SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482906487|ref|YP_007905047.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482906487|ref|YP_007905047.1|
Domain Number 1 Region: 2-375
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.99e-102
Family GABA-aminotransferase-like 0.0000453
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|482906487|ref|YP_007905047.1|
Sequence length 376
Comment TDP-4-oxo-6-deoxy-D-glucose transaminase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MIPFNAPPVVGTELEYMQSAMSSGKLCGDGGFTRRCQQWLEQHFGSAKVLLTPSCTASLE
MAALLLDIQPGDEVIMPSFTFVSTANAFVLRGAKIVFVDIRPDTMNIDETLIEAAITDKT
RAIVPVHYAGVACEMDVIMALADKYNLFVVEDAAQGVMSTYKGRALGTIGHIGCFSFHET
KNYTAGGEGGATLINDRTLIERAEIIREKGTNRSQFFRGQVDKYTWRDIGSSYLMSDLQA
AYLWAQLEAADRINQQRLSLWQTYYDALTPLARAGRFELPSIPENCGHNAHMFYIKLRDI
ADRSALINFLKEAEIMAVFHYIPLHDCPAGDKFGEFIGDDVYTTKESERLLRLPLFYNLA
PVDQRTVITTLLNYFS
Download sequence
Identical sequences A0A0D6IN70 A0A0F6B989 A0A0F7JC57 A0A0H3NHW2 A0A0U1G427 A0A0W4AWC8 A0A249V4R2 A0A2D3AIP8 A0A2H9YD92 E8XIN5 Q9L6R0
gi|525840035|ref|YP_008257468.1| gi|16767200|ref|NP_462815.1| 99287.STM3925 gi|378447274|ref|YP_005234906.1| gi|378991218|ref|YP_005254382.1| gi|383498541|ref|YP_005399230.1| gi|378701796|ref|YP_005183754.1| gi|378986619|ref|YP_005249775.1| ABAM02000001|CDS_4501667-4502797 ABAO01000043|CDS_28345-29475 AE006468|CDS_4133663-4134793 CP001363|CDS_4147354-4148484 FN424405|CDS_4156537-4157667 gi|482906487|ref|YP_007905047.1| gi|378452827|ref|YP_005240187.1| gi|549726460|ref|YP_008646650.1| NP_462815.1.58477 WP_000612078.1.100010 WP_000612078.1.100234 WP_000612078.1.100258 WP_000612078.1.100376 WP_000612078.1.100424 WP_000612078.1.100436 WP_000612078.1.100484 WP_000612078.1.100488 WP_000612078.1.100597 WP_000612078.1.10076 WP_000612078.1.100781 WP_000612078.1.100793 WP_000612078.1.100869 WP_000612078.1.100871 WP_000612078.1.100882 WP_000612078.1.101007 WP_000612078.1.101020 WP_000612078.1.101074 WP_000612078.1.101078 WP_000612078.1.101180 WP_000612078.1.101259 WP_000612078.1.101284 WP_000612078.1.101291 WP_000612078.1.101353 WP_000612078.1.101386 WP_000612078.1.101404 WP_000612078.1.101420 WP_000612078.1.101589 WP_000612078.1.101707 WP_000612078.1.101734 WP_000612078.1.101878 WP_000612078.1.10220 WP_000612078.1.10266 WP_000612078.1.10439 WP_000612078.1.10678 WP_000612078.1.10753 WP_000612078.1.10992 WP_000612078.1.11000 WP_000612078.1.11024 WP_000612078.1.11031 WP_000612078.1.11098 WP_000612078.1.11168 WP_000612078.1.11190 WP_000612078.1.11295 WP_000612078.1.11455 WP_000612078.1.11458 WP_000612078.1.11518 WP_000612078.1.11532 WP_000612078.1.11543 WP_000612078.1.11763 WP_000612078.1.11772 WP_000612078.1.11897 WP_000612078.1.12025 WP_000612078.1.12114 WP_000612078.1.12351 WP_000612078.1.12370 WP_000612078.1.12546 WP_000612078.1.1264 WP_000612078.1.12728 WP_000612078.1.12879 WP_000612078.1.12936 WP_000612078.1.12995 WP_000612078.1.13027 WP_000612078.1.13106 WP_000612078.1.13130 WP_000612078.1.13334 WP_000612078.1.13414 WP_000612078.1.13488 WP_000612078.1.13509 WP_000612078.1.13669 WP_000612078.1.13741 WP_000612078.1.1387 WP_000612078.1.13908 WP_000612078.1.13932 WP_000612078.1.13968 WP_000612078.1.14001 WP_000612078.1.14151 WP_000612078.1.14320 