1.18122 WP_001213790.1.18149 WP_001213790.1.18163 WP_001213790.1.18177 WP_001213790.1.18178 WP_001213790.1.1818 WP_001213790.1.18192 WP_001213790.1.18249 WP_001213790.1.18254 WP_001213790.1.18265 WP_001213790.1.18267 WP_001213790.1.18277 WP_001213790.1.18281 WP_001213790.1.18282 WP_001213790.1.1832 WP_001213790.1.18355 WP_001213790.1.18365 WP_001213790.1.18384 WP_001213790.1.18426 WP_001213790.1.18441 WP_001213790.1.18445 WP_001213790.1.18468 WP_001213790.1.18485 WP_001213790.1.18489 WP_001213790.1.18607 WP_001213790.1.18641 WP_001213790.1.18686 WP_001213790.1.18692 WP_001213790.1.18705 WP_001213790.1.18715 WP_001213790.1.18737 WP_001213790.1.18776 WP_001213790.1.18796 WP_001213790.1.18822 WP_001213790.1.18847 WP_001213790.1.18881 WP_001213790.1.18886 WP_001213790.1.18919 WP_001213790.1.18940 WP_001213790.1.18949 WP_001213790.1.1895 WP_001213790.1.1897 WP_001213790.1.18972 WP_001213790.1.19030 WP_001213790.1.19038 WP_001213790.1.19053 WP_001213790.1.19055 WP_001213790.1.19064 WP_001213790.1.19093 WP_001213790.1.19163 WP_001213790.1.19174 WP_001213790.1.19240 WP_001213790.1.19273 WP_001213790.1.19320 WP_001213790.1.19340 WP_001213790.1.19357 WP_001213790.1.19373 WP_001213790.1.1939 WP_001213790.1.19405 WP_001213790.1.19433 WP_001213790.1.19458 WP_001213790.1.19460 WP_001213790.1.19461 WP_001213790.1.19469 WP_001213790.1.1954 WP_001213790.1.1955 WP_001213790.1.19588 WP_001213790.1.19614 WP_001213790.1.19616 WP_001213790.1.19642 WP_001213790.1.19656 WP_001213790.1.19683 WP_001213790.1.19702 WP_001213790.1.19706 WP_001213790.1.19723 WP_001213790.1.19724 WP_001213790.1.19749 WP_001213790.1.19784 WP_001213790.1.19793 WP_001213790.1.19802 WP_001213790.1.19809 WP_001213790.1.19823 WP_001213790.1.19834 WP_001213790.1.19851 WP_001213790.1.19863 WP_001213790.1.19867 WP_001213790.1.19882 WP_001213790.1.19884 WP_001213790.1.19967 WP_001213790.1.19975 WP_001213790.1.1998 WP_001213790.1.19987 WP_001213790.1.20 WP_001213790.1.20023 WP_001213790.1.20034 WP_001213790.1.20081 WP_001213790.1.20086 WP_001213790.1.20089 WP_001213790.1.20091 WP_001213790.1.2010 WP_001213790.1.20212 WP_001213790.1.20218 WP_001213790.1.2026 WP_001213790.1.20261 WP_001213790.1.20266 WP_001213790.1.20271 WP_001213790.1.20330 WP_001213790.1.20349 WP_001213790.1.2036 WP_001213790.1.20362 WP_001213790.1.20391 WP_001213790.1.2041 WP_001213790.1.20418 WP_001213790.1.20425 WP_001213790.1.20437 WP_001213790.1.20438 WP_001213790.1.20443 WP_001213790.1.20446 WP_001213790.1.20525 WP_001213790.1.2054 WP_001213790.1.20553 WP_001213790.1.20564 WP_001213790.1.20573 WP_001213790.1.20614 WP_001213790.1.20626 WP_001213790.1.20631 WP_001213790.1.20646 WP_001213790.1.20695 WP_001213790.1.20700 WP_001213790.1.20721 WP_001213790.1.20760 WP_001213790.1.20767 WP_001213790.1.20787 WP_001213790.1.20789 WP_001213790.1.20795 WP_001213790.1.20810 WP_001213790.1.20886 WP_001213790.1.20894 WP_001213790.1.20908 WP_001213790.1.2101 WP_001213790.1.21049 WP_001213790.1.2107 WP_001213790.1.21075 WP_001213790.1.21079 WP_001213790.1.21086 WP_001213790.1.21089 WP_001213790.1.21103 WP_001213790.1.21136 WP_001213790.1.21146 WP_001213790.1.2116 WP_001213790.1.21165 WP_001213790.1.21194 WP_001213790.1.21202 WP_001213790.1.21241 WP_001213790.1.21245 WP_001213790.1.21246 WP_001213790.1.21260 WP_001213790.1.21269 WP_001213790.1.2130 WP_001213790.1.21309 WP_001213790.1.21326 WP_001213790.1.21332 WP_001213790.1.21351 WP_001213790.1.21362 WP_001213790.1.2139 WP_001213790.1.21400 WP_001213790.1.21404 WP_001213790.1.21423 WP_001213790.1.21453 WP_001213790.1.21473 WP_001213790.1.21497 WP_001213790.1.21499 WP_001213790.1.21534 WP_001213790.1.21548 WP_001213790.1.2155 WP_001213790.1.21603 WP_001213790.1.21616 WP_001213790.1.21681 WP_001213790.1.21692 WP_001213790.1.21715 WP_001213790.1.21728 WP_001213790.1.21730 WP_001213790.1.21750 WP_001213790.1.21751 WP_001213790.1.21757 WP_001213790.1.21792 WP_001213790.1.21845 WP_001213790.1.21877 WP_001213790.1.21886 WP_001213790.1.21909 WP_001213790.1.21940 WP_001213790.1.21950 WP_001213790.1.21981 WP_001213790.1.21991 WP_001213790.1.22019 WP_001213790.1.22024 WP_001213790.1.22026 WP_001213790.1.22030 WP_001213790.1.2205 WP_001213790.1.22051 WP_001213790.1.22062 WP_001213790.1.22067 WP_001213790.1.22069 WP_001213790.1.22096 WP_001213790.1.22117 WP_001213790.1.22136 WP_001213790.1.22158 WP_001213790.1.22162 WP_001213790.1.22169 WP_001213790.1.2221 WP_001213790.1.22235 WP_001213790.1.2224 WP_001213790.1.22240 WP_001213790.1.22270 WP_001213790.1.22296 WP_001213790.1.22315 WP_001213790.1.22323 WP_001213790.1.22346 WP_001213790.1.2235 WP_001213790.1.22379 WP_001213790.1.22388 WP_001213790.1.22427 WP_001213790.1.22449 WP_001213790.1.22451 WP_001213790.1.22453 WP_001213790.1.22454 WP_001213790.1.2246 WP_001213790.1.22460 WP_001213790.1.22485 WP_001213790.1.22514 WP_001213790.1.22537 WP_001213790.1.22566 WP_001213790.1.22575 WP_001213790.1.22590 WP_001213790.1.22595 WP_001213790.1.22604 WP_001213790.1.22605 WP_001213790.1.22620 WP_001213790.1.22623 WP_001213790.1.22676 WP_001213790.1.22692 WP_001213790.1.22758 WP_001213790.1.22760 WP_001213790.1.2283 WP_001213790.1.22857 WP_001213790.1.22864 WP_001213790.1.22870 WP_001213790.1.22880 WP_001213790.1.22902 WP_001213790.1.22947 WP_001213790.1.22966 WP_001213790.1.22979 WP_001213790.1.23010 WP_001213790.1.23053 WP_001213790.1.23080 WP_001213790.1.23102 WP_001213790.1.23114 WP_001213790.1.2314 WP_001213790.1.23148 WP_001213790.1.23155 WP_001213790.1.23172 WP_001213790.1.23192 WP_001213790.1.23201 WP_001213790.1.2324 WP_001213790.1.23246 WP_001213790.1.23258 WP_001213790.1.23259 WP_001213790.1.23274 WP_001213790.1.23279 WP_001213790.1.23309 WP_001213790.1.23329 WP_001213790.1.23379 WP_001213790.1.23409 WP_001213790.1.2342 WP_001213790.1.23442 WP_001213790.1.23444 WP_001213790.1.23460 WP_001213790.1.23466 WP_001213790.1.23472 WP_001213790.1.23482 WP_001213790.1.23485 WP_001213790.1.235 WP_001213790.1.23503 WP_001213790.1.23509 WP_001213790.1.23529 WP_001213790.1.2358 WP_001213790.1.23587 WP_001213790.1.23621 WP_001213790.1.23629 WP_001213790.1.23631 WP_001213790.1.23634 WP_001213790.1.23639 WP_001213790.1.2364 WP_001213790.1.23643 WP_001213790.1.23670 WP_001213790.1.23675 WP_001213790.1.23685 WP_001213790.1.23707 WP_001213790.1.23736 WP_001213790.1.23746 WP_001213790.1.23819 WP_001213790.1.23932 WP_001213790.1.23959 WP_001213790.1.24017 WP_001213790.1.24082 WP_001213790.1.24145 WP_001213790.1.24158 WP_001213790.1.24206 WP_001213790.1.24214 WP_001213790.1.24250 WP_001213790.1.24297 WP_001213790.1.24303 WP_001213790.1.24308 WP_001213790.1.24325 WP_001213790.1.24361 WP_001213790.1.24376 WP_001213790.1.24394 WP_001213790.1.24408 WP_001213790.1.24409 WP_001213790.1.24412 WP_001213790.1.24419 WP_001213790.1.24444 WP_001213790.1.24450 WP_001213790.1.24476 WP_001213790.1.24494 WP_001213790.1.24521 WP_001213790.1.24555 WP_001213790.1.24578 WP_001213790.1.2467 WP_001213790.1.24673 WP_001213790.1.24689 WP_001213790.1.24696 WP_001213790.1.24723 WP_001213790.1.24737 WP_001213790.1.24779 WP_001213790.1.24803 WP_001213790.1.24837 WP_001213790.1.24873 WP_001213790.1.24901 WP_001213790.1.24944 WP_001213790.1.25008 WP_001213790.1.25015 WP_001213790.1.25072 WP_001213790.1.25119 WP_001213790.1.25130 WP_001213790.1.25159 WP_001213790.1.25175 WP_001213790.1.25205 WP_001213790.1.25206 WP_001213790.1.25217 WP_001213790.1.25229 WP_001213790.1.2525 WP_001213790.1.25297 WP_001213790.1.25354 WP_001213790.1.25397 WP_001213790.1.25405 WP_001213790.1.25421 WP_001213790.1.25426 WP_001213790.1.25454 WP_001213790.1.25493 WP_001213790.1.25514 WP_001213790.1.25546 WP_001213790.1.25564 WP_001213790.1.25618 WP_001213790.1.25668 WP_001213790.1.2568 WP_001213790.1.25690 WP_001213790.1.25692 WP_001213790.1.2570 WP_001213790.1.25703 WP_001213790.1.25708 WP_001213790.1.25709 WP_001213790.1.25740 WP_001213790.1.25780 WP_001213790.1.25809 WP_001213790.1.2581 WP_001213790.1.25814 WP_001213790.1.25825 WP_001213790.1.25846 WP_001213790.1.25932 WP_001213790.1.25951 WP_001213790.1.25988 WP_001213790.1.26030 WP_001213790.1.26034 WP_001213790.1.26075 WP_001213790.1.26083 WP_001213790.1.26093 WP_001213790.1.26122 WP_001213790.1.26123 WP_001213790.1.26129 WP_001213790.1.26194 WP_001213790.1.26213 WP_001213790.1.26224 WP_001213790.1.26269 WP_001213790.1.26282 WP_001213790.1.26311 WP_001213790.1.26319 WP_001213790.1.2634 WP_001213790.1.26363 WP_001213790.1.26414 WP_001213790.1.26426 WP_001213790.1.26429 WP_001213790.1.26440 WP_001213790.1.26441 WP_001213790.1.26493 WP_001213790.1.26512 WP_001213790.1.26532 WP_001213790.1.26551 WP_001213790.1.26563 WP_001213790.1.26567 WP_001213790.1.26576 WP_001213790.1.26582 WP_001213790.1.26587 WP_001213790.1.2660 WP_001213790.1.26646 WP_001213790.1.2667 WP_001213790.1.26687 WP_001213790.1.26709 WP_001213790.1.2672 WP_001213790.1.26741 WP_001213790.1.26750 WP_001213790.1.26758 WP_001213790.1.26787 WP_001213790.1.26794 WP_001213790.1.26833 WP_001213790.1.26856 WP_001213790.1.26883 WP_001213790.1.26919 WP_001213790.1.26924 WP_001213790.1.26936 WP_001213790.1.27010 WP_001213790.1.27051 WP_001213790.1.27055 WP_001213790.1.27084 WP_001213790.1.27122 WP_001213790.1.27123 WP_001213790.1.27173 WP_001213790.1.272 WP_001213790.1.27206 WP_001213790.1.27223 WP_001213790.1.2723 WP_001213790.1.27272 WP_001213790.1.27279 WP_001213790.1.27314 WP_001213790.1.27383 WP_001213790.1.27419 WP_001213790.1.27452 WP_001213790.1.27522 WP_001213790.1.27544 WP_001213790.1.27547 WP_001213790.1.27556 WP_001213790.1.27561 WP_001213790.1.2763 WP_001213790.1.27632 WP_001213790.1.27638 WP_001213790.1.27655 WP_001213790.1.27658 WP_001213790.1.27665 WP_001213790.1.27679 WP_001213790.1.27707 WP_001213790.1.27755 WP_001213790.1.27761 WP_001213790.1.2777 WP_001213790.1.27776 WP_001213790.1.27798 WP_001213790.1.27800 WP_001213790.1.27815 WP_001213790.1.27833 WP_001213790.1.27857 WP_001213790.1.27883 WP_001213790.1.27969 WP_001213790.1.27977 WP_001213790.1.27995 WP_001213790.1.28002 WP_001213790.1.28032 WP_001213790.1.28037 WP_001213790.1.28056 WP_001213790.1.2806 WP_001213790.1.28094 WP_001213790.1.28116 WP_001213790.1.28126 WP_001213790.1.28139 WP_001213790.1.28170 WP_001213790.1.28174 WP_001213790.1.28200 WP_001213790.1.28232 WP_001213790.1.28233 