SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482906587|ref|YP_007905147.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482906587|ref|YP_007905147.1|
Domain Number 1 Region: 22-276
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.2e-79
Family FdhD/NarQ 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|482906587|ref|YP_007905147.1|
Sequence length 278
Comment formate dehydrogenase accessory protein [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MNNILSEEVLNVTDFTTSRQLTLWKREDLQSPQLDDVAEEVPVALVYNGISHVVMMASPK
DLTHFAMGFSLSEGIIDSPREIYGMDVVPSCNGLEVQIDLSSRRFMGLKARRRALAGRTG
CGVCGVEQLNDIGKPVQPLPFSQTFNLGNLDRALKHLNDFQPTGKLTGCTHAAAWVMPSG
ELAGGHEDVGRHVALDKLLGRRATEGEEWRQGAALVSSRASYEMVQKSAMCGVEILFAVS
AATTLAVEVAERCNLTLVGFCKPGRATIYTHPQRLIAD
Download sequence
Identical sequences A0A0D6IQ31 A0A0F6B9K8 A0A0F7JDS2 A0A0H3NI48 A0A0R9PEH8 A0A0U1G822 A0A0W4SFP5 A0A1S0Z8Z3 A0A2D3AIX8 A0A2H9YEZ8 B4SZY1 E8XKA2 Q8ZKS7 V7UR26
APC24123 StR58 gi|525839950|ref|YP_008257364.1| gi|194442281|ref|YP_002043257.1| 423368.SNSL254_A4319 99287.STM4038 gi|378447375|ref|YP_005235007.1| gi|378986723|ref|YP_005249879.1| gi|378701896|ref|YP_005183854.1| gi|379703281|ref|YP_005245009.1| ABAM02000001|CDS_4615775-4616611 ABAN01000010|CDS_102816-101980 ABAO01000008|CDS_24008-24844 ABFH02000001|CDS_888865-888029 AE006468|CDS_4248003-4248839 CP001113|CDS_4208331-4209167 CP001363|CDS_4261587-4262423 FN424405|CDS_4270758-4271594 gi|16767303|ref|NP_462918.1| gi|378452946|ref|YP_005240306.1| gi|378991319|ref|YP_005254483.1| gi|526218142|ref|YP_008263233.1| gi|482906587|ref|YP_007905147.1| gi|550903398|ref|YP_008672490.1| NP_462918.1.58477 WP_001059744.1.100010 WP_001059744.1.100234 WP_001059744.1.100376 WP_001059744.1.100424 WP_001059744.1.100436 WP_001059744.1.100484 WP_001059744.1.100488 WP_001059744.1.100502 WP_001059744.1.100521 WP_001059744.1.100589 WP_001059744.1.100597 WP_001059744.1.100707 WP_001059744.1.100711 WP_001059744.1.10076 WP_001059744.1.100781 WP_001059744.1.100793 WP_001059744.1.100869 WP_001059744.1.100871 WP_001059744.1.100882 WP_001059744.1.101020 WP_001059744.1.101074 WP_001059744.1.101078 WP_001059744.1.101180 WP_001059744.1.101185 WP_001059744.1.101223 WP_001059744.1.101259 WP_001059744.1.101284 WP_001059744.1.101353 WP_001059744.1.101386 WP_001059744.1.101404 WP_001059744.1.101420 WP_001059744.1.101589 WP_001059744.1.101707 WP_001059744.1.101734 WP_001059744.1.101953 WP_001059744.1.102103 WP_001059744.1.10220 WP_001059744.1.10266 WP_001059744.1.10310 WP_001059744.1.10429 WP_001059744.1.10439 WP_001059744.1.10465 WP_001059744.1.10675 WP_001059744.1.10678 WP_001059744.1.10753 WP_001059744.1.10992 WP_001059744.1.11024 WP_001059744.1.11031 WP_001059744.1.11041 WP_001059744.1.11098 WP_001059744.1.11168 WP_001059744.1.11190 WP_001059744.1.11295 WP_001059744.1.113 WP_001059744.1.11362 WP_001059744.1.11455 WP_001059744.1.11458 WP_001059744.1.11518 WP_001059744.1.11532 WP_001059744.1.11543 WP_001059744.1.11763 WP_001059744.1.11897 WP_001059744.1.12114 WP_001059744.1.12351 WP_001059744.1.12370 WP_001059744.1.12546 WP_001059744.1.1264 WP_001059744.1.12718 WP_001059744.1.12728 WP_001059744.1.12879 WP_001059744.1.12936 WP_001059744.1.12995 WP_001059744.1.13027 WP_001059744.1.13106 WP_001059744.1.13130 WP_001059744.1.1326 WP_001059744.1.13414 WP_001059744.1.13488 WP_001059744.1.13509 WP_001059744.1.13669 WP_001059744.1.13677 WP_001059744.1.13741 WP_001059744.1.1387 WP_001059744.1.13908 WP_001059744.1.13932 WP_001059744.1.13968 WP_001059744.1.14001 WP_001059744.1.14041 WP_001059744.1.14151 WP_001059744.1.14212 WP_001059744.1.14239 WP_001059744.1.14320 WP_001059744.1.14379 WP_001059744.1.14406 WP_001059744.1.14410 WP_001059744.1.14466 WP_001059744.1.14505 WP_001059744.1.14519 WP_001059744.1.14524 WP_001059744.1.14554 WP_001059744.1.14688 WP_001059744.1.14725 WP_001059744.1.14852 WP_001059744.1.1489 WP_001059744.1.14932 WP_001059744.1.15055 WP_001059744.1.15124 WP_001059744.1.15223 WP_001059744.1.15226 WP_001059744.1.15316 WP_001059744.1.15369 WP_001059744.1.1540 