SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482906652|ref|YP_007905212.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482906652|ref|YP_007905212.1|
Domain Number 1 Region: 5-381
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.09e-117
Family Cystathionine synthase-like 0.00000000000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|482906652|ref|YP_007905212.1|
Sequence length 386
Comment cystathionine gamma-synthase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLATRGCYRVR
FVDQGDERALQAALEEKPKLVLVESPSNPLLRVVDIAKICRLAREAGAVSVVDNTFLSPA
LQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPEVVTELAWWANNIGVTGGAFDSYL
LLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAARQQKGFGAML
SFELDGDEETLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMSPQARASAGISETLL
RISTGIEDGEDLIADLENGFRAANKG
Download sequence
Identical sequences A0A0D6IR51 A0A0F7JDW5 A0A0H3BS47 A0A0H3NK50 A0A0R9N285 A0A0U1JVW1 A0A0W3SPT8 A0A249V4C4 A0A2D3AJ25 A0A2H9YF64 G5NKX9 Q57HB5 Q8ZKN5
gi|482906652|ref|YP_007905212.1| gi|16767366|ref|NP_462981.1| 321314.SC3991 423368.SNSL254_A4431 99287.STM4100 gi|378701958|ref|YP_005183916.1| gi|525839896|ref|YP_008257299.1| gi|526218088|ref|YP_008263168.1| gi|378447437|ref|YP_005235069.1| gi|550903460|ref|YP_008672552.1| gi|378991382|ref|YP_005254546.1| gi|194444188|ref|YP_002043364.1| NP_462981.1.58477 WP_000197217.1.100010 WP_000197217.1.100234 WP_000197217.1.100258 WP_000197217.1.100376 WP_000197217.1.100424 WP_000197217.1.100436 WP_000197217.1.100484 WP_000197217.1.100488 WP_000197217.1.100502 WP_000197217.1.100597 WP_000197217.1.100711 WP_000197217.1.10076 WP_000197217.1.100781 WP_000197217.1.100793 WP_000197217.1.100869 WP_000197217.1.100871 WP_000197217.1.100882 WP_000197217.1.101007 WP_000197217.1.101020 WP_000197217.1.101074 WP_000197217.1.101078 WP_000197217.1.101180 WP_000197217.1.101259 WP_000197217.1.101284 WP_000197217.1.101291 WP_000197217.1.101320 WP_000197217.1.101353 WP_000197217.1.101386 WP_000197217.1.101404 WP_000197217.1.101420 WP_000197217.1.101589 WP_000197217.1.101707 WP_000197217.1.101734 WP_000197217.1.101878 WP_000197217.1.101953 WP_000197217.1.10220 WP_000197217.1.10266 WP_000197217.1.10429 WP_000197217.1.10439 WP_000197217.1.10675 WP_000197217.1.10678 WP_000197217.1.10753 WP_000197217.1.10992 WP_000197217.1.11000 WP_000197217.1.11024 WP_000197217.1.11031 WP_000197217.1.11098 WP_000197217.1.11168 WP_000197217.1.11190 WP_000197217.1.11295 WP_000197217.1.11455 WP_000197217.1.11458 WP_000197217.1.11518 WP_000197217.1.11532 WP_000197217.1.11543 WP_000197217.1.11763 WP_000197217.1.11772 WP_000197217.1.11897 WP_000197217.1.12025 WP_000197217.1.12114 WP_000197217.1.12351 WP_000197217.1.12370 WP_000197217.1.12546 WP_000197217.1.1264 WP_000197217.1.12728 WP_000197217.1.12879 WP_000197217.1.12936 WP_000197217.1.12995 WP_000197217.1.13027 WP_000197217.1.13106 WP_000197217.1.13130 WP_000197217.1.1326 WP_000197217.1.13334 WP_000197217.1.13414 WP_000197217.1.13488 WP_000197217.1.13509 WP_000197217.1.13669 WP_000197217.1.13741 WP_000197217.1.13908 WP_000197217.1.13932 WP_000197217.1.13968 