WP_001213790.1.28235 WP_001213790.1.28267 WP_001213790.1.2829 WP_001213790.1.28302 WP_001213790.1.28303 WP_001213790.1.2835 WP_001213790.1.28370 WP_001213790.1.28393 WP_001213790.1.28462 WP_001213790.1.28504 WP_001213790.1.2853 WP_001213790.1.28538 WP_001213790.1.28570 WP_001213790.1.28575 WP_001213790.1.28612 WP_001213790.1.28620 WP_001213790.1.28625 WP_001213790.1.28655 WP_001213790.1.28694 WP_001213790.1.287 WP_001213790.1.28773 WP_001213790.1.28775 WP_001213790.1.28776 WP_001213790.1.2879 WP_001213790.1.28811 WP_001213790.1.28830 WP_001213790.1.2890 WP_001213790.1.28921 WP_001213790.1.28938 WP_001213790.1.28946 WP_001213790.1.28963 WP_001213790.1.28977 WP_001213790.1.29006 WP_001213790.1.29010 WP_001213790.1.2910 WP_001213790.1.29113 WP_001213790.1.29130 WP_001213790.1.2915 WP_001213790.1.29168 WP_001213790.1.29174 WP_001213790.1.29190 WP_001213790.1.29218 WP_001213790.1.2924 WP_001213790.1.29265 WP_001213790.1.29274 WP_001213790.1.2932 WP_001213790.1.29379 WP_001213790.1.29422 WP_001213790.1.29436 WP_001213790.1.29454 WP_001213790.1.29509 WP_001213790.1.29530 WP_001213790.1.29576 WP_001213790.1.29588 WP_001213790.1.29593 WP_001213790.1.29601 WP_001213790.1.29606 WP_001213790.1.29615 WP_001213790.1.29619 WP_001213790.1.29682 WP_001213790.1.29704 WP_001213790.1.29732 WP_001213790.1.2974 WP_001213790.1.29768 WP_001213790.1.29774 WP_001213790.1.29775 WP_001213790.1.29827 WP_001213790.1.29898 WP_001213790.1.29969 WP_001213790.1.29990 WP_001213790.1.30006 WP_001213790.1.30022 WP_001213790.1.30027 WP_001213790.1.3005 WP_001213790.1.30059 WP_001213790.1.30086 WP_001213790.1.30093 WP_001213790.1.30165 WP_001213790.1.3017 WP_001213790.1.30179 WP_001213790.1.30180 WP_001213790.1.30202 WP_001213790.1.30210 WP_001213790.1.30213 WP_001213790.1.30225 WP_001213790.1.30238 WP_001213790.1.30246 WP_001213790.1.30278 WP_001213790.1.30331 WP_001213790.1.30356 WP_001213790.1.30386 WP_001213790.1.30437 WP_001213790.1.30469 WP_001213790.1.30492 WP_001213790.1.30505 WP_001213790.1.30507 WP_001213790.1.30535 WP_001213790.1.30547 WP_001213790.1.30548 WP_001213790.1.30555 WP_001213790.1.30573 WP_001213790.1.30589 WP_001213790.1.30602 WP_001213790.1.30619 WP_001213790.1.30627 WP_001213790.1.30635 WP_001213790.1.3066 WP_001213790.1.3067 WP_001213790.1.30696 WP_001213790.1.30752 WP_001213790.1.3076 WP_001213790.1.30794 WP_001213790.1.30802 WP_001213790.1.30803 WP_001213790.1.30819 WP_001213790.1.30833 WP_001213790.1.30835 WP_001213790.1.3089 WP_001213790.1.30909 WP_001213790.1.30934 WP_001213790.1.3095 WP_001213790.1.30968 WP_001213790.1.30972 WP_001213790.1.31 WP_001213790.1.31001 WP_001213790.1.31042 WP_001213790.1.31069 WP_001213790.1.31086 WP_001213790.1.31092 WP_001213790.1.31107 WP_001213790.1.31122 WP_001213790.1.3113 WP_001213790.1.31155 WP_001213790.1.31167 WP_001213790.1.3119 WP_001213790.1.31190 WP_001213790.1.31195 WP_001213790.1.31196 WP_001213790.1.31210 WP_001213790.1.31214 WP_001213790.1.31219 WP_001213790.1.31222 WP_001213790.1.3124 WP_001213790.1.31262 WP_001213790.1.3127 WP_001213790.1.31272 WP_001213790.1.31281 WP_001213790.1.31335 WP_001213790.1.31362 WP_001213790.1.31435 WP_001213790.1.31451 WP_001213790.1.31476 WP_001213790.1.31504 WP_001213790.1.31515 WP_001213790.1.31546 WP_001213790.1.31578 WP_001213790.1.31585 WP_001213790.1.31658 WP_001213790.1.3167 WP_001213790.1.3170 WP_001213790.1.31762 WP_001213790.1.31782 WP_001213790.1.3185 WP_001213790.1.31895 WP_001213790.1.31901 WP_001213790.1.31927 WP_001213790.1.31940 WP_001213790.1.31967 WP_001213790.1.31972 WP_001213790.1.31983 WP_001213790.1.32006 WP_001213790.1.3208 WP_001213790.1.32109 WP_001213790.1.32116 WP_001213790.1.32192 WP_001213790.1.32204 WP_001213790.1.32206 WP_001213790.1.32252 WP_001213790.1.32260 WP_001213790.1.32274 WP_001213790.1.32275 WP_001213790.1.32277 WP_001213790.1.32309 WP_001213790.1.32357 WP_001213790.1.32423 WP_001213790.1.32424 WP_001213790.1.32438 WP_001213790.1.32493 WP_001213790.1.32515 WP_001213790.1.32519 WP_001213790.1.32527 WP_001213790.1.32629 WP_001213790.1.32643 WP_001213790.1.32660 WP_001213790.1.32668 WP_001213790.1.32702 WP_001213790.1.32714 WP_001213790.1.32740 WP_001213790.1.32747 WP_001213790.1.32750 WP_001213790.1.3278 WP_001213790.1.32786 WP_001213790.1.32804 WP_001213790.1.32832 WP_001213790.1.32860 WP_001213790.1.32881 WP_001213790.1.32899 WP_001213790.1.329 WP_001213790.1.32900 WP_001213790.1.32907 WP_001213790.1.32961 WP_001213790.1.32977 WP_001213790.1.33030 WP_001213790.1.3304 WP_001213790.1.33078 WP_001213790.1.3310 WP_001213790.1.33114 WP_001213790.1.33127 WP_001213790.1.33143 WP_001213790.1.33144 WP_001213790.1.33160 WP_001213790.1.33248 WP_001213790.1.33253 WP_001213790.1.33261 WP_001213790.1.33270 WP_001213790.1.333 WP_001213790.1.33392 WP_001213790.1.33409 WP_001213790.1.33420 WP_001213790.1.33486 WP_001213790.1.33492 WP_001213790.1.33499 WP_001213790.1.335 WP_001213790.1.33504 WP_001213790.1.33553 WP_001213790.1.3356 WP_001213790.1.33580 WP_001213790.1.33586 WP_001213790.1.33592 WP_001213790.1.33609 WP_001213790.1.33629 WP_001213790.1.3364 WP_001213790.1.33659 WP_001213790.1.33817 WP_001213790.1.33825 WP_001213790.1.33865 WP_001213790.1.33894 WP_001213790.1.3394 WP_001213790.1.3395 WP_001213790.1.3396 WP_001213790.1.34 WP_001213790.1.34022 WP_001213790.1.34075 WP_001213790.1.34081 WP_001213790.1.34084 WP_001213790.1.34091 WP_001213790.1.34107 WP_001213790.1.34126 WP_001213790.1.34179 WP_001213790.1.34184 WP_001213790.1.34185 WP_001213790.1.34259 WP_001213790.1.34279 WP_001213790.1.34292 WP_001213790.1.34304 WP_001213790.1.34319 WP_001213790.1.34330 WP_001213790.1.3438 WP_001213790.1.34417 WP_001213790.1.34424 WP_001213790.1.34431 WP_001213790.1.3445 WP_001213790.1.34453 WP_001213790.1.34454 WP_001213790.1.34610 WP_001213790.1.34614 WP_001213790.1.34659 WP_001213790.1.34667 WP_001213790.1.34684 WP_001213790.1.34704 WP_001213790.1.34711 WP_001213790.1.34745 WP_001213790.1.34817 WP_001213790.1.34820 WP_001213790.1.34856 WP_001213790.1.34881 WP_001213790.1.34975 WP_001213790.1.34977 WP_001213790.1.35035 WP_001213790.1.35045 WP_001213790.1.35075 WP_001213790.1.35129 WP_001213790.1.35184 WP_001213790.1.35193 WP_001213790.1.35298 WP_001213790.1.35321 WP_001213790.1.35331 WP_001213790.1.35332 WP_001213790.1.35404 WP_001213790.1.35408 WP_001213790.1.3541 WP_001213790.1.35425 WP_001213790.1.35429 WP_001213790.1.35446 WP_001213790.1.35460 WP_001213790.1.35463 WP_001213790.1.35494 WP_001213790.1.35503 WP_001213790.1.35507 WP_001213790.1.35509 WP_001213790.1.3556 WP_001213790.1.35563 WP_001213790.1.35570 WP_001213790.1.35590 WP_001213790.1.35594 WP_001213790.1.35619 WP_001213790.1.35624 WP_001213790.1.3566 WP_001213790.1.3572 WP_001213790.1.35777 WP_001213790.1.35809 WP_001213790.1.35835 WP_001213790.1.35868 WP_001213790.1.35887 WP_001213790.1.35892 WP_001213790.1.35936 WP_001213790.1.35940 WP_001213790.1.35961 WP_001213790.1.35993 WP_001213790.1.36003 WP_001213790.1.3601 WP_001213790.1.36011 WP_001213790.1.36017 WP_001213790.1.36037 WP_001213790.1.36057 WP_001213790.1.36063 WP_001213790.1.3610 WP_001213790.1.36157 WP_001213790.1.36172 WP_001213790.1.36229 WP_001213790.1.36232 WP_001213790.1.36236 WP_001213790.1.36286 WP_001213790.1.36409 WP_001213790.1.36425 WP_001213790.1.36445 WP_001213790.1.36512 WP_001213790.1.36542 WP_001213790.1.36547 WP_001213790.1.36584 WP_001213790.1.36586 WP_001213790.1.36592 WP_001213790.1.36609 WP_001213790.1.36652 WP_001213790.1.36685 WP_001213790.1.36690 WP_001213790.1.3670 WP_001213790.1.36705 WP_001213790.1.36721 WP_001213790.1.36764 WP_001213790.1.36765 WP_001213790.1.36792 WP_001213790.1.36875 WP_001213790.1.3688 WP_001213790.1.36885 WP_001213790.1.36889 WP_001213790.1.36918 WP_001213790.1.36931 WP_001213790.1.36948 WP_001213790.1.36949 WP_001213790.1.37021 WP_001213790.1.37028 WP_001213790.1.37029 WP_001213790.1.37063 WP_001213790.1.37073 WP_001213790.1.37100 WP_001213790.1.37111 WP_001213790.1.37112 WP_001213790.1.37114 WP_001213790.1.37147 WP_001213790.1.37158 WP_001213790.1.37190 WP_001213790.1.37191 WP_001213790.1.37256 WP_001213790.1.3726 WP_001213790.1.37267 WP_001213790.1.3728 WP_001213790.1.37293 WP_001213790.1.37297 WP_001213790.1.37320 WP_001213790.1.3734 WP_001213790.1.37363 WP_001213790.1.37370 WP_001213790.1.37376 WP_001213790.1.37405 WP_001213790.1.3744 WP_001213790.1.3748 WP_001213790.1.37498 WP_001213790.1.37504 WP_001213790.1.37558 WP_001213790.1.3756 WP_001213790.1.37610 WP_001213790.1.37618 WP_001213790.1.37666 WP_001213790.1.37687 WP_001213790.1.3771 WP_001213790.1.37719 WP_001213790.1.3778 WP_001213790.1.37808 WP_001213790.1.37848 WP_001213790.1.37864 WP_001213790.1.3790 WP_001213790.1.37965 WP_001213790.1.37968 WP_001213790.1.37978 WP_001213790.1.38001 WP_001213790.1.38037 WP_001213790.1.38047 WP_001213790.1.38055 WP_001213790.1.38113 WP_001213790.1.38125 WP_001213790.1.38145 WP_001213790.1.38199 WP_001213790.1.3828 WP_001213790.1.383 WP_001213790.1.38341 WP_001213790.1.38344 WP_001213790.1.38393 WP_001213790.1.38408 WP_001213790.1.38452 WP_001213790.1.3848 WP_001213790.1.38569 WP_001213790.1.38613 WP_001213790.1.38620 WP_001213790.1.38673 WP_001213790.1.3869 WP_001213790.1.38693 WP_001213790.1.38740 WP_001213790.1.38773 WP_001213790.1.38781 WP_001213790.1.38797 WP_001213790.1.38857 WP_001213790.1.38882 WP_001213790.1.38898 WP_001213790.1.3891 WP_001213790.1.38913 WP_001213790.1.38942 WP_001213790.1.38995 WP_001213790.1.39003 WP_001213790.1.39048 WP_001213790.1.39055 WP_001213790.1.39059 WP_001213790.1.39065 WP_001213790.1.39075 WP_001213790.1.39082 WP_001213790.1.39112 WP_001213790.1.39136 WP_001213790.1.39140 WP_001213790.1.39146 WP_001213790.1.39183 WP_001213790.1.39197 WP_001213790.1.39265 WP_001213790.1.39311 WP_001213790.1.39312 WP_001213790.1.39385 WP_001213790.1.39395 WP_001213790.1.39405 WP_001213790.1.39414 WP_001213790.1.39420 WP_001213790.1.39449 WP_001213790.1.39466 WP_001213790.1.39497 WP_001213790.1.39503 WP_001213790.1.39512 WP_001213790.1.39556 WP_001213790.1.39576 WP_001213790.1.39584 WP_001213790.1.39614 WP_001213790.1.39629 WP_001213790.1.39632 WP_001213790.1.39722 WP_001213790.1.39723 WP_001213790.1.39724 WP_001213790.1.39763 WP_001213790.1.39862 WP_001213790.1.39921 WP_001213790.1.39923 WP_001213790.1.39953 