WP_001059744.1.15483 WP_001059744.1.15508 WP_001059744.1.15625 WP_001059744.1.15708 WP_001059744.1.15784 WP_001059744.1.15830 WP_001059744.1.16032 WP_001059744.1.16062 WP_001059744.1.16063 WP_001059744.1.16103 WP_001059744.1.16201 WP_001059744.1.16226 WP_001059744.1.16233 WP_001059744.1.16284 WP_001059744.1.16328 WP_001059744.1.16331 WP_001059744.1.1635 WP_001059744.1.16468 WP_001059744.1.16614 WP_001059744.1.16650 WP_001059744.1.16686 WP_001059744.1.16691 WP_001059744.1.16732 WP_001059744.1.16735 WP_001059744.1.16736 WP_001059744.1.16786 WP_001059744.1.16858 WP_001059744.1.1689 WP_001059744.1.16896 WP_001059744.1.16916 WP_001059744.1.16965 WP_001059744.1.1700 WP_001059744.1.17285 WP_001059744.1.17307 WP_001059744.1.1737 WP_001059744.1.174 WP_001059744.1.17439 WP_001059744.1.17447 WP_001059744.1.17546 WP_001059744.1.17560 WP_001059744.1.17702 WP_001059744.1.17705 WP_001059744.1.17755 WP_001059744.1.17901 WP_001059744.1.17919 WP_001059744.1.17991 WP_001059744.1.18019 WP_001059744.1.18111 WP_001059744.1.18163 WP_001059744.1.18265 WP_001059744.1.18267 WP_001059744.1.18281 WP_001059744.1.18282 WP_001059744.1.18468 WP_001059744.1.18607 WP_001059744.1.18692 WP_001059744.1.18705 WP_001059744.1.18715 WP_001059744.1.18776 WP_001059744.1.18822 WP_001059744.1.18881 WP_001059744.1.18940 WP_001059744.1.18949 WP_001059744.1.1897 WP_001059744.1.19053 WP_001059744.1.19320 WP_001059744.1.19458 WP_001059744.1.19460 WP_001059744.1.19461 WP_001059744.1.19614 WP_001059744.1.19642 WP_001059744.1.19702 WP_001059744.1.19706 WP_001059744.1.19723 WP_001059744.1.19724 WP_001059744.1.19749 WP_001059744.1.19784 WP_001059744.1.19802 WP_001059744.1.19809 WP_001059744.1.19867 WP_001059744.1.19970 WP_001059744.1.1998 WP_001059744.1.20 WP_001059744.1.2010 WP_001059744.1.20212 WP_001059744.1.20266 WP_001059744.1.20271 WP_001059744.1.2036 WP_001059744.1.20362 WP_001059744.1.20391 WP_001059744.1.20418 WP_001059744.1.20425 WP_001059744.1.20443 WP_001059744.1.20525 WP_001059744.1.2054 WP_001059744.1.20553 WP_001059744.1.20626 WP_001059744.1.20631 WP_001059744.1.20646 WP_001059744.1.20695 WP_001059744.1.20700 WP_001059744.1.20908 WP_001059744.1.21049 WP_001059744.1.21146 WP_001059744.1.21181 WP_001059744.1.21245 WP_001059744.1.21246 WP_001059744.1.21269 WP_001059744.1.21309 WP_001059744.1.21326 WP_001059744.1.21400 WP_001059744.1.21453 WP_001059744.1.21497 WP_001059744.1.21499 WP_001059744.1.21603 WP_001059744.1.21751 WP_001059744.1.21757 WP_001059744.1.21792 WP_001059744.1.22024 WP_001059744.1.2205 WP_001059744.1.22062 WP_001059744.1.22067 WP_001059744.1.22169 WP_001059744.1.2221 WP_001059744.1.22337 WP_001059744.1.2235 WP_001059744.1.22379 WP_001059744.1.22427 WP_001059744.1.2246 WP_001059744.1.22485 WP_001059744.1.22514 WP_001059744.1.22575 WP_001059744.1.22620 WP_001059744.1.22855 WP_001059744.1.22870 WP_001059744.1.22979 WP_001059744.1.23102 WP_001059744.1.23114 WP_001059744.1.2314 WP_001059744.1.23155 WP_001059744.1.23192 WP_001059744.1.23246 WP_001059744.1.23259 WP_001059744.1.2342 WP_001059744.1.23460 WP_001059744.1.23472 WP_001059744.1.23482 WP_001059744.1.23621 WP_001059744.1.23634 WP_001059744.1.2364 WP_001059744.1.23707 WP_001059744.1.23736 WP_001059744.1.23819 WP_001059744.1.23932 WP_001059744.1.24017 WP_001059744.1.24206 WP_001059744.1.24259 WP_001059744.1.24308 WP_001059744.1.24419 WP_001059744.1.24578 WP_001059744.1.2467 WP_001059744.1.24727 WP_001059744.1.24737 WP_001059744.1.24779 WP_001059744.1.25008 WP_001059744.1.25015 WP_001059744.1.25405 WP_001059744.1.25454 WP_001059744.1.25493 WP_001059744.1.25498 WP_001059744.1.2554 WP_001059744.1.25596 WP_001059744.1.25668 WP_001059744.1.25690 WP_001059744.1.2570 WP_001059744.1.25700 WP_001059744.1.25740 WP_001059744.1.25793 WP_001059744.1.25814 WP_001059744.1.25932 WP_001059744.1.25988 WP_001059744.1.26269 WP_001059744.1.26282 WP_001059744.1.26311 WP_001059744.1.26319 WP_001059744.1.26363 WP_001059744.1.26426 WP_001059744.1.26429 WP_001059744.1.26440 WP_001059744.1.26493 WP_001059744.1.26551 WP_001059744.1.26567 