WP_000612078.1.14379 WP_000612078.1.14406 WP_000612078.1.14410 WP_000612078.1.14466 WP_000612078.1.14524 WP_000612078.1.14554 WP_000612078.1.14725 WP_000612078.1.14852 WP_000612078.1.1489 WP_000612078.1.14932 WP_000612078.1.15055 WP_000612078.1.15079 WP_000612078.1.15124 WP_000612078.1.15223 WP_000612078.1.15226 WP_000612078.1.15316 WP_000612078.1.15369 WP_000612078.1.1540 WP_000612078.1.15508 WP_000612078.1.15784 WP_000612078.1.15830 WP_000612078.1.15909 WP_000612078.1.16062 WP_000612078.1.16063 WP_000612078.1.16103 WP_000612078.1.16226 WP_000612078.1.16233 WP_000612078.1.16284 WP_000612078.1.16328 WP_000612078.1.1635 WP_000612078.1.16468 WP_000612078.1.16614 WP_000612078.1.16650 WP_000612078.1.16686 WP_000612078.1.16691 WP_000612078.1.167 WP_000612078.1.16732 WP_000612078.1.16735 WP_000612078.1.16786 WP_000612078.1.16858 WP_000612078.1.16896 WP_000612078.1.16916 WP_000612078.1.16965 WP_000612078.1.1700 WP_000612078.1.17307 WP_000612078.1.174 WP_000612078.1.17480 WP_000612078.1.17546 WP_000612078.1.17702 WP_000612078.1.17705 WP_000612078.1.17747 WP_000612078.1.18019 WP_000612078.1.18111 WP_000612078.1.18163 WP_000612078.1.18265 WP_000612078.1.18267 WP_000612078.1.18468 WP_000612078.1.18607 WP_000612078.1.18705 WP_000612078.1.18715 WP_000612078.1.18776 WP_000612078.1.18822 WP_000612078.1.18881 WP_000612078.1.18940 WP_000612078.1.18949 WP_000612078.1.19053 WP_000612078.1.19320 WP_000612078.1.19458 WP_000612078.1.19460 WP_000612078.1.19461 WP_000612078.1.19614 WP_000612078.1.19642 WP_000612078.1.19702 WP_000612078.1.19706 WP_000612078.1.19724 WP_000612078.1.19784 WP_000612078.1.19802 WP_000612078.1.19809 WP_000612078.1.19867 WP_000612078.1.1998 WP_000612078.1.20 WP_000612078.1.2010 WP_000612078.1.20212 WP_000612078.1.20266 WP_000612078.1.20271 WP_000612078.1.20330 WP_000612078.1.20362 WP_000612078.1.20418 WP_000612078.1.20443 WP_000612078.1.20525 WP_000612078.1.2054 WP_000612078.1.20553 WP_000612078.1.20626 WP_000612078.1.20646 WP_000612078.1.20886 WP_000612078.1.20908 WP_000612078.1.21049 WP_000612078.1.21146 WP_000612078.1.21245 WP_000612078.1.21246 WP_000612078.1.21269 WP_000612078.1.21400 WP_000612078.1.21497 WP_000612078.1.21499 WP_000612078.1.21548 WP_000612078.1.21603 WP_000612078.1.21751 WP_000612078.1.21757 WP_000612078.1.22024 WP_000612078.1.2205 WP_000612078.1.22062 WP_000612078.1.22067 WP_000612078.1.2221 WP_000612078.1.2235 WP_000612078.1.22379 WP_000612078.1.22427 WP_000612078.1.2246 WP_000612078.1.22485 WP_000612078.1.22537 WP_000612078.1.22620 WP_000612078.1.22870 WP_000612078.1.22979 WP_000612078.1.23102 WP_000612078.1.23114 WP_000612078.1.2314 WP_000612078.1.23192 WP_000612078.1.23259 WP_000612078.1.23460 WP_000612078.1.23472 WP_000612078.1.23482 WP_000612078.1.23634 WP_000612078.1.2364 WP_000612078.1.23932 WP_000612078.1.24017 WP_000612078.1.24206 WP_000612078.1.24308 WP_000612078.1.24578 WP_000612078.1.24737 WP_000612078.1.24779 WP_000612078.1.25008 WP_000612078.1.25015 WP_000612078.1.25206 WP_000612078.1.25405 WP_000612078.1.25454 WP_000612078.1.25493 WP_000612078.1.25668 WP_000612078.1.25690 WP_000612078.1.2570 WP_000612078.1.25740 WP_000612078.1.25793 WP_000612078.1.25814 WP_000612078.1.25988 WP_000612078.1.26282 WP_000612078.1.26311 