WP_001213790.1.40008 WP_001213790.1.40017 WP_001213790.1.40031 WP_001213790.1.40072 WP_001213790.1.40073 WP_001213790.1.40081 WP_001213790.1.4011 WP_001213790.1.40155 WP_001213790.1.40158 WP_001213790.1.40170 WP_001213790.1.40171 WP_001213790.1.40205 WP_001213790.1.40208 WP_001213790.1.40240 WP_001213790.1.40254 WP_001213790.1.40257 WP_001213790.1.40259 WP_001213790.1.40284 WP_001213790.1.40292 WP_001213790.1.40305 WP_001213790.1.40307 WP_001213790.1.40311 WP_001213790.1.40341 WP_001213790.1.40374 WP_001213790.1.40380 WP_001213790.1.40395 WP_001213790.1.40465 WP_001213790.1.40492 WP_001213790.1.40493 WP_001213790.1.40508 WP_001213790.1.40528 WP_001213790.1.40533 WP_001213790.1.40577 WP_001213790.1.40583 WP_001213790.1.40605 WP_001213790.1.40622 WP_001213790.1.40648 WP_001213790.1.40688 WP_001213790.1.40693 WP_001213790.1.40695 WP_001213790.1.40710 WP_001213790.1.40745 WP_001213790.1.4075 WP_001213790.1.40788 WP_001213790.1.40849 WP_001213790.1.4087 WP_001213790.1.40877 WP_001213790.1.40910 WP_001213790.1.40930 WP_001213790.1.40935 WP_001213790.1.40973 WP_001213790.1.40996 WP_001213790.1.41017 WP_001213790.1.41018 WP_001213790.1.41048 WP_001213790.1.41050 WP_001213790.1.41086 WP_001213790.1.4109 WP_001213790.1.41091 WP_001213790.1.41116 WP_001213790.1.41128 WP_001213790.1.4114 WP_001213790.1.41192 WP_001213790.1.41225 WP_001213790.1.41226 WP_001213790.1.41265 WP_001213790.1.41277 WP_001213790.1.41279 WP_001213790.1.41299 WP_001213790.1.41308 WP_001213790.1.41310 WP_001213790.1.41375 WP_001213790.1.4141 WP_001213790.1.41427 WP_001213790.1.41434 WP_001213790.1.41438 WP_001213790.1.41440 WP_001213790.1.41468 WP_001213790.1.41516 WP_001213790.1.41528 WP_001213790.1.41554 WP_001213790.1.41572 WP_001213790.1.41591 WP_001213790.1.41593 WP_001213790.1.41610 WP_001213790.1.41628 WP_001213790.1.41662 WP_001213790.1.41688 WP_001213790.1.41690 WP_001213790.1.41708 WP_001213790.1.41724 WP_001213790.1.41735 WP_001213790.1.41761 WP_001213790.1.41789 WP_001213790.1.41799 WP_001213790.1.4184 WP_001213790.1.41859 WP_001213790.1.41862 WP_001213790.1.41882 WP_001213790.1.41897 WP_001213790.1.41911 WP_001213790.1.41931 WP_001213790.1.41938 WP_001213790.1.41949 WP_001213790.1.41978 WP_001213790.1.41979 WP_001213790.1.41985 WP_001213790.1.41994 WP_001213790.1.41998 WP_001213790.1.42009 WP_001213790.1.42098 WP_001213790.1.42104 WP_001213790.1.42136 WP_001213790.1.42156 WP_001213790.1.422 WP_001213790.1.4222 WP_001213790.1.42238 WP_001213790.1.42243 WP_001213790.1.42248 WP_001213790.1.42263 WP_001213790.1.42276 WP_001213790.1.4229 WP_001213790.1.42320 WP_001213790.1.42322 WP_001213790.1.42328 WP_001213790.1.42342 WP_001213790.1.42356 WP_001213790.1.42372 WP_001213790.1.4239 WP_001213790.1.42392 WP_001213790.1.42404 WP_001213790.1.42422 WP_001213790.1.42444 WP_001213790.1.42453 WP_001213790.1.42489 WP_001213790.1.42491 WP_001213790.1.4257 WP_001213790.1.42605 WP_001213790.1.42666 WP_001213790.1.42675 WP_001213790.1.42676 WP_001213790.1.42683 WP_001213790.1.42734 WP_001213790.1.4276 WP_001213790.1.42767 WP_001213790.1.42797 WP_001213790.1.42829 WP_001213790.1.42861 WP_001213790.1.42864 WP_001213790.1.4288 WP_001213790.1.42887 WP_001213790.1.42892 WP_001213790.1.42923 WP_001213790.1.42932 WP_001213790.1.42957 WP_001213790.1.42978 WP_001213790.1.42981 WP_001213790.1.43018 WP_001213790.1.43041 WP_001213790.1.43089 WP_001213790.1.43149 WP_001213790.1.43160 WP_001213790.1.43201 WP_001213790.1.43244 WP_001213790.1.43258 WP_001213790.1.43272 WP_001213790.1.43299 WP_001213790.1.43312 WP_001213790.1.4332 WP_001213790.1.43334 WP_001213790.1.43339 WP_001213790.1.43351 WP_001213790.1.43371 WP_001213790.1.43437 WP_001213790.1.4344 WP_001213790.1.43476 WP_001213790.1.43508 WP_001213790.1.43522 WP_001213790.1.43528 WP_001213790.1.43535 WP_001213790.1.43606 WP_001213790.1.43613 WP_001213790.1.43654 WP_001213790.1.43668 WP_001213790.1.43676 WP_001213790.1.43685 WP_001213790.1.43711 WP_001213790.1.43763 WP_001213790.1.43778 WP_001213790.1.43782 WP_001213790.1.43785 WP_001213790.1.43828 WP_001213790.1.43864 WP_001213790.1.43873 WP_001213790.1.43875 WP_001213790.1.43886 WP_001213790.1.43951 WP_001213790.1.43954 WP_001213790.1.44005 WP_001213790.1.44010 WP_001213790.1.4404 WP_001213790.1.44043 WP_001213790.1.4405 WP_001213790.1.44063 WP_001213790.1.44099 WP_001213790.1.44113 WP_001213790.1.44121 WP_001213790.1.44144 WP_001213790.1.44191 WP_001213790.1.44208 WP_001213790.1.4422 WP_001213790.1.4423 WP_001213790.1.44250 WP_001213790.1.44291 WP_001213790.1.44300 WP_001213790.1.44310 WP_001213790.1.44337 WP_001213790.1.44339 WP_001213790.1.44359 WP_001213790.1.44380 WP_001213790.1.44386 WP_001213790.1.44397 WP_001213790.1.4440 WP_001213790.1.44433 WP_001213790.1.44440 WP_001213790.1.44443 WP_001213790.1.44453 WP_001213790.1.44474 WP_001213790.1.44479 WP_001213790.1.44549 WP_001213790.1.44578 WP_001213790.1.44593 WP_001213790.1.44606 WP_001213790.1.44607 WP_001213790.1.44633 WP_001213790.1.44636 WP_001213790.1.44640 WP_001213790.1.4467 WP_001213790.1.44678 WP_001213790.1.44687 WP_001213790.1.44702 WP_001213790.1.44705 WP_001213790.1.44747 WP_001213790.1.44781 WP_001213790.1.44791 WP_001213790.1.44795 WP_001213790.1.44831 WP_001213790.1.44833 WP_001213790.1.4485 WP_001213790.1.44877 WP_001213790.1.44887 WP_001213790.1.44927 WP_001213790.1.44933 WP_001213790.1.44943 WP_001213790.1.44950 WP_001213790.1.44966 WP_001213790.1.44971 WP_001213790.1.44978 WP_001213790.1.44985 WP_001213790.1.44996 WP_001213790.1.44997 WP_001213790.1.4500 WP_001213790.1.45027 WP_001213790.1.45045 WP_001213790.1.4505 WP_001213790.1.45067 WP_001213790.1.45074 WP_001213790.1.45079 WP_001213790.1.45098 WP_001213790.1.45123 WP_001213790.1.45134 WP_001213790.1.45138 WP_001213790.1.45145 WP_001213790.1.45154 WP_001213790.1.45173 WP_001213790.1.45177 WP_001213790.1.45184 WP_001213790.1.45251 WP_001213790.1.45259 WP_001213790.1.45268 WP_001213790.1.45302 WP_001213790.1.4531 WP_001213790.1.45322 WP_001213790.1.45344 WP_001213790.1.45349 WP_001213790.1.45351 WP_001213790.1.45365 WP_001213790.1.45402 WP_001213790.1.45432 WP_001213790.1.45434 WP_001213790.1.45462 WP_001213790.1.45468 WP_001213790.1.45522 WP_001213790.1.45535 WP_001213790.1.45549 WP_001213790.1.45550 WP_001213790.1.45566 WP_001213790.1.45569 WP_001213790.1.45571 WP_001213790.1.45582 WP_001213790.1.45583 WP_001213790.1.45585 WP_001213790.1.45622 WP_001213790.1.45660 WP_001213790.1.45690 WP_001213790.1.45797 WP_001213790.1.458 WP_001213790.1.45844 WP_001213790.1.45848 WP_001213790.1.45906 WP_001213790.1.45918 WP_001213790.1.4592 WP_001213790.1.45947 WP_001213790.1.45984 WP_001213790.1.46011 WP_001213790.1.46028 WP_001213790.1.46069 WP_001213790.1.46091 WP_001213790.1.46112 WP_001213790.1.46124 WP_001213790.1.46173 WP_001213790.1.46174 WP_001213790.1.46187 WP_001213790.1.46203 WP_001213790.1.46215 WP_001213790.1.46232 WP_001213790.1.46243 WP_001213790.1.46250 WP_001213790.1.46278 WP_001213790.1.46286 WP_001213790.1.46299 WP_001213790.1.46303 WP_001213790.1.46345 WP_001213790.1.46358 WP_001213790.1.46406 WP_001213790.1.46434 WP_001213790.1.46444 WP_001213790.1.46499 WP_001213790.1.46574 WP_001213790.1.46578 WP_001213790.1.46595 WP_001213790.1.46620 WP_001213790.1.46637 WP_001213790.1.46666 WP_001213790.1.46675 WP_001213790.1.46689 WP_001213790.1.46693 WP_001213790.1.4671 WP_001213790.1.46726 WP_001213790.1.46730 WP_001213790.1.4674 WP_001213790.1.46803 WP_001213790.1.46804 WP_001213790.1.4686 WP_001213790.1.46930 WP_001213790.1.46961 WP_001213790.1.46967 WP_001213790.1.46975 WP_001213790.1.46976 WP_001213790.1.47005 WP_001213790.1.47008 WP_001213790.1.47014 WP_001213790.1.47023 WP_001213790.1.47057 WP_001213790.1.47058 WP_001213790.1.47061 WP_001213790.1.47110 WP_001213790.1.47214 WP_001213790.1.47243 WP_001213790.1.47429 WP_001213790.1.47442 WP_001213790.1.47448 WP_001213790.1.47460 WP_001213790.1.4747 WP_001213790.1.47472 WP_001213790.1.47478 WP_001213790.1.47482 WP_001213790.1.47492 WP_001213790.1.47507 WP_001213790.1.47542 WP_001213790.1.47567 WP_001213790.1.47576 WP_001213790.1.47579 WP_001213790.1.4758 WP_001213790.1.47587 WP_001213790.1.47614 WP_001213790.1.47621 WP_001213790.1.47649 WP_001213790.1.47660 WP_001213790.1.4769 WP_001213790.1.4775 WP_001213790.1.47767 WP_001213790.1.47799 WP_001213790.1.47814 WP_001213790.1.47829 WP_001213790.1.47850 WP_001213790.1.47875 WP_001213790.1.47902 WP_001213790.1.47911 WP_001213790.1.4795 WP_001213790.1.47988 WP_001213790.1.47992 WP_001213790.1.48124 WP_001213790.1.48132 WP_001213790.1.48134 WP_001213790.1.48209 WP_001213790.1.48215 WP_001213790.1.48218 WP_001213790.1.48242 WP_001213790.1.48244 WP_001213790.1.48253 WP_001213790.1.48262 WP_001213790.1.48268 WP_001213790.1.483 WP_001213790.1.48367 WP_001213790.1.48377 WP_001213790.1.4839 WP_001213790.1.48399 WP_001213790.1.48493 WP_001213790.1.48510 WP_001213790.1.4853 WP_001213790.1.48570 WP_001213790.1.48647 WP_001213790.1.48651 WP_001213790.1.48751 WP_001213790.1.48755 WP_001213790.1.48768 WP_001213790.1.48774 WP_001213790.1.48788 WP_001213790.1.48797 WP_001213790.1.48841 WP_001213790.1.4885 WP_001213790.1.48876 WP_001213790.1.48886 WP_001213790.1.48894 WP_001213790.1.48896 WP_001213790.1.48908 WP_001213790.1.48919 WP_001213790.1.48985 WP_001213790.1.49005 WP_001213790.1.49041 WP_001213790.1.49084 WP_001213790.1.49090 WP_001213790.1.49102 WP_001213790.1.49113 WP_001213790.1.49155 WP_001213790.1.49162 WP_001213790.1.49175 WP_001213790.1.49204 WP_001213790.1.49214 WP_001213790.1.49226 WP_001213790.1.49239 WP_001213790.1.49256 WP_001213790.1.49262 WP_001213790.1.49276 WP_001213790.1.49290 WP_001213790.1.49304 WP_001213790.1.49311 WP_001213790.1.49334 WP_001213790.1.49340 WP_001213790.1.49358 WP_001213790.1.49366 WP_001213790.1.49375 WP_001213790.1.49430 WP_001213790.1.49443 WP_001213790.1.49472 WP_001213790.1.49490 WP_001213790.1.49494 WP_001213790.1.49515 WP_001213790.1.49550 WP_001213790.1.49572 WP_001213790.1.49574 WP_001213790.1.49590 WP_001213790.1.49595 WP_001213790.1.49602 WP_001213790.1.49630 WP_001213790.1.49647 WP_001213790.1.49650 WP_001213790.1.49686 WP_001213790.1.49770 WP_001213790.1.49778 WP_001213790.1.4979 WP_001213790.1.49790 WP_001213790.1.49803 WP_001213790.1.49805 WP_001213790.1.49827 