WP_000197217.1.14001 WP_000197217.1.14151 WP_000197217.1.14239 WP_000197217.1.14320 WP_000197217.1.14379 WP_000197217.1.14406 WP_000197217.1.14410 WP_000197217.1.14466 WP_000197217.1.14524 WP_000197217.1.14554 WP_000197217.1.14725 WP_000197217.1.14852 WP_000197217.1.1489 WP_000197217.1.14932 WP_000197217.1.15055 WP_000197217.1.15124 WP_000197217.1.15223 WP_000197217.1.15226 WP_000197217.1.15316 WP_000197217.1.15369 WP_000197217.1.1540 WP_000197217.1.15483 WP_000197217.1.15508 WP_000197217.1.15625 WP_000197217.1.15637 WP_000197217.1.15708 WP_000197217.1.15784 WP_000197217.1.15830 WP_000197217.1.16062 WP_000197217.1.16063 WP_000197217.1.16103 WP_000197217.1.16226 WP_000197217.1.16233 WP_000197217.1.16284 WP_000197217.1.16328 WP_000197217.1.16331 WP_000197217.1.1635 WP_000197217.1.16468 WP_000197217.1.16614 WP_000197217.1.16650 WP_000197217.1.16686 WP_000197217.1.16691 WP_000197217.1.167 WP_000197217.1.16732 WP_000197217.1.16735 WP_000197217.1.16786 WP_000197217.1.16858 WP_000197217.1.16896 WP_000197217.1.16941 WP_000197217.1.16965 WP_000197217.1.1700 WP_000197217.1.17285 WP_000197217.1.17307 WP_000197217.1.174 WP_000197217.1.17447 WP_000197217.1.17480 WP_000197217.1.17546 WP_000197217.1.17702 WP_000197217.1.17705 WP_000197217.1.17747 WP_000197217.1.17758 WP_000197217.1.17991 WP_000197217.1.18019 WP_000197217.1.18111 WP_000197217.1.18163 WP_000197217.1.18265 WP_000197217.1.18267 WP_000197217.1.18281 WP_000197217.1.18282 WP_000197217.1.18468 WP_000197217.1.18607 WP_000197217.1.18692 WP_000197217.1.18705 WP_000197217.1.18715 WP_000197217.1.18776 WP_000197217.1.18822 WP_000197217.1.18881 WP_000197217.1.18940 WP_000197217.1.18949 WP_000197217.1.1897 WP_000197217.1.19053 WP_000197217.1.19320 WP_000197217.1.19458 WP_000197217.1.19460 WP_000197217.1.19461 WP_000197217.1.19614 WP_000197217.1.19642 WP_000197217.1.19702 WP_000197217.1.19706 WP_000197217.1.19724 WP_000197217.1.19749 WP_000197217.1.19784 WP_000197217.1.19802 WP_000197217.1.19809 WP_000197217.1.19867 WP_000197217.1.1998 WP_000197217.1.20 WP_000197217.1.2010 WP_000197217.1.20212 WP_000197217.1.20266 WP_000197217.1.20271 WP_000197217.1.20330 WP_000197217.1.20362 WP_000197217.1.20391 WP_000197217.1.20418 WP_000197217.1.20425 WP_000197217.1.20443 WP_000197217.1.20525 WP_000197217.1.2054 WP_000197217.1.20553 WP_000197217.1.20626 WP_000197217.1.20646 WP_000197217.1.20695 WP_000197217.1.20886 WP_000197217.1.20908 WP_000197217.1.21049 WP_000197217.1.21146 WP_000197217.1.21245 WP_000197217.1.21246 WP_000197217.1.21269 WP_000197217.1.21400 WP_000197217.1.21497 WP_000197217.1.21499 WP_000197217.1.21548 WP_000197217.1.21603 WP_000197217.1.21751 WP_000197217.1.21757 WP_000197217.1.21792 WP_000197217.1.22024 WP_000197217.1.2205 WP_000197217.1.22062 WP_000197217.1.22067 WP_000197217.1.2221 WP_000197217.1.22270 WP_000197217.1.2235 WP_000197217.1.22379 WP_000197217.1.22427 WP_000197217.1.2246 WP_000197217.1.22485 WP_000197217.1.22514 WP_000197217.1.22537 WP_000197217.1.22620 WP_000197217.1.22870 WP_000197217.1.22979 WP_000197217.1.23102 WP_000197217.1.23114 WP_000197217.1.2314 