WP_000612078.1.26319 WP_000612078.1.26429 WP_000612078.1.26440 WP_000612078.1.26493 WP_000612078.1.26551 WP_000612078.1.26567 WP_000612078.1.27010 WP_000612078.1.27173 WP_000612078.1.27206 WP_000612078.1.27423 WP_000612078.1.27561 WP_000612078.1.2763 WP_000612078.1.27665 WP_000612078.1.27707 WP_000612078.1.27761 WP_000612078.1.2777 WP_000612078.1.27857 WP_000612078.1.27977 WP_000612078.1.28094 WP_000612078.1.28126 WP_000612078.1.28170 WP_000612078.1.28302 WP_000612078.1.2835 WP_000612078.1.28370 WP_000612078.1.28538 WP_000612078.1.28575 WP_000612078.1.28625 WP_000612078.1.28655 WP_000612078.1.28694 WP_000612078.1.2879 WP_000612078.1.2890 WP_000612078.1.28938 WP_000612078.1.28946 WP_000612078.1.29006 WP_000612078.1.29010 WP_000612078.1.2910 WP_000612078.1.29588 WP_000612078.1.29601 WP_000612078.1.29606 WP_000612078.1.29615 WP_000612078.1.29619 WP_000612078.1.29704 WP_000612078.1.29969 WP_000612078.1.30006 WP_000612078.1.30027 WP_000612078.1.30180 WP_000612078.1.30469 WP_000612078.1.30505 WP_000612078.1.30507 WP_000612078.1.30535 WP_000612078.1.30547 WP_000612078.1.30794 WP_000612078.1.30833 WP_000612078.1.30835 WP_000612078.1.30972 WP_000612078.1.31 WP_000612078.1.3113 WP_000612078.1.31185 WP_000612078.1.3119 WP_000612078.1.31190 WP_000612078.1.31195 WP_000612078.1.31196 WP_000612078.1.31219 WP_000612078.1.31281 WP_000612078.1.31362 WP_000612078.1.31504 WP_000612078.1.31515 WP_000612078.1.31578 WP_000612078.1.31658 WP_000612078.1.31940 WP_000612078.1.31967 WP_000612078.1.31972 WP_000612078.1.32192 WP_000612078.1.32206 WP_000612078.1.32438 WP_000612078.1.32515 WP_000612078.1.32527 WP_000612078.1.32660 WP_000612078.1.32702 WP_000612078.1.32714 WP_000612078.1.32786 WP_000612078.1.32804 WP_000612078.1.32860 WP_000612078.1.32907 WP_000612078.1.33030 WP_000612078.1.33127 WP_000612078.1.33143 WP_000612078.1.33248 WP_000612078.1.33261 WP_000612078.1.333 WP_000612078.1.33492 WP_000612078.1.33553 WP_000612078.1.33592 WP_000612078.1.33894 WP_000612078.1.34043 WP_000612078.1.34075 WP_000612078.1.34257 WP_000612078.1.34279 WP_000612078.1.34319 WP_000612078.1.34453 WP_000612078.1.34610 WP_000612078.1.34856 WP_000612078.1.34975 WP_000612078.1.34977 WP_000612078.1.35045 WP_000612078.1.35129 WP_000612078.1.35184 WP_000612078.1.35404 WP_000612078.1.35408 WP_000612078.1.35425 WP_000612078.1.35429 WP_000612078.1.35463 WP_000612078.1.35503 WP_000612078.1.35509 WP_000612078.1.35590 WP_000612078.1.35940 WP_000612078.1.36003 WP_000612078.1.3601 WP_000612078.1.36609 WP_000612078.1.36690 WP_000612078.1.3670 WP_000612078.1.36705 WP_000612078.1.36918 WP_000612078.1.36931 WP_000612078.1.37073 WP_000612078.1.37111 WP_000612078.1.37112 WP_000612078.1.37256 WP_000612078.1.37293 WP_000612078.1.37370 WP_000612078.1.37376 WP_000612078.1.3744 WP_000612078.1.37498 WP_000612078.1.37504 WP_000612078.1.37618 WP_000612078.1.37687 WP_000612078.1.37968 WP_000612078.1.37978 WP_000612078.1.38125 WP_000612078.1.38145 WP_000612078.1.383 WP_000612078.1.3848 WP_000612078.1.38613 WP_000612078.1.38673 WP_000612078.1.3869 WP_000612078.1.38693 WP_000612078.1.38773 WP_000612078.1.38882 WP_000612078.1.38913 WP_000612078.1.39003 WP_000612078.1.39136 WP_000612078.1.39197 WP_000612078.1.39229 WP_000612078.1.39405 