WP_001213790.1.49848 WP_001213790.1.49929 WP_001213790.1.49931 WP_001213790.1.50003 WP_001213790.1.50007 WP_001213790.1.50080 WP_001213790.1.50128 WP_001213790.1.50153 WP_001213790.1.50161 WP_001213790.1.50198 WP_001213790.1.50211 WP_001213790.1.50238 WP_001213790.1.50285 WP_001213790.1.50332 WP_001213790.1.50349 WP_001213790.1.50376 WP_001213790.1.50386 WP_001213790.1.50389 WP_001213790.1.50404 WP_001213790.1.50449 WP_001213790.1.50469 WP_001213790.1.50478 WP_001213790.1.50480 WP_001213790.1.50497 WP_001213790.1.50517 WP_001213790.1.50529 WP_001213790.1.50563 WP_001213790.1.5058 WP_001213790.1.50593 WP_001213790.1.50652 WP_001213790.1.50676 WP_001213790.1.50684 WP_001213790.1.50750 WP_001213790.1.50769 WP_001213790.1.50774 WP_001213790.1.50777 WP_001213790.1.50782 WP_001213790.1.50800 WP_001213790.1.50804 WP_001213790.1.50808 WP_001213790.1.50882 WP_001213790.1.50893 WP_001213790.1.50905 WP_001213790.1.50908 WP_001213790.1.50918 WP_001213790.1.50941 WP_001213790.1.50954 WP_001213790.1.50960 WP_001213790.1.50999 WP_001213790.1.51014 WP_001213790.1.51022 WP_001213790.1.51025 WP_001213790.1.51036 WP_001213790.1.51066 WP_001213790.1.51117 WP_001213790.1.51131 WP_001213790.1.5114 WP_001213790.1.51162 WP_001213790.1.51178 WP_001213790.1.51179 WP_001213790.1.51182 WP_001213790.1.51186 WP_001213790.1.51224 WP_001213790.1.5125 WP_001213790.1.51285 WP_001213790.1.51308 WP_001213790.1.51331 WP_001213790.1.51338 WP_001213790.1.51356 WP_001213790.1.5138 WP_001213790.1.51412 WP_001213790.1.51414 WP_001213790.1.51419 WP_001213790.1.51451 WP_001213790.1.51464 WP_001213790.1.51487 WP_001213790.1.51488 WP_001213790.1.51502 WP_001213790.1.51506 WP_001213790.1.51514 WP_001213790.1.51555 WP_001213790.1.51594 WP_001213790.1.51611 WP_001213790.1.51615 WP_001213790.1.51634 WP_001213790.1.51642 WP_001213790.1.51649 WP_001213790.1.51686 WP_001213790.1.51704 WP_001213790.1.51756 WP_001213790.1.51764 WP_001213790.1.51810 WP_001213790.1.51831 WP_001213790.1.51841 WP_001213790.1.5185 WP_001213790.1.51868 WP_001213790.1.51888 WP_001213790.1.51900 WP_001213790.1.51910 WP_001213790.1.51911 WP_001213790.1.51914 WP_001213790.1.51930 WP_001213790.1.51932 WP_001213790.1.51989 WP_001213790.1.51994 WP_001213790.1.520 WP_001213790.1.52047 WP_001213790.1.52052 WP_001213790.1.52101 WP_001213790.1.5211 WP_001213790.1.52121 WP_001213790.1.52148 WP_001213790.1.52170 WP_001213790.1.52301 WP_001213790.1.52321 WP_001213790.1.52336 WP_001213790.1.52346 WP_001213790.1.52353 WP_001213790.1.52356 WP_001213790.1.52361 WP_001213790.1.52438 WP_001213790.1.52446 WP_001213790.1.52456 WP_001213790.1.52527 WP_001213790.1.52528 WP_001213790.1.52582 WP_001213790.1.52586 WP_001213790.1.52637 WP_001213790.1.52653 WP_001213790.1.52656 WP_001213790.1.52675 WP_001213790.1.52692 WP_001213790.1.5273 WP_001213790.1.52738 WP_001213790.1.52743 WP_001213790.1.52748 WP_001213790.1.52824 WP_001213790.1.52833 WP_001213790.1.52851 WP_001213790.1.52857 WP_001213790.1.52866 WP_001213790.1.52898 WP_001213790.1.52915 WP_001213790.1.52924 WP_001213790.1.52949 WP_001213790.1.52985 WP_001213790.1.53100 WP_001213790.1.53107 WP_001213790.1.53119 WP_001213790.1.5313 WP_001213790.1.53158 WP_001213790.1.5316 WP_001213790.1.53179 WP_001213790.1.53190 WP_001213790.1.53198 WP_001213790.1.53234 WP_001213790.1.53272 WP_001213790.1.53286 WP_001213790.1.53315 WP_001213790.1.53316 WP_001213790.1.53328 WP_001213790.1.5333 WP_001213790.1.53362 WP_001213790.1.53385 WP_001213790.1.53406 WP_001213790.1.53436 WP_001213790.1.53466 WP_001213790.1.53529 WP_001213790.1.53534 WP_001213790.1.53543 WP_001213790.1.53567 WP_001213790.1.53664 WP_001213790.1.53675 WP_001213790.1.53688 WP_001213790.1.53694 WP_001213790.1.53696 WP_001213790.1.53757 WP_001213790.1.53772 WP_001213790.1.53778 WP_001213790.1.53781 WP_001213790.1.53790 WP_001213790.1.53814 WP_001213790.1.53896 WP_001213790.1.53905 WP_001213790.1.5392 WP_001213790.1.53935 WP_001213790.1.53961 WP_001213790.1.54033 WP_001213790.1.54061 WP_001213790.1.54075 WP_001213790.1.54082 WP_001213790.1.54085 WP_001213790.1.54136 WP_001213790.1.5415 WP_001213790.1.54196 WP_001213790.1.542 WP_001213790.1.54209 WP_001213790.1.54271 WP_001213790.1.54273 WP_001213790.1.54274 WP_001213790.1.54283 WP_001213790.1.54319 WP_001213790.1.54324 WP_001213790.1.54333 WP_001213790.1.54340 WP_001213790.1.54364 WP_001213790.1.54366 WP_001213790.1.54400 WP_001213790.1.54469 WP_001213790.1.54500 WP_001213790.1.54526 WP_001213790.1.54558 WP_001213790.1.54569 WP_001213790.1.5459 WP_001213790.1.54607 WP_001213790.1.54615 WP_001213790.1.5462 WP_001213790.1.54644 WP_001213790.1.54662 WP_001213790.1.54722 WP_001213790.1.54749 WP_001213790.1.54764 WP_001213790.1.54774 WP_001213790.1.54822 WP_001213790.1.54833 WP_001213790.1.5485 WP_001213790.1.54877 WP_001213790.1.5493 WP_001213790.1.54936 WP_001213790.1.54984 WP_001213790.1.55152 WP_001213790.1.55156 WP_001213790.1.55166 WP_001213790.1.5517 WP_001213790.1.55200 WP_001213790.1.55224 WP_001213790.1.5523 WP_001213790.1.5525 WP_001213790.1.5527 WP_001213790.1.55285 WP_001213790.1.55294 WP_001213790.1.55325 WP_001213790.1.55361 WP_001213790.1.55418 WP_001213790.1.55430 WP_001213790.1.55461 WP_001213790.1.55475 WP_001213790.1.55477 WP_001213790.1.55496 WP_001213790.1.5552 WP_001213790.1.55528 WP_001213790.1.55545 WP_001213790.1.55554 WP_001213790.1.55559 WP_001213790.1.5560 WP_001213790.1.55614 WP_001213790.1.55623 WP_001213790.1.55640 WP_001213790.1.55647 WP_001213790.1.55680 WP_001213790.1.55706 WP_001213790.1.55718 WP_001213790.1.5572 WP_001213790.1.55743 WP_001213790.1.55768 WP_001213790.1.5577 WP_001213790.1.55782 WP_001213790.1.55796 WP_001213790.1.55803 WP_001213790.1.55853 WP_001213790.1.55923 WP_001213790.1.55948 WP_001213790.1.55973 WP_001213790.1.55993 WP_001213790.1.55995 WP_001213790.1.56002 WP_001213790.1.56004 WP_001213790.1.56012 WP_001213790.1.56059 WP_001213790.1.56069 WP_001213790.1.56070 WP_001213790.1.56082 WP_001213790.1.56097 WP_001213790.1.56105 WP_001213790.1.56130 WP_001213790.1.56152 WP_001213790.1.56222 WP_001213790.1.56235 WP_001213790.1.56238 WP_001213790.1.56244 WP_001213790.1.56247 WP_001213790.1.56261 WP_001213790.1.56263 WP_001213790.1.56286 WP_001213790.1.56303 WP_001213790.1.56304 WP_001213790.1.5633 WP_001213790.1.56354 WP_001213790.1.56370 WP_001213790.1.56374 WP_001213790.1.56385 WP_001213790.1.56389 WP_001213790.1.56393 WP_001213790.1.56396 WP_001213790.1.56413 WP_001213790.1.56414 WP_001213790.1.56420 WP_001213790.1.56438 WP_001213790.1.56468 WP_001213790.1.56512 WP_001213790.1.56559 WP_001213790.1.56560 WP_001213790.1.56597 WP_001213790.1.56601 WP_001213790.1.56614 WP_001213790.1.56642 WP_001213790.1.56660 WP_001213790.1.56671 WP_001213790.1.5668 WP_001213790.1.56682 WP_001213790.1.56791 WP_001213790.1.56824 WP_001213790.1.56851 WP_001213790.1.56853 WP_001213790.1.56861 WP_001213790.1.56875 WP_001213790.1.56877 WP_001213790.1.56893 WP_001213790.1.56898 WP_001213790.1.56905 WP_001213790.1.56942 WP_001213790.1.56950 WP_001213790.1.57026 WP_001213790.1.57039 WP_001213790.1.57056 WP_001213790.1.57076 WP_001213790.1.57084 WP_001213790.1.5711 WP_001213790.1.57125 WP_001213790.1.57143 WP_001213790.1.57149 WP_001213790.1.57168 WP_001213790.1.57187 WP_001213790.1.57232 WP_001213790.1.57233 WP_001213790.1.57244 WP_001213790.1.57246 WP_001213790.1.57296 WP_001213790.1.57307 WP_001213790.1.57344 WP_001213790.1.57356 WP_001213790.1.57357 WP_001213790.1.57362 WP_001213790.1.57377 WP_001213790.1.57418 WP_001213790.1.57433 WP_001213790.1.57495 WP_001213790.1.57510 WP_001213790.1.57515 WP_001213790.1.57521 WP_001213790.1.57529 WP_001213790.1.5753 WP_001213790.1.57534 WP_001213790.1.57555 WP_001213790.1.57559 WP_001213790.1.57576 WP_001213790.1.57601 WP_001213790.1.57607 WP_001213790.1.5761 WP_001213790.1.57631 WP_001213790.1.57710 WP_001213790.1.5774 WP_001213790.1.57763 WP_001213790.1.57778 WP_001213790.1.57781 WP_001213790.1.57797 WP_001213790.1.5781 WP_001213790.1.57835 WP_001213790.1.57857 WP_001213790.1.57862 WP_001213790.1.57890 WP_001213790.1.57891 WP_001213790.1.57893 WP_001213790.1.57902 WP_001213790.1.57978 WP_001213790.1.5801 WP_001213790.1.58040 WP_001213790.1.58041 WP_001213790.1.58090 WP_001213790.1.58131 WP_001213790.1.58144 WP_001213790.1.58239 WP_001213790.1.58249 WP_001213790.1.58251 WP_001213790.1.5828 WP_001213790.1.58290 WP_001213790.1.58301 WP_001213790.1.58334 WP_001213790.1.58357 WP_001213790.1.58358 WP_001213790.1.58372 WP_001213790.1.58407 WP_001213790.1.58416 WP_001213790.1.58418 WP_001213790.1.58442 WP_001213790.1.58443 WP_001213790.1.58467 WP_001213790.1.58486 WP_001213790.1.58489 WP_001213790.1.5854 WP_001213790.1.58548 WP_001213790.1.58564 WP_001213790.1.5858 WP_001213790.1.58604 WP_001213790.1.58633 WP_001213790.1.58662 WP_001213790.1.58669 WP_001213790.1.58675 WP_001213790.1.58698 WP_001213790.1.587 WP_001213790.1.58729 WP_001213790.1.58744 WP_001213790.1.58745 WP_001213790.1.58749 WP_001213790.1.5878 WP_001213790.1.58803 WP_001213790.1.58834 WP_001213790.1.5886 WP_001213790.1.58861 WP_001213790.1.58884 WP_001213790.1.58926 WP_001213790.1.59006 WP_001213790.1.59012 WP_001213790.1.59068 WP_001213790.1.5907 WP_001213790.1.59084 WP_001213790.1.59094 WP_001213790.1.59142 WP_001213790.1.59148 WP_001213790.1.59163 WP_001213790.1.59204 WP_001213790.1.59224 WP_001213790.1.59236 WP_001213790.1.59276 WP_001213790.1.5929 WP_001213790.1.59294 WP_001213790.1.59295 WP_001213790.1.59335 WP_001213790.1.59336 WP_001213790.1.59375 WP_001213790.1.59381 WP_001213790.1.59420 WP_001213790.1.59427 WP_001213790.1.59439 WP_001213790.1.59458 WP_001213790.1.59486 WP_001213790.1.59490 WP_001213790.1.59508 WP_001213790.1.5953 WP_001213790.1.59538 WP_001213790.1.59548 WP_001213790.1.59587 WP_001213790.1.59604 WP_001213790.1.59641 WP_001213790.1.59646 WP_001213790.1.59684 WP_001213790.1.59694 WP_001213790.1.59709 WP_001213790.1.59755 WP_001213790.1.59771 WP_001213790.1.5979 WP_001213790.1.59830 WP_001213790.1.59848 WP_001213790.1.59928 WP_001213790.1.59953 WP_001213790.1.59979 WP_001213790.1.60008 WP_001213790.1.60015 WP_001213790.1.60021 WP_001213790.1.60069 WP_001213790.1.60126 WP_001213790.1.60137 WP_001213790.1.60140 WP_001213790.1.60155 WP_001213790.1.60213 WP_001213790.1.60226 