WP_001059744.1.26582 WP_001059744.1.26924 WP_001059744.1.27010 WP_001059744.1.27169 WP_001059744.1.27173 WP_001059744.1.27206 WP_001059744.1.27419 WP_001059744.1.27423 WP_001059744.1.27561 WP_001059744.1.2763 WP_001059744.1.27665 WP_001059744.1.27679 WP_001059744.1.27707 WP_001059744.1.27755 WP_001059744.1.27761 WP_001059744.1.2777 WP_001059744.1.27857 WP_001059744.1.27977 WP_001059744.1.28094 WP_001059744.1.28170 WP_001059744.1.28302 WP_001059744.1.2835 WP_001059744.1.28370 WP_001059744.1.28538 WP_001059744.1.28575 WP_001059744.1.28612 WP_001059744.1.28625 WP_001059744.1.28655 WP_001059744.1.28694 WP_001059744.1.287 WP_001059744.1.2879 WP_001059744.1.2890 WP_001059744.1.28938 WP_001059744.1.28946 WP_001059744.1.29006 WP_001059744.1.29010 WP_001059744.1.2910 WP_001059744.1.29530 WP_001059744.1.29588 WP_001059744.1.29601 WP_001059744.1.29606 WP_001059744.1.29615 WP_001059744.1.29619 WP_001059744.1.29682 WP_001059744.1.29704 WP_001059744.1.29768 WP_001059744.1.29898 WP_001059744.1.29924 WP_001059744.1.29969 WP_001059744.1.30006 WP_001059744.1.30027 WP_001059744.1.30093 WP_001059744.1.3017 WP_001059744.1.30180 WP_001059744.1.30389 WP_001059744.1.30469 WP_001059744.1.30507 WP_001059744.1.30535 WP_001059744.1.30547 WP_001059744.1.30602 WP_001059744.1.3076 WP_001059744.1.30794 WP_001059744.1.30833 WP_001059744.1.30835 WP_001059744.1.30909 WP_001059744.1.30972 WP_001059744.1.31 WP_001059744.1.3113 WP_001059744.1.31185 WP_001059744.1.3119 WP_001059744.1.31190 WP_001059744.1.31195 WP_001059744.1.31196 WP_001059744.1.31210 WP_001059744.1.3124 WP_001059744.1.31281 WP_001059744.1.31362 WP_001059744.1.31476 WP_001059744.1.31504 WP_001059744.1.31515 WP_001059744.1.31578 WP_001059744.1.31658 WP_001059744.1.31940 WP_001059744.1.31967 WP_001059744.1.31972 WP_001059744.1.32038 WP_001059744.1.32054 WP_001059744.1.32192 WP_001059744.1.32438 WP_001059744.1.32459 WP_001059744.1.32515 WP_001059744.1.32527 WP_001059744.1.32660 WP_001059744.1.32702 WP_001059744.1.32714 WP_001059744.1.32786 WP_001059744.1.32804 WP_001059744.1.32907 WP_001059744.1.33030 WP_001059744.1.33127 WP_001059744.1.33143 WP_001059744.1.33248 WP_001059744.1.33261 WP_001059744.1.333 WP_001059744.1.33492 WP_001059744.1.33553 WP_001059744.1.33592 WP_001059744.1.33825 WP_001059744.1.33894 WP_001059744.1.3395 WP_001059744.1.34043 WP_001059744.1.34075 WP_001059744.1.34107 WP_001059744.1.34257 WP_001059744.1.34279 WP_001059744.1.34319 WP_001059744.1.34453 WP_001059744.1.34610 WP_001059744.1.34647 WP_001059744.1.34856 WP_001059744.1.34975 WP_001059744.1.35045 WP_001059744.1.35125 WP_001059744.1.35129 WP_001059744.1.35184 WP_001059744.1.35294 WP_001059744.1.35404 WP_001059744.1.35408 WP_001059744.1.35425 WP_001059744.1.35429 WP_001059744.1.35446 WP_001059744.1.35460 WP_001059744.1.35463 WP_001059744.1.35503 WP_001059744.1.35509 WP_001059744.1.3556 WP_001059744.1.35590 WP_001059744.1.35940 WP_001059744.1.36003 WP_001059744.1.3601 WP_001059744.1.36157 WP_001059744.1.36564 WP_001059744.1.36609 WP_001059744.1.36690 WP_001059744.1.3670 WP_001059744.1.36705 WP_001059744.1.36899 WP_001059744.1.36918 WP_001059744.1.36931 WP_001059744.1.37063 WP_001059744.1.37073 WP_001059744.1.37111 WP_001059744.1.37112 WP_001059744.1.37293 WP_001059744.1.37370 WP_001059744.1.37376 WP_001059744.1.3744 WP_001059744.1.37498 WP_001059744.1.37504 WP_001059744.1.37558 WP_001059744.1.37618 WP_001059744.1.37666 WP_001059744.1.37968 WP_001059744.1.37978 WP_001059744.1.38125 WP_001059744.1.38145 WP_001059744.1.38199 WP_001059744.1.383 WP_001059744.1.38408 WP_001059744.1.3848 WP_001059744.1.38613 WP_001059744.1.38673 WP_001059744.1.38693 WP_001059744.1.38773 WP_001059744.1.38882 WP_001059744.1.38913 WP_001059744.1.38942 WP_001059744.1.39003 WP_001059744.1.39136 WP_001059744.1.39197 WP_001059744.1.39229 WP_001059744.1.39405 WP_001059744.1.39420 WP_001059744.1.39449 WP_001059744.1.39512 WP_001059744.1.39553 WP_001059744.1.39629 WP_001059744.1.39763 WP_001059744.1.39862 WP_001059744.1.39921 WP_001059744.1.39923 WP_001059744.1.40017 