WP_000612078.1.39420 WP_000612078.1.39449 WP_000612078.1.39512 WP_000612078.1.39556 WP_000612078.1.39629 WP_000612078.1.39763 WP_000612078.1.39862 WP_000612078.1.39921 WP_000612078.1.39923 WP_000612078.1.40017 WP_000612078.1.40072 WP_000612078.1.40073 WP_000612078.1.4011 WP_000612078.1.40208 WP_000612078.1.40240 WP_000612078.1.40257 WP_000612078.1.40292 WP_000612078.1.40305 WP_000612078.1.40311 WP_000612078.1.40380 WP_000612078.1.40395 WP_000612078.1.40465 WP_000612078.1.40710 WP_000612078.1.4075 WP_000612078.1.4087 WP_000612078.1.40877 WP_000612078.1.41017 WP_000612078.1.41086 WP_000612078.1.41091 WP_000612078.1.41226 WP_000612078.1.41279 WP_000612078.1.41516 WP_000612078.1.41554 WP_000612078.1.41572 WP_000612078.1.41591 WP_000612078.1.41662 WP_000612078.1.41708 WP_000612078.1.41761 WP_000612078.1.41859 WP_000612078.1.41882 WP_000612078.1.41979 WP_000612078.1.41985 WP_000612078.1.42104 WP_000612078.1.42320 WP_000612078.1.42342 WP_000612078.1.42422 WP_000612078.1.4276 WP_000612078.1.42864 WP_000612078.1.4288 WP_000612078.1.43018 WP_000612078.1.43041 WP_000612078.1.43244 WP_000612078.1.43312 WP_000612078.1.43334 WP_000612078.1.43351 WP_000612078.1.43437 WP_000612078.1.43522 WP_000612078.1.43613 WP_000612078.1.43668 WP_000612078.1.43886 WP_000612078.1.44005 WP_000612078.1.44043 WP_000612078.1.44099 WP_000612078.1.44121 WP_000612078.1.44291 WP_000612078.1.44310 WP_000612078.1.44479 WP_000612078.1.44640 WP_000612078.1.4467 WP_000612078.1.44747 WP_000612078.1.4485 WP_000612078.1.44877 WP_000612078.1.44927 WP_000612078.1.44971 WP_000612078.1.45067 WP_000612078.1.45074 WP_000612078.1.45079 WP_000612078.1.45098 WP_000612078.1.45177 WP_000612078.1.45184 WP_000612078.1.45259 WP_000612078.1.45344 WP_000612078.1.45349 WP_000612078.1.45365 WP_000612078.1.45550 WP_000612078.1.45585 WP_000612078.1.45660 WP_000612078.1.45690 WP_000612078.1.45797 WP_000612078.1.458 WP_000612078.1.46011 WP_000612078.1.46069 WP_000612078.1.46112 WP_000612078.1.46173 WP_000612078.1.46174 WP_000612078.1.46187 WP_000612078.1.46303 WP_000612078.1.46595 WP_000612078.1.46675 WP_000612078.1.46930 WP_000612078.1.47214 WP_000612078.1.47429 WP_000612078.1.47448 WP_000612078.1.4747 WP_000612078.1.47472 WP_000612078.1.47478 WP_000612078.1.47621 WP_000612078.1.47799 WP_000612078.1.47928 WP_000612078.1.48242 WP_000612078.1.48253 WP_000612078.1.483 WP_000612078.1.48367 WP_000612078.1.48377 WP_000612078.1.4853 WP_000612078.1.48788 WP_000612078.1.4885 WP_000612078.1.48876 WP_000612078.1.48894 WP_000612078.1.48919 WP_000612078.1.49084 WP_000612078.1.49155 WP_000612078.1.49204 WP_000612078.1.49239 WP_000612078.1.49256 WP_000612078.1.49290 WP_000612078.1.49340 WP_000612078.1.49366 WP_000612078.1.49490 WP_000612078.1.49515 WP_000612078.1.49572 WP_000612078.1.4979 WP_000612078.1.49803 WP_000612078.1.49805 WP_000612078.1.49929 WP_000612078.1.50080 WP_000612078.1.50161 WP_000612078.1.50211 WP_000612078.1.50376 WP_000612078.1.50389 WP_000612078.1.50676 WP_000612078.1.50774 WP_000612078.1.50804 WP_000612078.1.50808 WP_000612078.1.5088 WP_000612078.1.50908 WP_000612078.1.50941 WP_000612078.1.51014 WP_000612078.1.51022 WP_000612078.1.51179 WP_000612078.1.51182 WP_000612078.1.51186 WP_000612078.1.51487 