WP_001213790.1.60231 WP_001213790.1.60285 WP_001213790.1.60320 WP_001213790.1.6033 WP_001213790.1.60330 WP_001213790.1.60379 WP_001213790.1.60425 WP_001213790.1.60464 WP_001213790.1.60469 WP_001213790.1.60486 WP_001213790.1.60503 WP_001213790.1.60507 WP_001213790.1.6052 WP_001213790.1.60545 WP_001213790.1.60560 WP_001213790.1.60561 WP_001213790.1.60597 WP_001213790.1.60622 WP_001213790.1.60713 WP_001213790.1.60746 WP_001213790.1.60760 WP_001213790.1.60772 WP_001213790.1.608 WP_001213790.1.60809 WP_001213790.1.60838 WP_001213790.1.60851 WP_001213790.1.60855 WP_001213790.1.60857 WP_001213790.1.60863 WP_001213790.1.60866 WP_001213790.1.60874 WP_001213790.1.60897 WP_001213790.1.6090 WP_001213790.1.60919 WP_001213790.1.60926 WP_001213790.1.60941 WP_001213790.1.60988 WP_001213790.1.60990 WP_001213790.1.61078 WP_001213790.1.61087 WP_001213790.1.61114 WP_001213790.1.6114 WP_001213790.1.61184 WP_001213790.1.61218 WP_001213790.1.61232 WP_001213790.1.61233 WP_001213790.1.6129 WP_001213790.1.61296 WP_001213790.1.61309 WP_001213790.1.61345 WP_001213790.1.61356 WP_001213790.1.61381 WP_001213790.1.61417 WP_001213790.1.6143 WP_001213790.1.61497 WP_001213790.1.61501 WP_001213790.1.61519 WP_001213790.1.61574 WP_001213790.1.61594 WP_001213790.1.61595 WP_001213790.1.61609 WP_001213790.1.6164 WP_001213790.1.61667 WP_001213790.1.61671 WP_001213790.1.61694 WP_001213790.1.61712 WP_001213790.1.61714 WP_001213790.1.61732 WP_001213790.1.61737 WP_001213790.1.61783 WP_001213790.1.61857 WP_001213790.1.6190 WP_001213790.1.61908 WP_001213790.1.61918 WP_001213790.1.61922 WP_001213790.1.61924 WP_001213790.1.61952 WP_001213790.1.62007 WP_001213790.1.62020 WP_001213790.1.62025 WP_001213790.1.62063 WP_001213790.1.62076 WP_001213790.1.6209 WP_001213790.1.6210 WP_001213790.1.62108 WP_001213790.1.62142 WP_001213790.1.62144 WP_001213790.1.62158 WP_001213790.1.62184 WP_001213790.1.62195 WP_001213790.1.62201 WP_001213790.1.62204 WP_001213790.1.62210 WP_001213790.1.62219 WP_001213790.1.62241 WP_001213790.1.62245 WP_001213790.1.62257 WP_001213790.1.62304 WP_001213790.1.62310 WP_001213790.1.62344 WP_001213790.1.62364 WP_001213790.1.62374 WP_001213790.1.62403 WP_001213790.1.62412 WP_001213790.1.62486 WP_001213790.1.62504 WP_001213790.1.6253 WP_001213790.1.62564 WP_001213790.1.62570 WP_001213790.1.62619 WP_001213790.1.62677 WP_001213790.1.62693 WP_001213790.1.627 WP_001213790.1.62725 WP_001213790.1.62745 WP_001213790.1.62757 WP_001213790.1.62798 WP_001213790.1.62828 WP_001213790.1.62853 WP_001213790.1.62903 WP_001213790.1.62910 WP_001213790.1.6292 WP_001213790.1.62955 WP_001213790.1.62983 WP_001213790.1.62988 WP_001213790.1.63043 WP_001213790.1.63045 WP_001213790.1.63063 WP_001213790.1.63102 WP_001213790.1.63118 WP_001213790.1.63135 WP_001213790.1.63155 WP_001213790.1.63181 WP_001213790.1.63203 WP_001213790.1.63229 WP_001213790.1.63234 WP_001213790.1.63250 WP_001213790.1.63256 WP_001213790.1.63290 WP_001213790.1.63358 WP_001213790.1.63382 WP_001213790.1.63432 WP_001213790.1.63461 WP_001213790.1.63479 WP_001213790.1.63497 WP_001213790.1.63499 WP_001213790.1.63509 WP_001213790.1.63513 WP_001213790.1.63525 WP_001213790.1.63529 WP_001213790.1.63532 WP_001213790.1.63568 WP_001213790.1.63577 WP_001213790.1.63585 WP_001213790.1.63603 WP_001213790.1.63633 WP_001213790.1.63664 WP_001213790.1.6367 WP_001213790.1.63690 WP_001213790.1.6370 WP_001213790.1.63718 WP_001213790.1.63731 WP_001213790.1.63748 WP_001213790.1.6375 WP_001213790.1.63757 WP_001213790.1.63781 WP_001213790.1.63782 WP_001213790.1.63797 WP_001213790.1.63824 WP_001213790.1.63831 WP_001213790.1.63834 WP_001213790.1.63851 WP_001213790.1.63860 WP_001213790.1.63863 WP_001213790.1.63864 WP_001213790.1.63866 WP_001213790.1.63903 WP_001213790.1.63912 WP_001213790.1.63934 WP_001213790.1.63958 WP_001213790.1.63977 WP_001213790.1.63992 WP_001213790.1.64007 WP_001213790.1.64010 WP_001213790.1.64018 WP_001213790.1.64034 WP_001213790.1.64036 WP_001213790.1.64046 WP_001213790.1.64072 WP_001213790.1.64085 WP_001213790.1.64109 WP_001213790.1.64121 WP_001213790.1.64157 WP_001213790.1.64229 WP_001213790.1.6423 WP_001213790.1.64242 WP_001213790.1.64244 WP_001213790.1.64266 WP_001213790.1.64294 WP_001213790.1.64350 WP_001213790.1.6437 WP_001213790.1.64374 WP_001213790.1.64385 WP_001213790.1.64387 WP_001213790.1.64389 WP_001213790.1.64403 WP_001213790.1.64462 WP_001213790.1.64500 WP_001213790.1.6451 WP_001213790.1.64569 WP_001213790.1.64597 WP_001213790.1.64649 WP_001213790.1.64674 WP_001213790.1.64702 WP_001213790.1.64711 WP_001213790.1.64715 WP_001213790.1.64757 WP_001213790.1.64758 WP_001213790.1.64771 WP_001213790.1.64781 WP_001213790.1.64798 WP_001213790.1.64831 WP_001213790.1.6489 WP_001213790.1.64894 WP_001213790.1.64919 WP_001213790.1.64944 WP_001213790.1.64972 WP_001213790.1.64977 WP_001213790.1.65011 WP_001213790.1.65016 WP_001213790.1.65018 WP_001213790.1.65022 WP_001213790.1.65027 WP_001213790.1.65028 WP_001213790.1.65171 WP_001213790.1.65185 WP_001213790.1.65248 WP_001213790.1.6525 WP_001213790.1.65269 WP_001213790.1.65295 WP_001213790.1.65308 WP_001213790.1.6535 WP_001213790.1.65357 WP_001213790.1.65363 WP_001213790.1.65474 WP_001213790.1.65475 WP_001213790.1.6550 WP_001213790.1.65508 WP_001213790.1.65538 WP_001213790.1.65558 WP_001213790.1.65572 WP_001213790.1.6558 WP_001213790.1.6560 WP_001213790.1.65601 WP_001213790.1.6561 WP_001213790.1.65633 WP_001213790.1.6565 WP_001213790.1.65687 WP_001213790.1.65696 WP_001213790.1.65698 WP_001213790.1.6572 WP_001213790.1.6575 WP_001213790.1.65771 WP_001213790.1.65782 WP_001213790.1.65790 WP_001213790.1.65795 WP_001213790.1.65818 WP_001213790.1.65838 WP_001213790.1.65849 WP_001213790.1.65876 WP_001213790.1.65881 WP_001213790.1.65883 WP_001213790.1.65901 WP_001213790.1.6594 WP_001213790.1.65940 WP_001213790.1.65945 WP_001213790.1.6595 WP_001213790.1.65956 WP_001213790.1.65968 WP_001213790.1.66049 WP_001213790.1.66074 WP_001213790.1.66082 WP_001213790.1.66085 WP_001213790.1.66122 WP_001213790.1.66167 WP_001213790.1.66171 WP_001213790.1.66235 WP_001213790.1.66250 WP_001213790.1.66272 WP_001213790.1.66289 WP_001213790.1.6630 WP_001213790.1.66314 WP_001213790.1.66315 WP_001213790.1.66330 WP_001213790.1.66358 WP_001213790.1.66362 WP_001213790.1.6638 WP_001213790.1.66385 WP_001213790.1.6640 WP_001213790.1.66400 WP_001213790.1.66428 WP_001213790.1.66446 WP_001213790.1.66462 WP_001213790.1.66492 WP_001213790.1.66534 WP_001213790.1.66539 WP_001213790.1.66600 WP_001213790.1.66630 WP_001213790.1.66678 WP_001213790.1.66698 WP_001213790.1.66702 WP_001213790.1.66733 WP_001213790.1.66779 WP_001213790.1.6680 WP_001213790.1.66800 WP_001213790.1.66807 WP_001213790.1.66820 WP_001213790.1.66824 WP_001213790.1.66834 WP_001213790.1.66876 WP_001213790.1.66901 WP_001213790.1.66937 WP_001213790.1.66959 WP_001213790.1.66962 WP_001213790.1.67037 WP_001213790.1.67045 WP_001213790.1.67075 WP_001213790.1.6710 WP_001213790.1.67100 WP_001213790.1.67173 WP_001213790.1.67175 WP_001213790.1.67181 WP_001213790.1.67184 WP_001213790.1.67228 WP_001213790.1.67235 WP_001213790.1.67268 WP_001213790.1.67279 WP_001213790.1.67288 WP_001213790.1.67347 WP_001213790.1.67374 WP_001213790.1.6739 WP_001213790.1.67405 WP_001213790.1.67424 WP_001213790.1.67465 WP_001213790.1.67552 WP_001213790.1.6760 WP_001213790.1.67603 WP_001213790.1.67637 WP_001213790.1.67682 WP_001213790.1.67707 WP_001213790.1.67731 WP_001213790.1.67772 WP_001213790.1.67776 WP_001213790.1.67814 WP_001213790.1.6782 WP_001213790.1.67825 WP_001213790.1.67829 WP_001213790.1.6785 WP_001213790.1.67887 WP_001213790.1.67905 WP_001213790.1.67924 WP_001213790.1.67932 WP_001213790.1.67969 WP_001213790.1.67970 WP_001213790.1.67977 WP_001213790.1.67988 WP_001213790.1.68036 WP_001213790.1.68073 WP_001213790.1.68115 WP_001213790.1.68140 WP_001213790.1.68147 WP_001213790.1.68159 WP_001213790.1.68167 WP_001213790.1.68201 WP_001213790.1.68206 WP_001213790.1.68210 WP_001213790.1.6827 WP_001213790.1.68275 WP_001213790.1.6833 WP_001213790.1.68401 WP_001213790.1.68477 WP_001213790.1.6849 WP_001213790.1.685 WP_001213790.1.68532 WP_001213790.1.68547 WP_001213790.1.6857 WP_001213790.1.6858 WP_001213790.1.68589 WP_001213790.1.68629 WP_001213790.1.68652 WP_001213790.1.68655 WP_001213790.1.68656 WP_001213790.1.68658 WP_001213790.1.68677 WP_001213790.1.6869 WP_001213790.1.68778 WP_001213790.1.68787 WP_001213790.1.68818 WP_001213790.1.6882 WP_001213790.1.6883 WP_001213790.1.68893 WP_001213790.1.68894 WP_001213790.1.68895 WP_001213790.1.68928 WP_001213790.1.68966 WP_001213790.1.68975 WP_001213790.1.68999 WP_001213790.1.69001 WP_001213790.1.69006 WP_001213790.1.69011 WP_001213790.1.69029 WP_001213790.1.6904 WP_001213790.1.69042 WP_001213790.1.6905 WP_001213790.1.69058 WP_001213790.1.6907 WP_001213790.1.69080 WP_001213790.1.69086 WP_001213790.1.6913 WP_001213790.1.69131 WP_001213790.1.69139 WP_001213790.1.69146 WP_001213790.1.69151 WP_001213790.1.69236 WP_001213790.1.69255 WP_001213790.1.69273 WP_001213790.1.69288 WP_001213790.1.69296 WP_001213790.1.69357 WP_001213790.1.69359 WP_001213790.1.69385 WP_001213790.1.69397 WP_001213790.1.69433 WP_001213790.1.69485 WP_001213790.1.69515 WP_001213790.1.6954 WP_001213790.1.69554 WP_001213790.1.69564 WP_001213790.1.69575 WP_001213790.1.69588 WP_001213790.1.69592 WP_001213790.1.69597 WP_001213790.1.69616 WP_001213790.1.69636 WP_001213790.1.69644 WP_001213790.1.69696 WP_001213790.1.69704 WP_001213790.1.69758 WP_001213790.1.69767 WP_001213790.1.69785 WP_001213790.1.69787 WP_001213790.1.69790 WP_001213790.1.69817 WP_001213790.1.69839 WP_001213790.1.69965 WP_001213790.1.69977 WP_001213790.1.69982 WP_001213790.1.70003 WP_001213790.1.70028 WP_001213790.1.70087 WP_001213790.1.70088 WP_001213790.1.7010 WP_001213790.1.7014 WP_001213790.1.7016 WP_001213790.1.70169 WP_001213790.1.70183 WP_001213790.1.7021 WP_001213790.1.70241 WP_001213790.1.70248 WP_001213790.1.70262 WP_001213790.1.70269 WP_001213790.1.70272 WP_001213790.1.70281 WP_001213790.1.70289 WP_001213790.1.70290 WP_001213790.1.70303 WP_001213790.1.70321 WP_001213790.1.70326 WP_001213790.1.70327 WP_001213790.1.70355 WP_001213790.1.7044 WP_001213790.1.70440 WP_001213790.1.70447 WP_001213790.1.70485 WP_001213790.1.70523 WP_001213790.1.70531 WP_001213790.1.70547 WP_001213790.1.7055 