WP_001059744.1.40072 WP_001059744.1.40073 WP_001059744.1.4011 WP_001059744.1.40170 WP_001059744.1.40208 WP_001059744.1.40240 WP_001059744.1.40254 WP_001059744.1.40257 WP_001059744.1.40292 WP_001059744.1.40305 WP_001059744.1.40311 WP_001059744.1.40374 WP_001059744.1.40380 WP_001059744.1.40395 WP_001059744.1.40465 WP_001059744.1.40508 WP_001059744.1.40710 WP_001059744.1.4075 WP_001059744.1.40771 WP_001059744.1.40788 WP_001059744.1.4087 WP_001059744.1.40877 WP_001059744.1.4088 WP_001059744.1.41017 WP_001059744.1.41086 WP_001059744.1.41091 WP_001059744.1.41226 WP_001059744.1.41279 WP_001059744.1.41516 WP_001059744.1.41554 WP_001059744.1.41572 WP_001059744.1.41591 WP_001059744.1.41662 WP_001059744.1.41708 WP_001059744.1.41724 WP_001059744.1.41761 WP_001059744.1.41882 WP_001059744.1.41979 WP_001059744.1.41985 WP_001059744.1.42104 WP_001059744.1.42320 WP_001059744.1.42342 WP_001059744.1.42422 WP_001059744.1.42489 WP_001059744.1.4276 WP_001059744.1.42797 WP_001059744.1.42829 WP_001059744.1.42864 WP_001059744.1.4288 WP_001059744.1.42887 WP_001059744.1.43018 WP_001059744.1.43041 WP_001059744.1.43160 WP_001059744.1.43244 WP_001059744.1.43312 WP_001059744.1.43334 WP_001059744.1.43437 WP_001059744.1.43476 WP_001059744.1.43522 WP_001059744.1.43613 WP_001059744.1.43668 WP_001059744.1.43875 WP_001059744.1.43886 WP_001059744.1.44005 WP_001059744.1.44043 WP_001059744.1.4405 WP_001059744.1.44099 WP_001059744.1.44113 WP_001059744.1.44121 WP_001059744.1.44250 WP_001059744.1.44291 WP_001059744.1.44310 WP_001059744.1.44386 WP_001059744.1.4440 WP_001059744.1.44438 WP_001059744.1.44440 WP_001059744.1.44479 WP_001059744.1.44578 WP_001059744.1.44640 WP_001059744.1.4467 WP_001059744.1.44747 WP_001059744.1.44781 WP_001059744.1.4485 WP_001059744.1.44877 WP_001059744.1.44927 WP_001059744.1.45045 WP_001059744.1.45067 WP_001059744.1.45074 WP_001059744.1.45079 WP_001059744.1.45098 WP_001059744.1.45177 WP_001059744.1.45184 WP_001059744.1.45259 WP_001059744.1.45344 WP_001059744.1.45349 WP_001059744.1.45365 WP_001059744.1.45550 WP_001059744.1.45585 WP_001059744.1.45660 WP_001059744.1.45690 WP_001059744.1.458 WP_001059744.1.46011 WP_001059744.1.46069 WP_001059744.1.46091 WP_001059744.1.46174 WP_001059744.1.46187 WP_001059744.1.46232 WP_001059744.1.46250 WP_001059744.1.46303 WP_001059744.1.46322 WP_001059744.1.46345 WP_001059744.1.46595 WP_001059744.1.46675 WP_001059744.1.46689 WP_001059744.1.46730 WP_001059744.1.46803 WP_001059744.1.46930 WP_001059744.1.46961 WP_001059744.1.47057 WP_001059744.1.47214 WP_001059744.1.47429 WP_001059744.1.47448 WP_001059744.1.4747 WP_001059744.1.47472 WP_001059744.1.47478 WP_001059744.1.47587 WP_001059744.1.47621 WP_001059744.1.47714 WP_001059744.1.47799 WP_001059744.1.48132 WP_001059744.1.48242 WP_001059744.1.48253 WP_001059744.1.483 WP_001059744.1.48367 WP_001059744.1.48377 WP_001059744.1.4853 WP_001059744.1.48788 WP_001059744.1.4885 WP_001059744.1.48894 WP_001059744.1.48919 WP_001059744.1.49084 WP_001059744.1.49102 WP_001059744.1.49155 WP_001059744.1.49175 WP_001059744.1.49204 WP_001059744.1.49226 WP_001059744.1.49239 WP_001059744.1.49256 WP_001059744.1.49290 WP_001059744.1.49340 WP_001059744.1.49366 WP_001059744.1.49490 WP_001059744.1.49515 WP_001059744.1.49550 WP_001059744.1.49572 WP_001059744.1.49590 WP_001059744.1.4979 WP_001059744.1.49803 WP_001059744.1.49805 WP_001059744.1.49929 WP_001059744.1.49931 WP_001059744.1.50007 WP_001059744.1.50080 WP_001059744.1.5009 WP_001059744.1.50161 WP_001059744.1.50211 WP_001059744.1.50376 WP_001059744.1.50389 WP_001059744.1.50517 WP_001059744.1.50576 WP_001059744.1.50676 WP_001059744.1.50774 WP_001059744.1.50782 WP_001059744.1.50804 WP_001059744.1.50808 WP_001059744.1.5088 WP_001059744.1.50908 WP_001059744.1.50941 WP_001059744.1.51014 WP_001059744.1.51022 WP_001059744.1.51162 WP_001059744.1.51179 WP_001059744.1.51182 WP_001059744.1.51186 WP_001059744.1.51414 WP_001059744.1.51487 WP_001059744.1.51488 WP_001059744.1.51555 WP_001059744.1.51611 WP_001059744.1.51634 WP_001059744.1.51649 WP_001059744.1.51686 