WP_000612078.1.51488 WP_000612078.1.51634 WP_000612078.1.51649 WP_000612078.1.51686 WP_000612078.1.51756 WP_000612078.1.51911 WP_000612078.1.51932 WP_000612078.1.51989 WP_000612078.1.52121 WP_000612078.1.52148 WP_000612078.1.52346 WP_000612078.1.52353 WP_000612078.1.52361 WP_000612078.1.52653 WP_000612078.1.52656 WP_000612078.1.52743 WP_000612078.1.52857 WP_000612078.1.52898 WP_000612078.1.52915 WP_000612078.1.53190 WP_000612078.1.53406 WP_000612078.1.53436 WP_000612078.1.53466 WP_000612078.1.53529 WP_000612078.1.53543 WP_000612078.1.53757 WP_000612078.1.53812 WP_000612078.1.54033 WP_000612078.1.54075 WP_000612078.1.54196 WP_000612078.1.542 WP_000612078.1.54209 WP_000612078.1.54271 WP_000612078.1.54273 WP_000612078.1.54274 WP_000612078.1.54319 WP_000612078.1.54364 WP_000612078.1.54400 WP_000612078.1.54644 WP_000612078.1.54662 WP_000612078.1.54722 WP_000612078.1.54749 WP_000612078.1.54764 WP_000612078.1.55008 WP_000612078.1.55152 WP_000612078.1.55156 WP_000612078.1.55285 WP_000612078.1.55475 WP_000612078.1.55647 WP_000612078.1.55743 WP_000612078.1.55768 WP_000612078.1.55782 WP_000612078.1.55796 WP_000612078.1.55993 WP_000612078.1.56002 WP_000612078.1.56012 WP_000612078.1.56105 WP_000612078.1.56238 WP_000612078.1.56286 WP_000612078.1.56304 WP_000612078.1.56414 WP_000612078.1.56438 WP_000612078.1.56560 WP_000612078.1.56597 WP_000612078.1.56601 WP_000612078.1.56614 WP_000612078.1.56671 WP_000612078.1.56682 WP_000612078.1.56875 WP_000612078.1.56877 WP_000612078.1.57168 WP_000612078.1.57187 WP_000612078.1.57232 WP_000612078.1.57377 WP_000612078.1.57433 WP_000612078.1.57515 WP_000612078.1.57529 WP_000612078.1.57576 WP_000612078.1.57601 WP_000612078.1.57607 WP_000612078.1.57763 WP_000612078.1.57862 WP_000612078.1.57890 WP_000612078.1.57891 WP_000612078.1.57978 WP_000612078.1.5801 WP_000612078.1.58041 WP_000612078.1.58418 WP_000612078.1.5854 WP_000612078.1.58548 WP_000612078.1.5858 WP_000612078.1.58662 WP_000612078.1.58669 WP_000612078.1.58745 WP_000612078.1.58803 WP_000612078.1.5886 WP_000612078.1.59094 WP_000612078.1.59224 WP_000612078.1.59321 WP_000612078.1.59375 WP_000612078.1.59458 WP_000612078.1.59490 WP_000612078.1.59508 WP_000612078.1.5953 WP_000612078.1.59684 WP_000612078.1.59694 WP_000612078.1.59771 WP_000612078.1.5979 WP_000612078.1.59953 WP_000612078.1.60008 WP_000612078.1.60021 WP_000612078.1.60052 WP_000612078.1.60069 WP_000612078.1.60140 WP_000612078.1.60155 WP_000612078.1.60285 WP_000612078.1.60379 WP_000612078.1.60464 WP_000612078.1.60874 WP_000612078.1.60941 WP_000612078.1.61078 WP_000612078.1.6114 WP_000612078.1.61232 WP_000612078.1.6129 WP_000612078.1.61296 WP_000612078.1.61345 WP_000612078.1.61417 WP_000612078.1.61574 WP_000612078.1.61609 WP_000612078.1.61712 WP_000612078.1.61714 WP_000612078.1.61730 WP_000612078.1.61857 WP_000612078.1.61952 WP_000612078.1.62007 WP_000612078.1.62025 WP_000612078.1.62204 WP_000612078.1.62304 WP_000612078.1.62364 WP_000612078.1.62374 WP_000612078.1.62403 WP_000612078.1.6253 WP_000612078.1.62570 WP_000612078.1.62853 WP_000612078.1.62903 WP_000612078.1.62910 WP_000612078.1.62955 WP_000612078.1.63063 WP_000612078.1.63181 WP_000612078.1.63203 WP_000612078.1.63256 WP_000612078.1.63290 WP_000612078.1.63382 WP_000612078.1.63432 