WP_001213790.1.70596 WP_001213790.1.7060 WP_001213790.1.70643 WP_001213790.1.70644 WP_001213790.1.70662 WP_001213790.1.70678 WP_001213790.1.70683 WP_001213790.1.70685 WP_001213790.1.70692 WP_001213790.1.70712 WP_001213790.1.70732 WP_001213790.1.70733 WP_001213790.1.70761 WP_001213790.1.70785 WP_001213790.1.70792 WP_001213790.1.70797 WP_001213790.1.70837 WP_001213790.1.70869 WP_001213790.1.70883 WP_001213790.1.70899 WP_001213790.1.70914 WP_001213790.1.70922 WP_001213790.1.70929 WP_001213790.1.7093 WP_001213790.1.70948 WP_001213790.1.70959 WP_001213790.1.70971 WP_001213790.1.70977 WP_001213790.1.70985 WP_001213790.1.70986 WP_001213790.1.71007 WP_001213790.1.71023 WP_001213790.1.71069 WP_001213790.1.71088 WP_001213790.1.7110 WP_001213790.1.71116 WP_001213790.1.71120 WP_001213790.1.71146 WP_001213790.1.71150 WP_001213790.1.71165 WP_001213790.1.71171 WP_001213790.1.71172 WP_001213790.1.71184 WP_001213790.1.71188 WP_001213790.1.71201 WP_001213790.1.71202 WP_001213790.1.71243 WP_001213790.1.71248 WP_001213790.1.71268 WP_001213790.1.71299 WP_001213790.1.71305 WP_001213790.1.71306 WP_001213790.1.71337 WP_001213790.1.7134 WP_001213790.1.71363 WP_001213790.1.71378 WP_001213790.1.714 WP_001213790.1.71401 WP_001213790.1.71407 WP_001213790.1.71418 WP_001213790.1.7142 WP_001213790.1.71446 WP_001213790.1.71450 WP_001213790.1.71481 WP_001213790.1.71583 WP_001213790.1.71600 WP_001213790.1.71626 WP_001213790.1.71636 WP_001213790.1.71649 WP_001213790.1.71656 WP_001213790.1.71667 WP_001213790.1.71691 WP_001213790.1.71702 WP_001213790.1.7174 WP_001213790.1.71746 WP_001213790.1.71750 WP_001213790.1.71756 WP_001213790.1.71798 WP_001213790.1.71845 WP_001213790.1.71848 WP_001213790.1.71881 WP_001213790.1.71908 WP_001213790.1.71941 WP_001213790.1.71952 WP_001213790.1.71973 WP_001213790.1.71979 WP_001213790.1.71984 WP_001213790.1.720 WP_001213790.1.72065 WP_001213790.1.72068 WP_001213790.1.72100 WP_001213790.1.72105 WP_001213790.1.72119 WP_001213790.1.72121 WP_001213790.1.72182 WP_001213790.1.72188 WP_001213790.1.72190 WP_001213790.1.72203 WP_001213790.1.72220 WP_001213790.1.72221 WP_001213790.1.72226 WP_001213790.1.72234 WP_001213790.1.72243 WP_001213790.1.72254 WP_001213790.1.72277 WP_001213790.1.72281 WP_001213790.1.72300 WP_001213790.1.72325 WP_001213790.1.72339 WP_001213790.1.72372 WP_001213790.1.72376 WP_001213790.1.72382 WP_001213790.1.72403 WP_001213790.1.72412 WP_001213790.1.72438 WP_001213790.1.72470 WP_001213790.1.72532 WP_001213790.1.72594 WP_001213790.1.72602 WP_001213790.1.72625 WP_001213790.1.72629 WP_001213790.1.72671 WP_001213790.1.72689 WP_001213790.1.72716 WP_001213790.1.72718 WP_001213790.1.72728 WP_001213790.1.72793 WP_001213790.1.72797 WP_001213790.1.72827 WP_001213790.1.72843 WP_001213790.1.72850 WP_001213790.1.72865 WP_001213790.1.72871 WP_001213790.1.72872 WP_001213790.1.72887 WP_001213790.1.72892 WP_001213790.1.72894 WP_001213790.1.72897 WP_001213790.1.72946 WP_001213790.1.7295 WP_001213790.1.72968 WP_001213790.1.72975 WP_001213790.1.7304 WP_001213790.1.73062 WP_001213790.1.73068 WP_001213790.1.73102 WP_001213790.1.73125 WP_001213790.1.73144 WP_001213790.1.7315 WP_001213790.1.73164 WP_001213790.1.73200 WP_001213790.1.73242 WP_001213790.1.7334 WP_001213790.1.73362 WP_001213790.1.73377 WP_001213790.1.73379 WP_001213790.1.73461 WP_001213790.1.73481 WP_001213790.1.73512 WP_001213790.1.7356 WP_001213790.1.73561 WP_001213790.1.73581 WP_001213790.1.73596 WP_001213790.1.73617 WP_001213790.1.73667 WP_001213790.1.73701 WP_001213790.1.73708 WP_001213790.1.73753 WP_001213790.1.73758 WP_001213790.1.73764 WP_001213790.1.73794 WP_001213790.1.73804 WP_001213790.1.73831 WP_001213790.1.73847 WP_001213790.1.7386 WP_001213790.1.7387 WP_001213790.1.73901 WP_001213790.1.73924 WP_001213790.1.73926 WP_001213790.1.7394 WP_001213790.1.73958 WP_001213790.1.74029 WP_001213790.1.74040 WP_001213790.1.74089 WP_001213790.1.74117 WP_001213790.1.74174 WP_001213790.1.74181 WP_001213790.1.74191 WP_001213790.1.74207 WP_001213790.1.74228 WP_001213790.1.74248 WP_001213790.1.743 WP_001213790.1.74300 WP_001213790.1.7433 WP_001213790.1.74379 WP_001213790.1.74410 WP_001213790.1.74414 WP_001213790.1.74418 WP_001213790.1.74428 WP_001213790.1.7444 WP_001213790.1.74454 WP_001213790.1.74466 WP_001213790.1.74469 WP_001213790.1.74481 WP_001213790.1.745 WP_001213790.1.74500 WP_001213790.1.74529 WP_001213790.1.74545 WP_001213790.1.74570 WP_001213790.1.74578 WP_001213790.1.74620 WP_001213790.1.74632 WP_001213790.1.74673 WP_001213790.1.74741 WP_001213790.1.74745 WP_001213790.1.74757 WP_001213790.1.74806 WP_001213790.1.74807 WP_001213790.1.74826 WP_001213790.1.74876 WP_001213790.1.74884 WP_001213790.1.7491 WP_001213790.1.74972 WP_001213790.1.74992 WP_001213790.1.74996 WP_001213790.1.75051 WP_001213790.1.75056 WP_001213790.1.75114 WP_001213790.1.75129 WP_001213790.1.75134 WP_001213790.1.75148 WP_001213790.1.75150 WP_001213790.1.75159 WP_001213790.1.75168 WP_001213790.1.75177 WP_001213790.1.75187 WP_001213790.1.75288 WP_001213790.1.75301 WP_001213790.1.7531 WP_001213790.1.75334 WP_001213790.1.75362 WP_001213790.1.75371 WP_001213790.1.75385 WP_001213790.1.75392 WP_001213790.1.75400 WP_001213790.1.75402 WP_001213790.1.7543 WP_001213790.1.75450 WP_001213790.1.75494 WP_001213790.1.7558 WP_001213790.1.75585 WP_001213790.1.75607 WP_001213790.1.75626 WP_001213790.1.75664 WP_001213790.1.75703 WP_001213790.1.75716 WP_001213790.1.75740 WP_001213790.1.75751 WP_001213790.1.75760 WP_001213790.1.75764 WP_001213790.1.75793 WP_001213790.1.75794 WP_001213790.1.75810 WP_001213790.1.75828 WP_001213790.1.75837 WP_001213790.1.75863 WP_001213790.1.75873 WP_001213790.1.75874 WP_001213790.1.75902 WP_001213790.1.75932 WP_001213790.1.75945 WP_001213790.1.76020 WP_001213790.1.76055 WP_001213790.1.76097 WP_001213790.1.76108 WP_001213790.1.76115 WP_001213790.1.76137 WP_001213790.1.76156 WP_001213790.1.76162 WP_001213790.1.76186 WP_001213790.1.76208 WP_001213790.1.76252 WP_001213790.1.7629 WP_001213790.1.76301 WP_001213790.1.76327 WP_001213790.1.7633 WP_001213790.1.7634 WP_001213790.1.76345 WP_001213790.1.76346 WP_001213790.1.76364 WP_001213790.1.76434 WP_001213790.1.76445 WP_001213790.1.76451 WP_001213790.1.76471 WP_001213790.1.76495 WP_001213790.1.76529 WP_001213790.1.76532 WP_001213790.1.7655 WP_001213790.1.7657 WP_001213790.1.7660 WP_001213790.1.76611 WP_001213790.1.76673 WP_001213790.1.76706 WP_001213790.1.7672 WP_001213790.1.76721 WP_001213790.1.76756 WP_001213790.1.76760 WP_001213790.1.76776 WP_001213790.1.76799 WP_001213790.1.76806 WP_001213790.1.7684 WP_001213790.1.76866 WP_001213790.1.76875 WP_001213790.1.76880 WP_001213790.1.76899 WP_001213790.1.76913 WP_001213790.1.76968 WP_001213790.1.77017 WP_001213790.1.77033 WP_001213790.1.77038 WP_001213790.1.77047 WP_001213790.1.77067 WP_001213790.1.77080 WP_001213790.1.7712 WP_001213790.1.77177 WP_001213790.1.77180 WP_001213790.1.77184 WP_001213790.1.77241 WP_001213790.1.77244 WP_001213790.1.77267 WP_001213790.1.77271 WP_001213790.1.77292 WP_001213790.1.77306 WP_001213790.1.77313 WP_001213790.1.77349 WP_001213790.1.77356 WP_001213790.1.77475 WP_001213790.1.77496 WP_001213790.1.77514 WP_001213790.1.77529 WP_001213790.1.77543 WP_001213790.1.77549 WP_001213790.1.77555 WP_001213790.1.77575 WP_001213790.1.77596 WP_001213790.1.77646 WP_001213790.1.77653 WP_001213790.1.77692 WP_001213790.1.77710 WP_001213790.1.77761 WP_001213790.1.7782 WP_001213790.1.7784 WP_001213790.1.77851 WP_001213790.1.77871 WP_001213790.1.77898 WP_001213790.1.77918 WP_001213790.1.7792 WP_001213790.1.7793 WP_001213790.1.77951 WP_001213790.1.77960 WP_001213790.1.77983 WP_001213790.1.77989 WP_001213790.1.78 WP_001213790.1.78016 WP_001213790.1.7802 WP_001213790.1.78026 WP_001213790.1.78033 WP_001213790.1.78051 WP_001213790.1.78053 WP_001213790.1.78076 WP_001213790.1.78096 WP_001213790.1.78100 WP_001213790.1.78110 WP_001213790.1.78120 WP_001213790.1.7814 WP_001213790.1.78168 WP_001213790.1.78170 WP_001213790.1.78180 WP_001213790.1.78201 WP_001213790.1.78245 WP_001213790.1.78339 WP_001213790.1.78352 WP_001213790.1.78366 WP_001213790.1.78372 WP_001213790.1.78383 WP_001213790.1.78407 WP_001213790.1.78443 WP_001213790.1.78495 WP_001213790.1.78496 WP_001213790.1.78501 WP_001213790.1.78502 WP_001213790.1.78602 WP_001213790.1.78603 WP_001213790.1.7861 WP_001213790.1.78618 WP_001213790.1.78632 WP_001213790.1.78658 WP_001213790.1.78673 WP_001213790.1.78697 WP_001213790.1.78715 WP_001213790.1.78734 WP_001213790.1.78735 WP_001213790.1.7877 WP_001213790.1.78771 WP_001213790.1.78789 WP_001213790.1.78802 WP_001213790.1.78815 WP_001213790.1.78830 WP_001213790.1.78835 WP_001213790.1.78838 WP_001213790.1.78871 WP_001213790.1.78874 WP_001213790.1.78877 WP_001213790.1.78881 WP_001213790.1.78896 WP_001213790.1.78913 WP_001213790.1.78918 WP_001213790.1.78928 WP_001213790.1.7893 WP_001213790.1.78930 WP_001213790.1.78951 WP_001213790.1.78959 WP_001213790.1.79011 WP_001213790.1.79032 WP_001213790.1.79099 WP_001213790.1.79140 WP_001213790.1.79151 WP_001213790.1.79167 WP_001213790.1.79189 WP_001213790.1.79203 WP_001213790.1.79289 WP_001213790.1.79300 WP_001213790.1.79302 WP_001213790.1.79335 WP_001213790.1.79370 WP_001213790.1.794 WP_001213790.1.79427 WP_001213790.1.79462 WP_001213790.1.79466 WP_001213790.1.79468 WP_001213790.1.79472 WP_001213790.1.79490 WP_001213790.1.79495 WP_001213790.1.79529 WP_001213790.1.79531 WP_001213790.1.7956 WP_001213790.1.79570 WP_001213790.1.79580 WP_001213790.1.79586 WP_001213790.1.79635 WP_001213790.1.7964 WP_001213790.1.79645 WP_001213790.1.79659 WP_001213790.1.79668 WP_001213790.1.79708 WP_001213790.1.7972 WP_001213790.1.79734 WP_001213790.1.79738 WP_001213790.1.79757 WP_001213790.1.79778 WP_001213790.1.7982 WP_001213790.1.79845 WP_001213790.1.79867 WP_001213790.1.79892 WP_001213790.1.79929 WP_001213790.1.79934 WP_001213790.1.7994 WP_001213790.1.79942 WP_001213790.1.79951 WP_001213790.1.79966 WP_001213790.1.79974 WP_001213790.1.79977 WP_001213790.1.79996 WP_001213790.1.80045 WP_001213790.1.80077 WP_001213790.1.80137 WP_001213790.1.80149 WP_001213790.1.80182 WP_001213790.1.80229 WP_001213790.1.80236 WP_001213790.1.8024 WP_001213790.1.80249 WP_001213790.1.80250 WP_001213790.1.80254 WP_001213790.1.80296 WP_001213790.1.80307 WP_001213790.1.80333 