WP_001059744.1.51756 WP_001059744.1.51911 WP_001059744.1.51932 WP_001059744.1.51989 WP_001059744.1.52121 WP_001059744.1.52346 WP_001059744.1.52353 WP_001059744.1.52356 WP_001059744.1.52361 WP_001059744.1.52653 WP_001059744.1.52656 WP_001059744.1.52743 WP_001059744.1.52857 WP_001059744.1.52898 WP_001059744.1.52915 WP_001059744.1.5301 WP_001059744.1.53190 WP_001059744.1.53274 WP_001059744.1.53286 WP_001059744.1.53406 WP_001059744.1.53466 WP_001059744.1.53529 WP_001059744.1.53543 WP_001059744.1.53694 WP_001059744.1.53757 WP_001059744.1.53812 WP_001059744.1.54033 WP_001059744.1.54061 WP_001059744.1.54075 WP_001059744.1.54082 WP_001059744.1.54136 WP_001059744.1.54196 WP_001059744.1.54209 WP_001059744.1.54271 WP_001059744.1.54319 WP_001059744.1.54364 WP_001059744.1.54400 WP_001059744.1.54644 WP_001059744.1.54662 WP_001059744.1.54722 WP_001059744.1.54749 WP_001059744.1.54764 WP_001059744.1.55008 WP_001059744.1.55152 WP_001059744.1.55156 WP_001059744.1.5517 WP_001059744.1.55285 WP_001059744.1.55475 WP_001059744.1.55623 WP_001059744.1.55647 WP_001059744.1.55706 WP_001059744.1.55743 WP_001059744.1.55768 WP_001059744.1.55782 WP_001059744.1.55796 WP_001059744.1.56002 WP_001059744.1.56012 WP_001059744.1.56097 WP_001059744.1.56105 WP_001059744.1.56238 WP_001059744.1.56247 WP_001059744.1.56303 WP_001059744.1.56304 WP_001059744.1.56370 WP_001059744.1.56393 WP_001059744.1.56414 WP_001059744.1.56438 WP_001059744.1.56560 WP_001059744.1.56597 WP_001059744.1.56601 WP_001059744.1.56614 WP_001059744.1.56671 WP_001059744.1.56682 WP_001059744.1.56875 WP_001059744.1.56877 WP_001059744.1.57125 WP_001059744.1.57149 WP_001059744.1.57168 WP_001059744.1.57187 WP_001059744.1.57357 WP_001059744.1.57377 WP_001059744.1.57418 WP_001059744.1.57433 WP_001059744.1.57510 WP_001059744.1.57515 WP_001059744.1.57529 WP_001059744.1.57576 WP_001059744.1.57601 WP_001059744.1.57607 WP_001059744.1.57763 WP_001059744.1.57781 WP_001059744.1.57862 WP_001059744.1.57890 WP_001059744.1.57891 WP_001059744.1.57978 WP_001059744.1.5801 WP_001059744.1.58041 WP_001059744.1.58249 WP_001059744.1.58301 WP_001059744.1.58418 WP_001059744.1.58548 WP_001059744.1.58564 WP_001059744.1.5858 WP_001059744.1.58662 WP_001059744.1.58669 WP_001059744.1.5878 WP_001059744.1.58803 WP_001059744.1.5886 WP_001059744.1.59084 WP_001059744.1.59094 WP_001059744.1.59224 WP_001059744.1.59236 WP_001059744.1.59375 WP_001059744.1.59439 WP_001059744.1.59458 WP_001059744.1.59490 WP_001059744.1.59508 WP_001059744.1.59562 WP_001059744.1.59684 WP_001059744.1.59694 WP_001059744.1.59771 WP_001059744.1.5979 WP_001059744.1.59928 WP_001059744.1.59953 WP_001059744.1.60008 WP_001059744.1.60021 WP_001059744.1.60069 WP_001059744.1.60140 WP_001059744.1.60155 WP_001059744.1.60226 WP_001059744.1.60285 WP_001059744.1.60379 WP_001059744.1.60464 WP_001059744.1.6052 WP_001059744.1.60746 WP_001059744.1.60838 WP_001059744.1.60855 WP_001059744.1.60874 WP_001059744.1.60941 WP_001059744.1.61078 WP_001059744.1.6114 WP_001059744.1.61201 WP_001059744.1.61232 WP_001059744.1.61233 WP_001059744.1.6129 WP_001059744.1.61296 WP_001059744.1.61345 WP_001059744.1.61417 WP_001059744.1.61434 WP_001059744.1.61574 WP_001059744.1.61609 WP_001059744.1.61712 WP_001059744.1.61714 WP_001059744.1.61730 WP_001059744.1.61857 WP_001059744.1.61918 WP_001059744.1.61924 WP_001059744.1.61952 WP_001059744.1.62007 WP_001059744.1.62025 WP_001059744.1.6210 WP_001059744.1.62204 WP_001059744.1.62219 WP_001059744.1.62241 WP_001059744.1.62304 WP_001059744.1.62364 WP_001059744.1.62374 WP_001059744.1.62403 WP_001059744.1.62488 WP_001059744.1.62504 WP_001059744.1.6253 WP_001059744.1.62798 WP_001059744.1.62903 WP_001059744.1.62910 WP_001059744.1.62955 WP_001059744.1.63043 WP_001059744.1.63118 WP_001059744.1.63135 WP_001059744.1.63181 WP_001059744.1.63203 WP_001059744.1.63234 WP_001059744.1.63250 WP_001059744.1.63256 WP_001059744.1.63290 WP_001059744.1.63382 WP_001059744.1.63432 WP_001059744.1.63479 WP_001059744.1.63532 WP_001059744.1.63577 WP_001059744.1.63664 WP_001059744.1.63718 