WP_000197217.1.23155 WP_000197217.1.23192 WP_000197217.1.23259 WP_000197217.1.23460 WP_000197217.1.23472 WP_000197217.1.23482 WP_000197217.1.23634 WP_000197217.1.2364 WP_000197217.1.23736 WP_000197217.1.23932 WP_000197217.1.24017 WP_000197217.1.24206 WP_000197217.1.24308 WP_000197217.1.24419 WP_000197217.1.24578 WP_000197217.1.24737 WP_000197217.1.24779 WP_000197217.1.25008 WP_000197217.1.25015 WP_000197217.1.25206 WP_000197217.1.25405 WP_000197217.1.25454 WP_000197217.1.25493 WP_000197217.1.25668 WP_000197217.1.25690 WP_000197217.1.2570 WP_000197217.1.25740 WP_000197217.1.25814 WP_000197217.1.25988 WP_000197217.1.26269 WP_000197217.1.26282 WP_000197217.1.26311 WP_000197217.1.26319 WP_000197217.1.26363 WP_000197217.1.26426 WP_000197217.1.26429 WP_000197217.1.26440 WP_000197217.1.26493 WP_000197217.1.26551 WP_000197217.1.26567 WP_000197217.1.26582 WP_000197217.1.27010 WP_000197217.1.27173 WP_000197217.1.27206 WP_000197217.1.27419 WP_000197217.1.27423 WP_000197217.1.27561 WP_000197217.1.2763 WP_000197217.1.27665 WP_000197217.1.27707 WP_000197217.1.27761 WP_000197217.1.2777 WP_000197217.1.27857 WP_000197217.1.27977 WP_000197217.1.28094 WP_000197217.1.28126 WP_000197217.1.28170 WP_000197217.1.28302 WP_000197217.1.2835 WP_000197217.1.28370 WP_000197217.1.28538 WP_000197217.1.28575 WP_000197217.1.28612 WP_000197217.1.28625 WP_000197217.1.28655 WP_000197217.1.28694 WP_000197217.1.2879 WP_000197217.1.2890 WP_000197217.1.28938 WP_000197217.1.28946 WP_000197217.1.29006 WP_000197217.1.29010 WP_000197217.1.2910 WP_000197217.1.29588 WP_000197217.1.29601 WP_000197217.1.29606 WP_000197217.1.29615 WP_000197217.1.29619 WP_000197217.1.29704 WP_000197217.1.29969 WP_000197217.1.30006 WP_000197217.1.30027 WP_000197217.1.30180 WP_000197217.1.30469 WP_000197217.1.30505 WP_000197217.1.30507 WP_000197217.1.30535 WP_000197217.1.30547 WP_000197217.1.30794 WP_000197217.1.30833 WP_000197217.1.30835 WP_000197217.1.30909 WP_000197217.1.30972 WP_000197217.1.31 WP_000197217.1.3113 WP_000197217.1.31185 WP_000197217.1.3119 WP_000197217.1.31190 WP_000197217.1.31195 WP_000197217.1.31196 WP_000197217.1.31210 WP_000197217.1.31219 WP_000197217.1.31281 WP_000197217.1.31362 WP_000197217.1.31476 WP_000197217.1.31504 WP_000197217.1.31515 WP_000197217.1.31578 WP_000197217.1.31658 WP_000197217.1.31940 WP_000197217.1.31967 WP_000197217.1.31972 WP_000197217.1.32192 WP_000197217.1.32206 WP_000197217.1.32438 WP_000197217.1.32493 WP_000197217.1.32515 WP_000197217.1.32527 WP_000197217.1.32660 WP_000197217.1.32702 WP_000197217.1.32714 WP_000197217.1.32786 WP_000197217.1.32804 WP_000197217.1.32860 WP_000197217.1.32907 WP_000197217.1.33030 WP_000197217.1.33127 WP_000197217.1.33143 WP_000197217.1.33248 WP_000197217.1.33261 WP_000197217.1.333 WP_000197217.1.33492 WP_000197217.1.33553 WP_000197217.1.33592 WP_000197217.1.33894 WP_000197217.1.34043 WP_000197217.1.34075 WP_000197217.1.34257 WP_000197217.1.34279 WP_000197217.1.34319 WP_000197217.1.34453 WP_000197217.1.34610 WP_000197217.1.34856 WP_000197217.1.34975 WP_000197217.1.34977 WP_000197217.1.35045 WP_000197217.1.35129 WP_000197217.1.35184 