WP_001213790.1.80363 WP_001213790.1.80366 WP_001213790.1.80380 WP_001213790.1.80441 WP_001213790.1.80443 WP_001213790.1.80473 WP_001213790.1.80496 WP_001213790.1.80529 WP_001213790.1.80542 WP_001213790.1.80586 WP_001213790.1.80609 WP_001213790.1.80629 WP_001213790.1.80667 WP_001213790.1.80674 WP_001213790.1.80707 WP_001213790.1.80723 WP_001213790.1.80741 WP_001213790.1.80750 WP_001213790.1.80757 WP_001213790.1.80760 WP_001213790.1.80780 WP_001213790.1.80803 WP_001213790.1.80827 WP_001213790.1.80831 WP_001213790.1.80840 WP_001213790.1.80850 WP_001213790.1.80857 WP_001213790.1.80868 WP_001213790.1.80874 WP_001213790.1.80876 WP_001213790.1.80881 WP_001213790.1.80913 WP_001213790.1.80939 WP_001213790.1.8096 WP_001213790.1.80973 WP_001213790.1.81037 WP_001213790.1.81041 WP_001213790.1.8106 WP_001213790.1.81062 WP_001213790.1.81069 WP_001213790.1.81084 WP_001213790.1.81109 WP_001213790.1.81110 WP_001213790.1.81118 WP_001213790.1.81149 WP_001213790.1.81175 WP_001213790.1.8119 WP_001213790.1.81193 WP_001213790.1.81197 WP_001213790.1.81225 WP_001213790.1.8127 WP_001213790.1.81275 WP_001213790.1.8130 WP_001213790.1.81302 WP_001213790.1.81305 WP_001213790.1.81320 WP_001213790.1.81321 WP_001213790.1.81328 WP_001213790.1.8134 WP_001213790.1.81354 WP_001213790.1.81388 WP_001213790.1.81404 WP_001213790.1.81410 WP_001213790.1.81425 WP_001213790.1.81455 WP_001213790.1.81528 WP_001213790.1.81568 WP_001213790.1.81667 WP_001213790.1.81668 WP_001213790.1.81727 WP_001213790.1.81735 WP_001213790.1.81736 WP_001213790.1.81743 WP_001213790.1.81750 WP_001213790.1.81760 WP_001213790.1.81768 WP_001213790.1.81785 WP_001213790.1.81795 WP_001213790.1.81798 WP_001213790.1.81902 WP_001213790.1.81941 WP_001213790.1.81965 WP_001213790.1.81974 WP_001213790.1.81977 WP_001213790.1.82037 WP_001213790.1.82141 WP_001213790.1.82149 WP_001213790.1.82192 WP_001213790.1.82232 WP_001213790.1.82337 WP_001213790.1.82347 WP_001213790.1.82352 WP_001213790.1.82395 WP_001213790.1.82401 WP_001213790.1.82420 WP_001213790.1.82434 WP_001213790.1.82464 WP_001213790.1.8247 WP_001213790.1.82474 WP_001213790.1.82479 WP_001213790.1.82503 WP_001213790.1.82515 WP_001213790.1.82530 WP_001213790.1.82562 WP_001213790.1.82569 WP_001213790.1.82570 WP_001213790.1.82637 WP_001213790.1.82648 WP_001213790.1.82676 WP_001213790.1.82692 WP_001213790.1.82761 WP_001213790.1.82763 WP_001213790.1.8282 WP_001213790.1.82841 WP_001213790.1.82843 WP_001213790.1.82867 WP_001213790.1.82895 WP_001213790.1.82899 WP_001213790.1.82908 WP_001213790.1.82937 WP_001213790.1.82944 WP_001213790.1.82956 WP_001213790.1.82964 WP_001213790.1.82992 WP_001213790.1.83005 WP_001213790.1.83006 WP_001213790.1.83061 WP_001213790.1.83092 WP_001213790.1.83119 WP_001213790.1.83128 WP_001213790.1.83139 WP_001213790.1.83163 WP_001213790.1.83204 WP_001213790.1.83247 WP_001213790.1.83258 WP_001213790.1.83280 WP_001213790.1.83301 WP_001213790.1.83305 WP_001213790.1.83331 WP_001213790.1.83354 WP_001213790.1.83356 WP_001213790.1.83360 WP_001213790.1.83365 WP_001213790.1.83388 WP_001213790.1.83407 WP_001213790.1.83413 WP_001213790.1.83491 WP_001213790.1.83523 WP_001213790.1.8354 WP_001213790.1.83558 WP_001213790.1.83572 WP_001213790.1.83598 WP_001213790.1.83650 WP_001213790.1.83651 WP_001213790.1.83710 WP_001213790.1.83721 WP_001213790.1.83739 WP_001213790.1.83760 WP_001213790.1.83806 WP_001213790.1.83854 WP_001213790.1.83897 WP_001213790.1.83960 WP_001213790.1.83979 WP_001213790.1.8399 WP_001213790.1.83995 WP_001213790.1.84000 WP_001213790.1.84001 WP_001213790.1.84011 WP_001213790.1.84031 WP_001213790.1.84075 WP_001213790.1.84083 WP_001213790.1.84086 WP_001213790.1.84100 WP_001213790.1.84103 WP_001213790.1.84106 WP_001213790.1.84115 WP_001213790.1.84154 WP_001213790.1.84179 WP_001213790.1.84198 WP_001213790.1.84205 WP_001213790.1.84209 WP_001213790.1.84229 WP_001213790.1.8425 WP_001213790.1.84283 WP_001213790.1.84291 WP_001213790.1.84300 WP_001213790.1.84325 WP_001213790.1.84355 WP_001213790.1.84359 WP_001213790.1.84373 WP_001213790.1.84392 WP_001213790.1.84397 WP_001213790.1.84403 WP_001213790.1.8441 WP_001213790.1.84459 WP_001213790.1.84497 WP_001213790.1.84515 WP_001213790.1.84523 WP_001213790.1.84532 WP_001213790.1.84551 WP_001213790.1.84554 WP_001213790.1.84572 WP_001213790.1.84598 WP_001213790.1.84644 WP_001213790.1.84659 WP_001213790.1.84683 WP_001213790.1.84693 WP_001213790.1.84711 WP_001213790.1.84721 WP_001213790.1.84745 WP_001213790.1.84814 WP_001213790.1.84872 WP_001213790.1.84876 WP_001213790.1.84879 WP_001213790.1.84899 WP_001213790.1.8497 WP_001213790.1.84983 WP_001213790.1.850 WP_001213790.1.85014 WP_001213790.1.85031 WP_001213790.1.85040 WP_001213790.1.85079 WP_001213790.1.85120 WP_001213790.1.85134 WP_001213790.1.85147 WP_001213790.1.85180 WP_001213790.1.85190 WP_001213790.1.85192 WP_001213790.1.85217 WP_001213790.1.8526 WP_001213790.1.85271 WP_001213790.1.85301 WP_001213790.1.8533 WP_001213790.1.8537 WP_001213790.1.85408 WP_001213790.1.8545 WP_001213790.1.85456 WP_001213790.1.85481 WP_001213790.1.85483 WP_001213790.1.8552 WP_001213790.1.85541 WP_001213790.1.8556 WP_001213790.1.85568 WP_001213790.1.85615 WP_001213790.1.85617 WP_001213790.1.85663 WP_001213790.1.85671 WP_001213790.1.85672 WP_001213790.1.85723 WP_001213790.1.85759 WP_001213790.1.85777 WP_001213790.1.85780 WP_001213790.1.85784 WP_001213790.1.85797 WP_001213790.1.85854 WP_001213790.1.85855 WP_001213790.1.85864 WP_001213790.1.85886 WP_001213790.1.85900 WP_001213790.1.85904 WP_001213790.1.8591 WP_001213790.1.85943 WP_001213790.1.85976 WP_001213790.1.85982 WP_001213790.1.86010 WP_001213790.1.86017 WP_001213790.1.86043 WP_001213790.1.86092 WP_001213790.1.86120 WP_001213790.1.86138 WP_001213790.1.86157 WP_001213790.1.86159 WP_001213790.1.8616 WP_001213790.1.86173 WP_001213790.1.86206 WP_001213790.1.86224 WP_001213790.1.86240 WP_001213790.1.86259 WP_001213790.1.86284 WP_001213790.1.86306 WP_001213790.1.86335 WP_001213790.1.86347 WP_001213790.1.86356 WP_001213790.1.86380 WP_001213790.1.86442 WP_001213790.1.86450 WP_001213790.1.86453 WP_001213790.1.86466 WP_001213790.1.86469 WP_001213790.1.8647 WP_001213790.1.86514 WP_001213790.1.86580 WP_001213790.1.86588 WP_001213790.1.86593 WP_001213790.1.86601 WP_001213790.1.86610 WP_001213790.1.86634 WP_001213790.1.86656 WP_001213790.1.86658 WP_001213790.1.86661 WP_001213790.1.86676 WP_001213790.1.8671 WP_001213790.1.8672 WP_001213790.1.8678 WP_001213790.1.86810 WP_001213790.1.8684 WP_001213790.1.86859 WP_001213790.1.86895 WP_001213790.1.86906 WP_001213790.1.8691 WP_001213790.1.86915 WP_001213790.1.86921 WP_001213790.1.86982 WP_001213790.1.87038 WP_001213790.1.87095 WP_001213790.1.87143 WP_001213790.1.87148 WP_001213790.1.87187 WP_001213790.1.87219 WP_001213790.1.8722 WP_001213790.1.87220 WP_001213790.1.87265 WP_001213790.1.87276 WP_001213790.1.87282 WP_001213790.1.87283 WP_001213790.1.8736 WP_001213790.1.87365 WP_001213790.1.87376 WP_001213790.1.87460 WP_001213790.1.87484 WP_001213790.1.87493 WP_001213790.1.87500 WP_001213790.1.87552 WP_001213790.1.87583 WP_001213790.1.87618 WP_001213790.1.87651 WP_001213790.1.87687 WP_001213790.1.87695 WP_001213790.1.87712 WP_001213790.1.87760 WP_001213790.1.87779 WP_001213790.1.87813 WP_001213790.1.87875 WP_001213790.1.87891 WP_001213790.1.87899 WP_001213790.1.87905 WP_001213790.1.8792 WP_001213790.1.87933 WP_001213790.1.87936 WP_001213790.1.87945 WP_001213790.1.87999 WP_001213790.1.8800 WP_001213790.1.88014 WP_001213790.1.88019 WP_001213790.1.88052 WP_001213790.1.88073 WP_001213790.1.8809 WP_001213790.1.88136 WP_001213790.1.88165 WP_001213790.1.88185 WP_001213790.1.88214 WP_001213790.1.88244 WP_001213790.1.88275 WP_001213790.1.88291 WP_001213790.1.88293 WP_001213790.1.88303 WP_001213790.1.88356 WP_001213790.1.8837 WP_001213790.1.88393 WP_001213790.1.88474 WP_001213790.1.88483 WP_001213790.1.8849 WP_001213790.1.88508 WP_001213790.1.88597 WP_001213790.1.88609 WP_001213790.1.88624 WP_001213790.1.88651 WP_001213790.1.88675 WP_001213790.1.88683 WP_001213790.1.88703 WP_001213790.1.88731 WP_001213790.1.88762 WP_001213790.1.88776 WP_001213790.1.88792 WP_001213790.1.88817 WP_001213790.1.88845 WP_001213790.1.88854 WP_001213790.1.88902 WP_001213790.1.8891 WP_001213790.1.88942 WP_001213790.1.88957 WP_001213790.1.88966 WP_001213790.1.88968 WP_001213790.1.88970 WP_001213790.1.88980 WP_001213790.1.88982 WP_001213790.1.88998 WP_001213790.1.89008 WP_001213790.1.89114 WP_001213790.1.89116 WP_001213790.1.89119 WP_001213790.1.89120 WP_001213790.1.89138 WP_001213790.1.89177 WP_001213790.1.89221 WP_001213790.1.89291 WP_001213790.1.89304 WP_001213790.1.89311 WP_001213790.1.89354 WP_001213790.1.89355 WP_001213790.1.89362 WP_001213790.1.89408 WP_001213790.1.89425 WP_001213790.1.89452 WP_001213790.1.89462 WP_001213790.1.89512 WP_001213790.1.89527 WP_001213790.1.89570 WP_001213790.1.89580 WP_001213790.1.89604 WP_001213790.1.89606 WP_001213790.1.8961 WP_001213790.1.89622 WP_001213790.1.89634 WP_001213790.1.89657 WP_001213790.1.89659 WP_001213790.1.89680 WP_001213790.1.89746 WP_001213790.1.89764 WP_001213790.1.89765 WP_001213790.1.89789 WP_001213790.1.89815 WP_001213790.1.89817 WP_001213790.1.89832 WP_001213790.1.89870 WP_001213790.1.89902 WP_001213790.1.89914 WP_001213790.1.89940 WP_001213790.1.8996 WP_001213790.1.89965 WP_001213790.1.89975 WP_001213790.1.9003 WP_001213790.1.90084 WP_001213790.1.90097 WP_001213790.1.90193 WP_001213790.1.90211 WP_001213790.1.90252 WP_001213790.1.90293 WP_001213790.1.90302 WP_001213790.1.90409 WP_001213790.1.90417 WP_001213790.1.90421 WP_001213790.1.90453 WP_001213790.1.90458 WP_001213790.1.90521 WP_001213790.1.90522 WP_001213790.1.90540 WP_001213790.1.90557 WP_001213790.1.90563 WP_001213790.1.90566 WP_001213790.1.90585 WP_001213790.1.90617 WP_001213790.1.90620 WP_001213790.1.90641 WP_001213790.1.90686 WP_001213790.1.90734 WP_001213790.1.90748 WP_001213790.1.90752 WP_001213790.1.90759 WP_001213790.1.90814 WP_001213790.1.90859 WP_001213790.1.90878 WP_001213790.1.9089 WP_001213790.1.9093 WP_001213790.1.90959 WP_001213790.1.90973 WP_001213790.1.90984 WP_001213790.1.90991 WP_001213790.1.91003 WP_001213790.1.91023 WP_001213790.1.91042 WP_001213790.1.91049 WP_001213790.1.91056 WP_001213790.1.91069 WP_001213790.1.91107 WP_001213790.1.91156 