WP_000612078.1.63461 WP_000612078.1.63479 WP_000612078.1.63577 WP_000612078.1.63664 WP_000612078.1.63718 WP_000612078.1.6375 WP_000612078.1.63757 WP_000612078.1.63834 WP_000612078.1.64046 WP_000612078.1.6423 WP_000612078.1.64244 WP_000612078.1.64403 WP_000612078.1.64649 WP_000612078.1.64702 WP_000612078.1.64757 WP_000612078.1.64781 WP_000612078.1.64831 WP_000612078.1.6489 WP_000612078.1.65018 WP_000612078.1.65028 WP_000612078.1.65171 WP_000612078.1.65248 WP_000612078.1.6535 WP_000612078.1.65474 WP_000612078.1.65572 WP_000612078.1.65633 WP_000612078.1.6565 WP_000612078.1.65696 WP_000612078.1.6575 WP_000612078.1.65782 WP_000612078.1.6630 WP_000612078.1.66314 WP_000612078.1.66358 WP_000612078.1.66362 WP_000612078.1.6638 WP_000612078.1.6640 WP_000612078.1.66698 WP_000612078.1.6680 WP_000612078.1.66834 WP_000612078.1.66901 WP_000612078.1.66962 WP_000612078.1.67037 WP_000612078.1.67045 WP_000612078.1.67181 WP_000612078.1.67268 WP_000612078.1.67347 WP_000612078.1.67465 WP_000612078.1.67552 WP_000612078.1.67682 WP_000612078.1.67829 WP_000612078.1.67887 WP_000612078.1.68073 WP_000612078.1.68201 WP_000612078.1.68206 WP_000612078.1.6827 WP_000612078.1.68275 WP_000612078.1.6849 WP_000612078.1.68547 WP_000612078.1.68589 WP_000612078.1.68655 WP_000612078.1.68656 WP_000612078.1.68778 WP_000612078.1.68787 WP_000612078.1.68894 WP_000612078.1.68928 WP_000612078.1.68975 WP_000612078.1.69006 WP_000612078.1.6913 WP_000612078.1.69146 WP_000612078.1.69255 WP_000612078.1.69397 WP_000612078.1.69564 WP_000612078.1.69644 WP_000612078.1.69704 WP_000612078.1.69754 WP_000612078.1.7021 WP_000612078.1.70241 WP_000612078.1.70269 WP_000612078.1.70289 WP_000612078.1.70447 WP_000612078.1.70485 WP_000612078.1.70643 WP_000612078.1.70683 WP_000612078.1.70883 WP_000612078.1.70922 WP_000612078.1.70948 WP_000612078.1.71116 WP_000612078.1.71146 WP_000612078.1.71165 WP_000612078.1.71188 WP_000612078.1.71202 WP_000612078.1.71243 WP_000612078.1.71306 WP_000612078.1.71337 WP_000612078.1.71378 WP_000612078.1.71401 WP_000612078.1.71691 WP_000612078.1.71702 WP_000612078.1.71845 WP_000612078.1.71881 WP_000612078.1.71908 WP_000612078.1.71952 WP_000612078.1.71973 WP_000612078.1.72105 WP_000612078.1.72203 WP_000612078.1.72372 WP_000612078.1.72376 WP_000612078.1.72594 WP_000612078.1.72871 WP_000612078.1.72975 WP_000612078.1.73062 WP_000612078.1.7315 WP_000612078.1.73200 WP_000612078.1.7334 WP_000612078.1.73377 WP_000612078.1.73481 WP_000612078.1.7356 WP_000612078.1.73561 WP_000612078.1.73581 WP_000612078.1.73617 WP_000612078.1.73667 WP_000612078.1.73753 WP_000612078.1.73758 WP_000612078.1.73794 WP_000612078.1.7387 WP_000612078.1.73924 WP_000612078.1.73926 WP_000612078.1.74029 WP_000612078.1.74181 WP_000612078.1.74191 WP_000612078.1.7433 WP_000612078.1.74379 WP_000612078.1.74410 WP_000612078.1.74466 WP_000612078.1.74529 WP_000612078.1.74545 WP_000612078.1.74745 WP_000612078.1.75129 WP_000612078.1.75187 WP_000612078.1.75288 WP_000612078.1.75334 WP_000612078.1.75385 WP_000612078.1.75392 WP_000612078.1.75760 WP_000612078.1.75764 WP_000612078.1.75837 WP_000612078.1.75874 WP_000612078.1.75945 WP_000612078.1.76020 WP_000612078.1.76252 WP_000612078.1.76445 WP_000612078.1.7660 WP_000612078.1.76673 WP_000612078.1.76706 