WP_001059744.1.6375 WP_001059744.1.63757 WP_001059744.1.63766 WP_001059744.1.63824 WP_001059744.1.63834 WP_001059744.1.63992 WP_001059744.1.64046 WP_001059744.1.64217 WP_001059744.1.6423 WP_001059744.1.64242 WP_001059744.1.64244 WP_001059744.1.64374 WP_001059744.1.64403 WP_001059744.1.64569 WP_001059744.1.64649 WP_001059744.1.64702 WP_001059744.1.64757 WP_001059744.1.64781 WP_001059744.1.64831 WP_001059744.1.6489 WP_001059744.1.64920 WP_001059744.1.65018 WP_001059744.1.65022 WP_001059744.1.65028 WP_001059744.1.65171 WP_001059744.1.65248 WP_001059744.1.6535 WP_001059744.1.65474 WP_001059744.1.65558 WP_001059744.1.6560 WP_001059744.1.65633 WP_001059744.1.6565 WP_001059744.1.65696 WP_001059744.1.6575 WP_001059744.1.65782 WP_001059744.1.65790 WP_001059744.1.65838 WP_001059744.1.66167 WP_001059744.1.6630 WP_001059744.1.66314 WP_001059744.1.66358 WP_001059744.1.66362 WP_001059744.1.6638 WP_001059744.1.6640 WP_001059744.1.66462 WP_001059744.1.66492 WP_001059744.1.66534 WP_001059744.1.66600 WP_001059744.1.66630 WP_001059744.1.66698 WP_001059744.1.66820 WP_001059744.1.66824 WP_001059744.1.66834 WP_001059744.1.66901 WP_001059744.1.66962 WP_001059744.1.67037 WP_001059744.1.67045 WP_001059744.1.67181 WP_001059744.1.67184 WP_001059744.1.67268 WP_001059744.1.67347 WP_001059744.1.67374 WP_001059744.1.67465 WP_001059744.1.67552 WP_001059744.1.67682 WP_001059744.1.67829 WP_001059744.1.67887 WP_001059744.1.67905 WP_001059744.1.67942 WP_001059744.1.68036 WP_001059744.1.68073 WP_001059744.1.68075 WP_001059744.1.68201 WP_001059744.1.68206 WP_001059744.1.6827 WP_001059744.1.68275 WP_001059744.1.6833 WP_001059744.1.6849 WP_001059744.1.68547 WP_001059744.1.68589 WP_001059744.1.68655 WP_001059744.1.68656 WP_001059744.1.6869 WP_001059744.1.68778 WP_001059744.1.68787 WP_001059744.1.68818 WP_001059744.1.68894 WP_001059744.1.68928 WP_001059744.1.68975 WP_001059744.1.69006 WP_001059744.1.69011 WP_001059744.1.6913 WP_001059744.1.69146 WP_001059744.1.69255 WP_001059744.1.69288 WP_001059744.1.69296 WP_001059744.1.69397 WP_001059744.1.69564 WP_001059744.1.69644 WP_001059744.1.69704 WP_001059744.1.7014 WP_001059744.1.7016 WP_001059744.1.7021 WP_001059744.1.70241 WP_001059744.1.70269 WP_001059744.1.70289 WP_001059744.1.70326 WP_001059744.1.70447 WP_001059744.1.70488 WP_001059744.1.70523 WP_001059744.1.70547 WP_001059744.1.70580 WP_001059744.1.70643 WP_001059744.1.70683 WP_001059744.1.70883 WP_001059744.1.70922 WP_001059744.1.70948 WP_001059744.1.71116 WP_001059744.1.71146 WP_001059744.1.71165 WP_001059744.1.71188 WP_001059744.1.71202 WP_001059744.1.71243 WP_001059744.1.71299 WP_001059744.1.71306 WP_001059744.1.71337 WP_001059744.1.71378 WP_001059744.1.71401 WP_001059744.1.71481 WP_001059744.1.71702 WP_001059744.1.71750 WP_001059744.1.71845 WP_001059744.1.71881 WP_001059744.1.71908 WP_001059744.1.71952 WP_001059744.1.71973 WP_001059744.1.72065 WP_001059744.1.72105 WP_001059744.1.72203 WP_001059744.1.72376 WP_001059744.1.72412 WP_001059744.1.72594 WP_001059744.1.72850 WP_001059744.1.72871 WP_001059744.1.72975 WP_001059744.1.73144 WP_001059744.1.7315 WP_001059744.1.7316 WP_001059744.1.73200 WP_001059744.1.7334 WP_001059744.1.73362 WP_001059744.1.73377 WP_001059744.1.73379 WP_001059744.1.73481 WP_001059744.1.7356 WP_001059744.1.73561 WP_001059744.1.73581 WP_001059744.1.73617 WP_001059744.1.73753 WP_001059744.1.73758 WP_001059744.1.73794 WP_001059744.1.7387 WP_001059744.1.73924 WP_001059744.1.74029 WP_001059744.1.74181 WP_001059744.1.74191 WP_001059744.1.7433 WP_001059744.1.74379 WP_001059744.1.74410 WP_001059744.1.7444 WP_001059744.1.74466 WP_001059744.1.74500 WP_001059744.1.74529 WP_001059744.1.74545 WP_001059744.1.74745 WP_001059744.1.74996 WP_001059744.1.75129 WP_001059744.1.75187 WP_001059744.1.75288 WP_001059744.1.75334 WP_001059744.1.75362 WP_001059744.1.75385 WP_001059744.1.75392 WP_001059744.1.7543 WP_001059744.1.75494 WP_001059744.1.75585 WP_001059744.1.75626 WP_001059744.1.75760 WP_001059744.1.75764 WP_001059744.1.75793 WP_001059744.1.75828 WP_001059744.1.75837 