WP_000197217.1.35404 WP_000197217.1.35408 WP_000197217.1.35425 WP_000197217.1.35429 WP_000197217.1.35446 WP_000197217.1.35463 WP_000197217.1.35503 WP_000197217.1.35509 WP_000197217.1.35590 WP_000197217.1.35940 WP_000197217.1.36003 WP_000197217.1.3601 WP_000197217.1.36157 WP_000197217.1.36609 WP_000197217.1.36690 WP_000197217.1.3670 WP_000197217.1.36705 WP_000197217.1.36918 WP_000197217.1.36931 WP_000197217.1.36948 WP_000197217.1.37073 WP_000197217.1.37111 WP_000197217.1.37112 WP_000197217.1.37256 WP_000197217.1.37293 WP_000197217.1.37370 WP_000197217.1.37376 WP_000197217.1.3744 WP_000197217.1.37498 WP_000197217.1.37504 WP_000197217.1.37558 WP_000197217.1.37618 WP_000197217.1.37687 WP_000197217.1.37968 WP_000197217.1.37978 WP_000197217.1.38125 WP_000197217.1.38145 WP_000197217.1.38199 WP_000197217.1.383 WP_000197217.1.3848 WP_000197217.1.38613 WP_000197217.1.38673 WP_000197217.1.3869 WP_000197217.1.38693 WP_000197217.1.38882 WP_000197217.1.38913 WP_000197217.1.38942 WP_000197217.1.39003 WP_000197217.1.39136 WP_000197217.1.39197 WP_000197217.1.39229 WP_000197217.1.39405 WP_000197217.1.39420 WP_000197217.1.39449 WP_000197217.1.39512 WP_000197217.1.39556 WP_000197217.1.39629 WP_000197217.1.39763 WP_000197217.1.39862 WP_000197217.1.39921 WP_000197217.1.39923 WP_000197217.1.40017 WP_000197217.1.40072 WP_000197217.1.40073 WP_000197217.1.4011 WP_000197217.1.40208 WP_000197217.1.40240 WP_000197217.1.40257 WP_000197217.1.40292 WP_000197217.1.40305 WP_000197217.1.40311 WP_000197217.1.40380 WP_000197217.1.40395 WP_000197217.1.40465 WP_000197217.1.40710 WP_000197217.1.4075 WP_000197217.1.4087 WP_000197217.1.40877 WP_000197217.1.41017 WP_000197217.1.41086 WP_000197217.1.41091 WP_000197217.1.41226 WP_000197217.1.41279 WP_000197217.1.41516 WP_000197217.1.41554 WP_000197217.1.41572 WP_000197217.1.41591 WP_000197217.1.41662 WP_000197217.1.41708 WP_000197217.1.41761 WP_000197217.1.41859 WP_000197217.1.41882 WP_000197217.1.41979 WP_000197217.1.41985 WP_000197217.1.42104 WP_000197217.1.42320 WP_000197217.1.42342 WP_000197217.1.42422 WP_000197217.1.4276 WP_000197217.1.42797 WP_000197217.1.42829 WP_000197217.1.42864 WP_000197217.1.4288 WP_000197217.1.42887 WP_000197217.1.43018 WP_000197217.1.43041 WP_000197217.1.43244 WP_000197217.1.43312 WP_000197217.1.43334 WP_000197217.1.43351 WP_000197217.1.43437 WP_000197217.1.43522 WP_000197217.1.43613 WP_000197217.1.43668 WP_000197217.1.43875 WP_000197217.1.43886 WP_000197217.1.44005 WP_000197217.1.44043 WP_000197217.1.4405 WP_000197217.1.44099 WP_000197217.1.44121 WP_000197217.1.44291 WP_000197217.1.44310 WP_000197217.1.44386 WP_000197217.1.44440 WP_000197217.1.44640 WP_000197217.1.4467 WP_000197217.1.44747 WP_000197217.1.44781 WP_000197217.1.4485 WP_000197217.1.44877 WP_000197217.1.44927 WP_000197217.1.44943 WP_000197217.1.44971 WP_000197217.1.45067 WP_000197217.1.45074 WP_000197217.1.45079 WP_000197217.1.45098 WP_000197217.1.45177 WP_000197217.1.45184 WP_000197217.1.45259 WP_000197217.1.45344 WP_000197217.1.45349 WP_000197217.1.45365 WP_000197217.1.45550 WP_000197217.1.45585 WP_000197217.1.45660 