WP_001213790.1.91179 WP_001213790.1.91189 WP_001213790.1.91215 WP_001213790.1.91278 WP_001213790.1.91282 WP_001213790.1.9131 WP_001213790.1.91312 WP_001213790.1.91331 WP_001213790.1.91334 WP_001213790.1.9137 WP_001213790.1.91372 WP_001213790.1.91381 WP_001213790.1.91405 WP_001213790.1.91424 WP_001213790.1.91470 WP_001213790.1.91473 WP_001213790.1.91474 WP_001213790.1.91505 WP_001213790.1.91512 WP_001213790.1.91524 WP_001213790.1.91528 WP_001213790.1.91564 WP_001213790.1.91580 WP_001213790.1.91621 WP_001213790.1.91628 WP_001213790.1.91655 WP_001213790.1.9166 WP_001213790.1.91702 WP_001213790.1.91724 WP_001213790.1.91732 WP_001213790.1.91736 WP_001213790.1.91742 WP_001213790.1.91772 WP_001213790.1.91776 WP_001213790.1.91788 WP_001213790.1.91795 WP_001213790.1.91806 WP_001213790.1.91864 WP_001213790.1.91880 WP_001213790.1.91898 WP_001213790.1.91903 WP_001213790.1.91904 WP_001213790.1.91974 WP_001213790.1.91984 WP_001213790.1.92013 WP_001213790.1.92039 WP_001213790.1.92044 WP_001213790.1.92047 WP_001213790.1.92060 WP_001213790.1.92067 WP_001213790.1.92068 WP_001213790.1.92082 WP_001213790.1.92093 WP_001213790.1.92099 WP_001213790.1.92108 WP_001213790.1.92122 WP_001213790.1.92129 WP_001213790.1.92149 WP_001213790.1.92165 WP_001213790.1.92171 WP_001213790.1.92183 WP_001213790.1.92208 WP_001213790.1.9222 WP_001213790.1.92268 WP_001213790.1.92270 WP_001213790.1.92310 WP_001213790.1.92318 WP_001213790.1.92375 WP_001213790.1.92394 WP_001213790.1.92399 WP_001213790.1.92408 WP_001213790.1.92439 WP_001213790.1.92443 WP_001213790.1.92452 WP_001213790.1.92482 WP_001213790.1.92529 WP_001213790.1.92531 WP_001213790.1.92557 WP_001213790.1.92562 WP_001213790.1.92628 WP_001213790.1.92646 WP_001213790.1.92669 WP_001213790.1.92671 WP_001213790.1.92729 WP_001213790.1.92738 WP_001213790.1.92754 WP_001213790.1.92758 WP_001213790.1.9276 WP_001213790.1.92786 WP_001213790.1.92806 WP_001213790.1.92827 WP_001213790.1.92832 WP_001213790.1.92836 WP_001213790.1.92842 WP_001213790.1.92843 WP_001213790.1.92875 WP_001213790.1.92883 WP_001213790.1.92890 WP_001213790.1.92893 WP_001213790.1.92895 WP_001213790.1.92929 WP_001213790.1.92936 WP_001213790.1.92939 WP_001213790.1.92947 WP_001213790.1.92975 WP_001213790.1.92988 WP_001213790.1.93059 WP_001213790.1.93061 WP_001213790.1.93076 WP_001213790.1.93086 WP_001213790.1.93101 WP_001213790.1.93118 WP_001213790.1.93136 WP_001213790.1.93155 WP_001213790.1.93215 WP_001213790.1.93275 WP_001213790.1.93322 WP_001213790.1.93339 WP_001213790.1.93350 WP_001213790.1.93365 WP_001213790.1.93376 WP_001213790.1.93410 WP_001213790.1.93524 WP_001213790.1.93543 WP_001213790.1.93577 WP_001213790.1.93596 WP_001213790.1.93648 WP_001213790.1.93650 WP_001213790.1.93656 WP_001213790.1.93662 WP_001213790.1.93671 WP_001213790.1.937 WP_001213790.1.93705 WP_001213790.1.93767 WP_001213790.1.9380 WP_001213790.1.93803 WP_001213790.1.93804 WP_001213790.1.93809 WP_001213790.1.9389 WP_001213790.1.93937 WP_001213790.1.93956 WP_001213790.1.93986 WP_001213790.1.93994 WP_001213790.1.94056 WP_001213790.1.94071 WP_001213790.1.94072 WP_001213790.1.94132 WP_001213790.1.94162 WP_001213790.1.94168 WP_001213790.1.94181 WP_001213790.1.94198 WP_001213790.1.9432 WP_001213790.1.94352 WP_001213790.1.94354 WP_001213790.1.94379 WP_001213790.1.94380 WP_001213790.1.9440 WP_001213790.1.94412 WP_001213790.1.94458 WP_001213790.1.94473 WP_001213790.1.94557 WP_001213790.1.94562 WP_001213790.1.94565 WP_001213790.1.94584 WP_001213790.1.94598 WP_001213790.1.94622 WP_001213790.1.9463 WP_001213790.1.94649 WP_001213790.1.94655 WP_001213790.1.94669 WP_001213790.1.94670 WP_001213790.1.94674 WP_001213790.1.94717 WP_001213790.1.94785 WP_001213790.1.94796 WP_001213790.1.9481 WP_001213790.1.94835 WP_001213790.1.94849 WP_001213790.1.94862 WP_001213790.1.94959 WP_001213790.1.94967 WP_001213790.1.94971 WP_001213790.1.94983 WP_001213790.1.94986 WP_001213790.1.94987 WP_001213790.1.9503 WP_001213790.1.95051 WP_001213790.1.95085 WP_001213790.1.95121 WP_001213790.1.95133 WP_001213790.1.95136 WP_001213790.1.9516 WP_001213790.1.95235 WP_001213790.1.95248 WP_001213790.1.9527 WP_001213790.1.95277 WP_001213790.1.95282 WP_001213790.1.95289 WP_001213790.1.95298 WP_001213790.1.95320 WP_001213790.1.95388 WP_001213790.1.95434 WP_001213790.1.95447 WP_001213790.1.95456 WP_001213790.1.95465 WP_001213790.1.95546 WP_001213790.1.95558 WP_001213790.1.95623 WP_001213790.1.95630 WP_001213790.1.95641 WP_001213790.1.95656 WP_001213790.1.95670 WP_001213790.1.95691 WP_001213790.1.95703 WP_001213790.1.95729 WP_001213790.1.9574 WP_001213790.1.95744 WP_001213790.1.95757 WP_001213790.1.95840 WP_001213790.1.9586 WP_001213790.1.95866 WP_001213790.1.95901 WP_001213790.1.95911 WP_001213790.1.95939 WP_001213790.1.95940 WP_001213790.1.95963 WP_001213790.1.96004 WP_001213790.1.96042 WP_001213790.1.96045 WP_001213790.1.9609 WP_001213790.1.96107 WP_001213790.1.96139 WP_001213790.1.96162 WP_001213790.1.96172 WP_001213790.1.96190 WP_001213790.1.9624 WP_001213790.1.96260 WP_001213790.1.9627 WP_001213790.1.96335 WP_001213790.1.96340 WP_001213790.1.96343 WP_001213790.1.96348 WP_001213790.1.96349 WP_001213790.1.96380 WP_001213790.1.96404 WP_001213790.1.9644 WP_001213790.1.96469 WP_001213790.1.96490 WP_001213790.1.96497 WP_001213790.1.96500 WP_001213790.1.96521 WP_001213790.1.96533 WP_001213790.1.96537 WP_001213790.1.96555 WP_001213790.1.96563 WP_001213790.1.96584 WP_001213790.1.96588 WP_001213790.1.96590 WP_001213790.1.96600 WP_001213790.1.96642 WP_001213790.1.96662 WP_001213790.1.96721 WP_001213790.1.96731 WP_001213790.1.96732 WP_001213790.1.96735 WP_001213790.1.9674 WP_001213790.1.96758 WP_001213790.1.96761 WP_001213790.1.96771 WP_001213790.1.96798 WP_001213790.1.9686 WP_001213790.1.96876 WP_001213790.1.96917 WP_001213790.1.96993 WP_001213790.1.97005 WP_001213790.1.97015 WP_001213790.1.97043 WP_001213790.1.97047 WP_001213790.1.97103 WP_001213790.1.97109 WP_001213790.1.97143 WP_001213790.1.97145 WP_001213790.1.97190 WP_001213790.1.97224 WP_001213790.1.97297 WP_001213790.1.97318 WP_001213790.1.97322 WP_001213790.1.97328 WP_001213790.1.97337 WP_001213790.1.97368 WP_001213790.1.97369 WP_001213790.1.97477 WP_001213790.1.97487 WP_001213790.1.97496 WP_001213790.1.97534 WP_001213790.1.97547 WP_001213790.1.97594 WP_001213790.1.97597 WP_001213790.1.97613 WP_001213790.1.97620 WP_001213790.1.97626 WP_001213790.1.97631 WP_001213790.1.97640 WP_001213790.1.97648 WP_001213790.1.97656 WP_001213790.1.97691 WP_001213790.1.97704 WP_001213790.1.97726 WP_001213790.1.97727 WP_001213790.1.97732 WP_001213790.1.97736 WP_001213790.1.9774 WP_001213790.1.9775 WP_001213790.1.97772 WP_001213790.1.97846 WP_001213790.1.9793 WP_001213790.1.97981 WP_001213790.1.97983 WP_001213790.1.9799 WP_001213790.1.97991 WP_001213790.1.98006 WP_001213790.1.98019 WP_001213790.1.98022 WP_001213790.1.9805 WP_001213790.1.9811 WP_001213790.1.98110 WP_001213790.1.98119 WP_001213790.1.98124 WP_001213790.1.98146 WP_001213790.1.98170 WP_001213790.1.98201 WP_001213790.1.98219 WP_001213790.1.98250 WP_001213790.1.9826 WP_001213790.1.98266 WP_001213790.1.98338 WP_001213790.1.98392 WP_001213790.1.98402 WP_001213790.1.98403 WP_001213790.1.9841 WP_001213790.1.98438 WP_001213790.1.98440 WP_001213790.1.98472 WP_001213790.1.98483 WP_001213790.1.98495 WP_001213790.1.98513 WP_001213790.1.98531 WP_001213790.1.98551 WP_001213790.1.98558 WP_001213790.1.98570 WP_001213790.1.98577 WP_001213790.1.98608 WP_001213790.1.9863 WP_001213790.1.98634 WP_001213790.1.98676 WP_001213790.1.98677 WP_001213790.1.98726 WP_001213790.1.98760 WP_001213790.1.98763 WP_001213790.1.98779 WP_001213790.1.98843 WP_001213790.1.9887 WP_001213790.1.98899 WP_001213790.1.98931 WP_001213790.1.98947 WP_001213790.1.9898 WP_001213790.1.9899 WP_001213790.1.99040 WP_001213790.1.99057 WP_001213790.1.99071 WP_001213790.1.99072 WP_001213790.1.99073 WP_001213790.1.99083 WP_001213790.1.99097 WP_001213790.1.99098 WP_001213790.1.99107 WP_001213790.1.99164 WP_001213790.1.99184 WP_001213790.1.9919 WP_001213790.1.99215 WP_001213790.1.99267 WP_001213790.1.99276 WP_001213790.1.99278 WP_001213790.1.99370 WP_001213790.1.99426 WP_001213790.1.99456 WP_001213790.1.99490 WP_001213790.1.99493 WP_001213790.1.99531 WP_001213790.1.9954 WP_001213790.1.99561 WP_001213790.1.99577 WP_001213790.1.99613 WP_001213790.1.99626 WP_001213790.1.99630 WP_001213790.1.99637 WP_001213790.1.99646 WP_001213790.1.99657 WP_001213790.1.99660 WP_001213790.1.99712 WP_001213790.1.99747 WP_001213790.1.99813 WP_001213790.1.99824 WP_001213790.1.99858 WP_001213790.1.99889 WP_001213790.1.99924 WP_001213790.1.99958 WP_001213790.1.99961 gi|16766994|ref|NP_462609.1| gi|378986306|ref|YP_005249462.1| gi|482906273|ref|YP_007904833.1| gi|161616787|ref|YP_001590752.1| gi|550903052|ref|YP_008672144.1| 272994.SPAB_04606 295319.SPA3561 321314.SC3632 41514.SARI_03932 423368.SNSL254_A3989 439843.SeSA_A3908 439851.SeD_A4095 454166.SeAg_B3927 454169.SeHA_C4034 476213.SPC_3791 550537.SEN3531 554290.SSPA3324 99287.STM3709 gi|56415599|ref|YP_152674.1| gi|452122497|ref|YP_007472745.1| gi|378991011|ref|YP_005254175.1| gi|383498344|ref|YP_005399033.1| ABAM02000001|CDS_4277590-4276394 ABAN01000001|CDS_158229-159425 ABAO01000037|CDS_27320-26124 ABEH02000004|CDS_191713-192909 ABEJ01000002|CDS_283272-282076 ABEL01000003|CDS_301513-300317 ABEW01000004|CDS_184951-186147 AE006468|CDS_3905113-3903917 AE017220|CDS_3847414-3846218 AM933172|CDS_3786214-3785018 CP000026|CDS_3693059-3691863 CP000857|CDS_3842269-3841073 CP000880|CDS_3863864-3865060 CP000886|CDS_3854061-3852865 CP001113|CDS_3877551-3876355 CP001120|CDS_3918123-3916927 CP001127|CDS_3780468-3779272 CP001138|CDS_3824483-3823287 CP001144|CDS_3944812-3943616 CP001363|CDS_3918805-3917609 FM200053|CDS_3688736-3687540 FN424405|CDS_3927990-3926794 NZ_ACBF01000002|CDS_118693-119889 gi|525840204|ref|YP_008257677.1| gi|528816887|ref|YP_008358090.1| gi|526218397|ref|YP_008263548.1| gi|161505756|ref|YP_001572868.1| gi|386593382|ref|YP_006089782.1| gi|194734301|ref|YP_002116644.1| gi|207858946|ref|YP_002245597.1| gi|549726262|ref|YP_008646452.1| gi|194444407|ref|YP_002042959.1| gi|197364526|ref|YP_002144163.1| gi|62182202|ref|YP_218619.1| gi|525945670|ref|YP_008306634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]