WP_000612078.1.76721 WP_000612078.1.76756 WP_000612078.1.76760 WP_000612078.1.76875 WP_000612078.1.76880 WP_000612078.1.76899 WP_000612078.1.77038 WP_000612078.1.77047 WP_000612078.1.77080 WP_000612078.1.7712 WP_000612078.1.77180 WP_000612078.1.77244 WP_000612078.1.77292 WP_000612078.1.77349 WP_000612078.1.77514 WP_000612078.1.77529 WP_000612078.1.77549 WP_000612078.1.77692 WP_000612078.1.7782 WP_000612078.1.77851 WP_000612078.1.77898 WP_000612078.1.77918 WP_000612078.1.77960 WP_000612078.1.78033 WP_000612078.1.78076 WP_000612078.1.78096 WP_000612078.1.78100 WP_000612078.1.78110 WP_000612078.1.78120 WP_000612078.1.78383 WP_000612078.1.78407 WP_000612078.1.7861 WP_000612078.1.78618 WP_000612078.1.78673 WP_000612078.1.78735 WP_000612078.1.78802 WP_000612078.1.78830 WP_000612078.1.78835 WP_000612078.1.78871 WP_000612078.1.78874 WP_000612078.1.78918 WP_000612078.1.78930 WP_000612078.1.79151 WP_000612078.1.79167 WP_000612078.1.79335 WP_000612078.1.79462 WP_000612078.1.79472 WP_000612078.1.79490 WP_000612078.1.79495 WP_000612078.1.79529 WP_000612078.1.79570 WP_000612078.1.7964 WP_000612078.1.79659 WP_000612078.1.79668 WP_000612078.1.79708 WP_000612078.1.79845 WP_000612078.1.80077 WP_000612078.1.80137 WP_000612078.1.80182 WP_000612078.1.80296 WP_000612078.1.80366 WP_000612078.1.80780 WP_000612078.1.80831 WP_000612078.1.80850 WP_000612078.1.80881 WP_000612078.1.80939 WP_000612078.1.8096 WP_000612078.1.81037 WP_000612078.1.81069 WP_000612078.1.81149 WP_000612078.1.81175 WP_000612078.1.8119 WP_000612078.1.81193 WP_000612078.1.81354 WP_000612078.1.81410 WP_000612078.1.81425 WP_000612078.1.81750 WP_000612078.1.81785 WP_000612078.1.81902 WP_000612078.1.81974 WP_000612078.1.82337 WP_000612078.1.82479 WP_000612078.1.82503 WP_000612078.1.82515 WP_000612078.1.82584 WP_000612078.1.82676 WP_000612078.1.82761 WP_000612078.1.8282 WP_000612078.1.82944 WP_000612078.1.82956 WP_000612078.1.83092 WP_000612078.1.83163 WP_000612078.1.83305 WP_000612078.1.83365 WP_000612078.1.83413 WP_000612078.1.83491 WP_000612078.1.83523 WP_000612078.1.8354 WP_000612078.1.83721 WP_000612078.1.83760 WP_000612078.1.83995 WP_000612078.1.84103 WP_000612078.1.84283 WP_000612078.1.84392 WP_000612078.1.8441 WP_000612078.1.84532 WP_000612078.1.84554 WP_000612078.1.84659 WP_000612078.1.84693 WP_000612078.1.84899 WP_000612078.1.8497 WP_000612078.1.85040 WP_000612078.1.85134 WP_000612078.1.85178 WP_000612078.1.85190 WP_000612078.1.8533 WP_000612078.1.8545 WP_000612078.1.85481 WP_000612078.1.85483 WP_000612078.1.85541 WP_000612078.1.8556 WP_000612078.1.85615 WP_000612078.1.85617 WP_000612078.1.85663 WP_000612078.1.85671 WP_000612078.1.85672 WP_000612078.1.85777 WP_000612078.1.85855 WP_000612078.1.85886 WP_000612078.1.85900 WP_000612078.1.85904 WP_000612078.1.85976 WP_000612078.1.86306 WP_000612078.1.86356 WP_000612078.1.86450 WP_000612078.1.86469 WP_000612078.1.86580 WP_000612078.1.86588 WP_000612078.1.86661 WP_000612078.1.8672 WP_000612078.1.8678 WP_000612078.1.86810 WP_000612078.1.8684 WP_000612078.1.86895 WP_000612078.1.86906 WP_000612078.1.87095 WP_000612078.1.87323 WP_000612078.1.8736 WP_000612078.1.87460 WP_000612078.1.87552 WP_000612078.1.87779 WP_000612078.1.87945 WP_000612078.1.88019 WP_000612078.1.88073 