WP_000197217.1.45690 WP_000197217.1.45797 WP_000197217.1.458 WP_000197217.1.46011 WP_000197217.1.46069 WP_000197217.1.46112 WP_000197217.1.46173 WP_000197217.1.46174 WP_000197217.1.46187 WP_000197217.1.46250 WP_000197217.1.46303 WP_000197217.1.46595 WP_000197217.1.46675 WP_000197217.1.46730 WP_000197217.1.46803 WP_000197217.1.46930 WP_000197217.1.46961 WP_000197217.1.47057 WP_000197217.1.47214 WP_000197217.1.47429 WP_000197217.1.47448 WP_000197217.1.4747 WP_000197217.1.47472 WP_000197217.1.47478 WP_000197217.1.47621 WP_000197217.1.47799 WP_000197217.1.48242 WP_000197217.1.48253 WP_000197217.1.483 WP_000197217.1.48367 WP_000197217.1.48377 WP_000197217.1.4853 WP_000197217.1.48788 WP_000197217.1.4885 WP_000197217.1.48876 WP_000197217.1.48894 WP_000197217.1.48919 WP_000197217.1.49084 WP_000197217.1.49102 WP_000197217.1.49155 WP_000197217.1.49204 WP_000197217.1.49226 WP_000197217.1.49239 WP_000197217.1.49256 WP_000197217.1.49290 WP_000197217.1.49340 WP_000197217.1.49366 WP_000197217.1.49490 WP_000197217.1.49515 WP_000197217.1.49550 WP_000197217.1.49572 WP_000197217.1.4979 WP_000197217.1.49803 WP_000197217.1.49805 WP_000197217.1.49929 WP_000197217.1.49931 WP_000197217.1.50007 WP_000197217.1.50080 WP_000197217.1.5009 WP_000197217.1.50161 WP_000197217.1.50211 WP_000197217.1.50376 WP_000197217.1.50389 WP_000197217.1.50497 WP_000197217.1.50676 WP_000197217.1.50774 WP_000197217.1.50777 WP_000197217.1.50804 WP_000197217.1.50808 WP_000197217.1.5088 WP_000197217.1.50908 WP_000197217.1.50941 WP_000197217.1.51014 WP_000197217.1.51022 WP_000197217.1.51162 WP_000197217.1.51179 WP_000197217.1.51182 WP_000197217.1.51186 WP_000197217.1.51487 WP_000197217.1.51488 WP_000197217.1.51555 WP_000197217.1.51611 WP_000197217.1.51634 WP_000197217.1.51649 WP_000197217.1.51686 WP_000197217.1.51911 WP_000197217.1.51932 WP_000197217.1.51989 WP_000197217.1.52121 WP_000197217.1.52148 WP_000197217.1.52346 WP_000197217.1.52353 WP_000197217.1.52361 WP_000197217.1.52653 WP_000197217.1.52656 WP_000197217.1.52743 WP_000197217.1.52857 WP_000197217.1.52898 WP_000197217.1.52915 WP_000197217.1.53190 WP_000197217.1.53406 WP_000197217.1.53436 WP_000197217.1.53466 WP_000197217.1.53529 WP_000197217.1.53543 WP_000197217.1.53694 WP_000197217.1.53757 WP_000197217.1.53812 WP_000197217.1.54033 WP_000197217.1.54061 WP_000197217.1.54075 WP_000197217.1.54082 WP_000197217.1.54196 WP_000197217.1.542 WP_000197217.1.54209 WP_000197217.1.54271 WP_000197217.1.54273 WP_000197217.1.54274 WP_000197217.1.54319 WP_000197217.1.54333 WP_000197217.1.54364 WP_000197217.1.54400 WP_000197217.1.54644 WP_000197217.1.54662 WP_000197217.1.54722 WP_000197217.1.54749 WP_000197217.1.54764 WP_000197217.1.55008 WP_000197217.1.55152 WP_000197217.1.55156 WP_000197217.1.5517 WP_000197217.1.55285 WP_000197217.1.55475 WP_000197217.1.55647 WP_000197217.1.55743 WP_000197217.1.55768 WP_000197217.1.55782 WP_000197217.1.55796 WP_000197217.1.55993 WP_000197217.1.56002 WP_000197217.1.56012 WP_000197217.1.56105 WP_000197217.1.56238 WP_000197217.1.56247 WP_000197217.1.56286 WP_000197217.1.56304 WP_000197217.1.56393 