WP_001059744.1.75874 WP_001059744.1.75932 WP_001059744.1.75945 WP_001059744.1.76020 WP_001059744.1.76208 WP_001059744.1.76252 WP_001059744.1.7634 WP_001059744.1.76434 WP_001059744.1.76445 WP_001059744.1.7660 WP_001059744.1.76673 WP_001059744.1.76706 WP_001059744.1.76721 WP_001059744.1.76738 WP_001059744.1.76756 WP_001059744.1.76760 WP_001059744.1.76875 WP_001059744.1.76880 WP_001059744.1.76899 WP_001059744.1.77038 WP_001059744.1.77047 WP_001059744.1.77080 WP_001059744.1.7712 WP_001059744.1.77180 WP_001059744.1.77244 WP_001059744.1.77292 WP_001059744.1.77313 WP_001059744.1.77349 WP_001059744.1.77414 WP_001059744.1.77514 WP_001059744.1.77529 WP_001059744.1.77543 WP_001059744.1.77549 WP_001059744.1.77575 WP_001059744.1.77646 WP_001059744.1.77692 WP_001059744.1.7782 WP_001059744.1.77851 WP_001059744.1.77898 WP_001059744.1.77918 WP_001059744.1.77960 WP_001059744.1.78033 WP_001059744.1.78076 WP_001059744.1.78096 WP_001059744.1.78100 WP_001059744.1.78110 WP_001059744.1.78120 WP_001059744.1.78383 WP_001059744.1.78407 WP_001059744.1.78602 WP_001059744.1.7861 WP_001059744.1.78618 WP_001059744.1.78673 WP_001059744.1.78735 WP_001059744.1.78802 WP_001059744.1.78830 WP_001059744.1.78835 WP_001059744.1.78874 WP_001059744.1.78918 WP_001059744.1.78930 WP_001059744.1.79151 WP_001059744.1.79167 WP_001059744.1.79297 WP_001059744.1.79335 WP_001059744.1.79462 WP_001059744.1.79472 WP_001059744.1.79490 WP_001059744.1.79495 WP_001059744.1.79529 WP_001059744.1.79570 WP_001059744.1.7964 WP_001059744.1.79659 WP_001059744.1.79668 WP_001059744.1.79708 WP_001059744.1.79845 WP_001059744.1.79892 WP_001059744.1.80077 WP_001059744.1.80137 WP_001059744.1.80182 WP_001059744.1.80296 WP_001059744.1.80366 WP_001059744.1.80827 WP_001059744.1.80831 WP_001059744.1.80850 WP_001059744.1.80881 WP_001059744.1.80939 WP_001059744.1.8096 WP_001059744.1.81037 WP_001059744.1.81069 WP_001059744.1.81149 WP_001059744.1.81175 WP_001059744.1.8119 WP_001059744.1.81193 WP_001059744.1.81354 WP_001059744.1.81425 WP_001059744.1.81667 WP_001059744.1.81750 WP_001059744.1.81785 WP_001059744.1.81902 WP_001059744.1.81965 WP_001059744.1.81974 WP_001059744.1.82144 WP_001059744.1.82337 WP_001059744.1.82479 WP_001059744.1.82503 WP_001059744.1.82515 WP_001059744.1.82529 WP_001059744.1.82676 WP_001059744.1.82761 WP_001059744.1.8282 WP_001059744.1.82843 WP_001059744.1.82895 WP_001059744.1.82908 WP_001059744.1.82937 WP_001059744.1.82944 WP_001059744.1.82956 WP_001059744.1.82992 WP_001059744.1.83061 WP_001059744.1.83092 WP_001059744.1.83139 WP_001059744.1.83163 WP_001059744.1.83301 WP_001059744.1.83305 WP_001059744.1.83413 WP_001059744.1.83491 WP_001059744.1.83523 WP_001059744.1.8354 WP_001059744.1.83598 WP_001059744.1.83651 WP_001059744.1.83721 WP_001059744.1.83739 WP_001059744.1.83759 WP_001059744.1.83760 WP_001059744.1.83995 WP_001059744.1.84031 WP_001059744.1.84103 WP_001059744.1.84179 WP_001059744.1.84283 WP_001059744.1.84392 WP_001059744.1.8441 WP_001059744.1.84532 WP_001059744.1.84554 WP_001059744.1.84659 WP_001059744.1.84899 WP_001059744.1.8497 WP_001059744.1.85014 WP_001059744.1.85040 WP_001059744.1.85120 WP_001059744.1.85134 WP_001059744.1.85147 WP_001059744.1.85178 WP_001059744.1.85180 WP_001059744.1.85190 WP_001059744.1.8533 WP_001059744.1.85481 WP_001059744.1.85483 WP_001059744.1.8552 WP_001059744.1.8556 WP_001059744.1.85615 WP_001059744.1.85617 WP_001059744.1.85654 WP_001059744.1.85663 WP_001059744.1.85671 WP_001059744.1.85672 WP_001059744.1.85777 WP_001059744.1.85886 WP_001059744.1.85900 WP_001059744.1.85904 WP_001059744.1.85976 WP_001059744.1.86017 WP_001059744.1.86126 WP_001059744.1.86306 WP_001059744.1.86356 WP_001059744.1.86450 WP_001059744.1.86469 WP_001059744.1.86580 WP_001059744.1.86588 WP_001059744.1.86634 WP_001059744.1.86661 WP_001059744.1.8672 WP_001059744.1.8678 WP_001059744.1.86810 WP_001059744.1.8684 WP_001059744.1.86895 WP_001059744.1.86906 WP_001059744.1.86982 WP_001059744.1.87095 WP_001059744.1.87143 WP_001059744.1.87283 WP_001059744.1.87323 WP_001059744.1.8736 WP_001059744.1.87460 