WP_000612078.1.8809 WP_000612078.1.88291 WP_000612078.1.88293 WP_000612078.1.8837 WP_000612078.1.88393 WP_000612078.1.88703 WP_000612078.1.88792 WP_000612078.1.88902 WP_000612078.1.8891 WP_000612078.1.88981 WP_000612078.1.89008 WP_000612078.1.89116 WP_000612078.1.89138 WP_000612078.1.89304 WP_000612078.1.89512 WP_000612078.1.89527 WP_000612078.1.89570 WP_000612078.1.89604 WP_000612078.1.89622 WP_000612078.1.89659 WP_000612078.1.89902 WP_000612078.1.8996 WP_000612078.1.90097 WP_000612078.1.90252 WP_000612078.1.90417 WP_000612078.1.90453 WP_000612078.1.90458 WP_000612078.1.90557 WP_000612078.1.90585 WP_000612078.1.90641 WP_000612078.1.90734 WP_000612078.1.91003 WP_000612078.1.91069 WP_000612078.1.91278 WP_000612078.1.9131 WP_000612078.1.91512 WP_000612078.1.91564 WP_000612078.1.91628 WP_000612078.1.91655 WP_000612078.1.91724 WP_000612078.1.91732 WP_000612078.1.91788 WP_000612078.1.92013 WP_000612078.1.92060 WP_000612078.1.92093 WP_000612078.1.92108 WP_000612078.1.92171 WP_000612078.1.92183 WP_000612078.1.92208 WP_000612078.1.92268 WP_000612078.1.92310 WP_000612078.1.92318 WP_000612078.1.92443 WP_000612078.1.92482 WP_000612078.1.92531 WP_000612078.1.92669 WP_000612078.1.92671 WP_000612078.1.92738 WP_000612078.1.93086 WP_000612078.1.93101 WP_000612078.1.93136 WP_000612078.1.93155 WP_000612078.1.93275 WP_000612078.1.93365 WP_000612078.1.93376 WP_000612078.1.93543 WP_000612078.1.93650 WP_000612078.1.93656 WP_000612078.1.93662 WP_000612078.1.937 WP_000612078.1.93705 WP_000612078.1.93804 WP_000612078.1.9389 WP_000612078.1.93994 WP_000612078.1.94072 WP_000612078.1.94162 WP_000612078.1.94168 WP_000612078.1.94198 WP_000612078.1.9432 WP_000612078.1.94354 WP_000612078.1.94380 WP_000612078.1.94458 WP_000612078.1.94565 WP_000612078.1.94584 WP_000612078.1.94674 WP_000612078.1.94796 WP_000612078.1.94959 WP_000612078.1.95051 WP_000612078.1.95085 WP_000612078.1.95121 WP_000612078.1.95282 WP_000612078.1.95546 WP_000612078.1.95630 WP_000612078.1.95911 WP_000612078.1.96139 WP_000612078.1.96317 WP_000612078.1.96343 WP_000612078.1.9644 WP_000612078.1.96469 WP_000612078.1.96497 WP_000612078.1.96500 WP_000612078.1.96555 WP_000612078.1.96563 WP_000612078.1.96732 WP_000612078.1.96771 WP_000612078.1.97015 WP_000612078.1.97145 WP_000612078.1.97190 WP_000612078.1.97318 WP_000612078.1.97369 WP_000612078.1.97594 WP_000612078.1.97597 WP_000612078.1.97613 WP_000612078.1.97620 WP_000612078.1.97727 WP_000612078.1.97732 WP_000612078.1.97736 WP_000612078.1.9775 WP_000612078.1.97846 WP_000612078.1.98006 WP_000612078.1.98019 WP_000612078.1.98022 WP_000612078.1.98110 WP_000612078.1.98146 WP_000612078.1.98219 WP_000612078.1.9841 WP_000612078.1.98495 WP_000612078.1.98531 WP_000612078.1.98577 WP_000612078.1.98676 WP_000612078.1.98677 WP_000612078.1.98760 WP_000612078.1.98843 WP_000612078.1.9898 WP_000612078.1.99098 WP_000612078.1.99184 WP_000612078.1.99267 WP_000612078.1.99276 WP_000612078.1.99646 WP_000612078.1.99657 WP_000612078.1.99660 WP_000612078.1.99712 WP_000612078.1.99813 WP_000612078.1.99858 WP_000612078.1.99889 WP_000612078.1.99958 gi|526218227|ref|YP_008263337.1| gi|550903299|ref|YP_008672391.1| gi|379703178|ref|YP_005244906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]