WP_001059744.1.87493 WP_001059744.1.87552 WP_001059744.1.87618 WP_001059744.1.87779 WP_001059744.1.87945 WP_001059744.1.88019 WP_001059744.1.88073 WP_001059744.1.8809 WP_001059744.1.88244 WP_001059744.1.88291 WP_001059744.1.88293 WP_001059744.1.8837 WP_001059744.1.88393 WP_001059744.1.88624 WP_001059744.1.88703 WP_001059744.1.88792 WP_001059744.1.88902 WP_001059744.1.8891 WP_001059744.1.88942 WP_001059744.1.88981 WP_001059744.1.89008 WP_001059744.1.89116 WP_001059744.1.89138 WP_001059744.1.89304 WP_001059744.1.89512 WP_001059744.1.89527 WP_001059744.1.89570 WP_001059744.1.89604 WP_001059744.1.89622 WP_001059744.1.89815 WP_001059744.1.89902 WP_001059744.1.8996 WP_001059744.1.89975 WP_001059744.1.9002 WP_001059744.1.90084 WP_001059744.1.90248 WP_001059744.1.90252 WP_001059744.1.90417 WP_001059744.1.90453 WP_001059744.1.90458 WP_001059744.1.90557 WP_001059744.1.90641 WP_001059744.1.90686 WP_001059744.1.90734 WP_001059744.1.90866 WP_001059744.1.91003 WP_001059744.1.91049 WP_001059744.1.91278 WP_001059744.1.91512 WP_001059744.1.91524 WP_001059744.1.91564 WP_001059744.1.91628 WP_001059744.1.91655 WP_001059744.1.91724 WP_001059744.1.91732 WP_001059744.1.91788 WP_001059744.1.91806 WP_001059744.1.91914 WP_001059744.1.92013 WP_001059744.1.92047 WP_001059744.1.92093 WP_001059744.1.92108 WP_001059744.1.92183 WP_001059744.1.92208 WP_001059744.1.92268 WP_001059744.1.92310 WP_001059744.1.92318 WP_001059744.1.92375 WP_001059744.1.92439 WP_001059744.1.92443 WP_001059744.1.92482 WP_001059744.1.92529 WP_001059744.1.9253 WP_001059744.1.92531 WP_001059744.1.92671 WP_001059744.1.92738 WP_001059744.1.92988 WP_001059744.1.93086 WP_001059744.1.93101 WP_001059744.1.93136 WP_001059744.1.93155 WP_001059744.1.93365 WP_001059744.1.93543 WP_001059744.1.93596 WP_001059744.1.93650 WP_001059744.1.93656 WP_001059744.1.93662 WP_001059744.1.937 WP_001059744.1.93705 WP_001059744.1.93761 WP_001059744.1.93803 WP_001059744.1.93804 WP_001059744.1.9389 WP_001059744.1.93956 WP_001059744.1.93994 WP_001059744.1.94072 WP_001059744.1.94132 WP_001059744.1.94162 WP_001059744.1.94168 WP_001059744.1.94198 WP_001059744.1.9432 WP_001059744.1.94354 WP_001059744.1.94380 WP_001059744.1.94458 WP_001059744.1.94565 WP_001059744.1.94584 WP_001059744.1.94588 WP_001059744.1.94674 WP_001059744.1.94796 WP_001059744.1.94959 WP_001059744.1.95051 WP_001059744.1.95085 WP_001059744.1.95121 WP_001059744.1.9516 WP_001059744.1.95282 WP_001059744.1.95546 WP_001059744.1.95579 WP_001059744.1.95630 WP_001059744.1.95641 WP_001059744.1.95911 WP_001059744.1.95940 WP_001059744.1.96139 WP_001059744.1.96317 WP_001059744.1.96343 WP_001059744.1.9644 WP_001059744.1.96469 WP_001059744.1.96497 WP_001059744.1.96500 WP_001059744.1.96555 WP_001059744.1.96563 WP_001059744.1.96590 WP_001059744.1.96732 WP_001059744.1.96771 WP_001059744.1.96798 WP_001059744.1.96917 WP_001059744.1.97015 WP_001059744.1.97145 WP_001059744.1.97190 WP_001059744.1.97318 WP_001059744.1.97337 WP_001059744.1.97369 WP_001059744.1.97594 WP_001059744.1.97597 WP_001059744.1.97613 WP_001059744.1.97620 WP_001059744.1.97727 WP_001059744.1.97732 WP_001059744.1.97736 WP_001059744.1.9775 WP_001059744.1.97772 WP_001059744.1.97846 WP_001059744.1.97873 WP_001059744.1.98006 WP_001059744.1.98019 WP_001059744.1.98022 WP_001059744.1.98110 WP_001059744.1.98146 WP_001059744.1.98219 WP_001059744.1.98250 WP_001059744.1.98314 WP_001059744.1.9841 WP_001059744.1.98495 WP_001059744.1.98513 WP_001059744.1.98531 WP_001059744.1.98577 WP_001059744.1.98676 WP_001059744.1.98677 WP_001059744.1.98760 WP_001059744.1.98843 WP_001059744.1.9898 WP_001059744.1.99072 WP_001059744.1.99098 WP_001059744.1.99184 WP_001059744.1.9919 WP_001059744.1.99198 WP_001059744.1.99267 WP_001059744.1.99276 WP_001059744.1.9954 WP_001059744.1.99646 WP_001059744.1.99657 WP_001059744.1.99660 WP_001059744.1.99712 WP_001059744.1.99725 WP_001059744.1.99783 WP_001059744.1.99813 WP_001059744.1.99858 WP_001059744.1.99889 WP_001059744.1.99958 gi|549726564|ref|YP_008646754.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]