WP_000197217.1.56414 WP_000197217.1.56438 WP_000197217.1.56560 WP_000197217.1.56597 WP_000197217.1.56601 WP_000197217.1.56614 WP_000197217.1.56671 WP_000197217.1.56682 WP_000197217.1.56875 WP_000197217.1.56877 WP_000197217.1.57149 WP_000197217.1.57168 WP_000197217.1.57187 WP_000197217.1.57232 WP_000197217.1.57357 WP_000197217.1.57377 WP_000197217.1.57433 WP_000197217.1.57510 WP_000197217.1.57515 WP_000197217.1.57529 WP_000197217.1.57576 WP_000197217.1.57601 WP_000197217.1.57607 WP_000197217.1.57763 WP_000197217.1.57862 WP_000197217.1.57890 WP_000197217.1.57891 WP_000197217.1.57902 WP_000197217.1.57978 WP_000197217.1.5801 WP_000197217.1.58041 WP_000197217.1.58249 WP_000197217.1.58301 WP_000197217.1.58418 WP_000197217.1.5854 WP_000197217.1.58548 WP_000197217.1.5858 WP_000197217.1.58662 WP_000197217.1.58669 WP_000197217.1.58745 WP_000197217.1.58803 WP_000197217.1.5886 WP_000197217.1.59094 WP_000197217.1.59375 WP_000197217.1.59458 WP_000197217.1.59490 WP_000197217.1.59508 WP_000197217.1.5953 WP_000197217.1.59684 WP_000197217.1.59694 WP_000197217.1.59771 WP_000197217.1.5979 WP_000197217.1.59928 WP_000197217.1.59953 WP_000197217.1.60008 WP_000197217.1.60021 WP_000197217.1.60069 WP_000197217.1.60140 WP_000197217.1.60155 WP_000197217.1.60285 WP_000197217.1.60379 WP_000197217.1.60464 WP_000197217.1.60486 WP_000197217.1.60746 WP_000197217.1.60838 WP_000197217.1.60874 WP_000197217.1.60941 WP_000197217.1.61078 WP_000197217.1.6114 WP_000197217.1.61232 WP_000197217.1.61233 WP_000197217.1.6129 WP_000197217.1.61296 WP_000197217.1.61345 WP_000197217.1.61417 WP_000197217.1.61574 WP_000197217.1.61609 WP_000197217.1.61712 WP_000197217.1.61714 WP_000197217.1.61730 WP_000197217.1.61857 WP_000197217.1.61918 WP_000197217.1.61952 WP_000197217.1.62007 WP_000197217.1.62025 WP_000197217.1.6210 WP_000197217.1.62204 WP_000197217.1.62304 WP_000197217.1.62364 WP_000197217.1.62374 WP_000197217.1.62403 WP_000197217.1.6253 WP_000197217.1.62570 WP_000197217.1.62853 WP_000197217.1.62903 WP_000197217.1.62910 WP_000197217.1.62955 WP_000197217.1.63043 WP_000197217.1.63063 WP_000197217.1.63181 WP_000197217.1.63203 WP_000197217.1.63234 WP_000197217.1.63256 WP_000197217.1.63290 WP_000197217.1.63382 WP_000197217.1.63432 WP_000197217.1.63461 WP_000197217.1.63479 WP_000197217.1.63577 WP_000197217.1.63664 WP_000197217.1.63718 WP_000197217.1.6375 WP_000197217.1.63757 WP_000197217.1.63766 WP_000197217.1.63824 WP_000197217.1.63834 WP_000197217.1.63992 WP_000197217.1.64046 WP_000197217.1.6423 WP_000197217.1.64242 WP_000197217.1.64244 WP_000197217.1.64403 WP_000197217.1.64569 WP_000197217.1.64649 WP_000197217.1.64702 WP_000197217.1.64757 WP_000197217.1.64781 WP_000197217.1.64831 WP_000197217.1.6489 WP_000197217.1.65018 WP_000197217.1.65028 WP_000197217.1.65171 WP_000197217.1.65248 WP_000197217.1.6535 WP_000197217.1.65474 WP_000197217.1.65572 WP_000197217.1.65633 WP_000197217.1.6565 WP_000197217.1.65696 WP_000197217.1.6575 WP_000197217.1.65782 WP_000197217.1.65838 WP_000197217.1.66167 WP_000197217.1.6630 WP_000197217.1.66314 WP_000197217.1.66358 WP_000197217.1.66362 WP_000197217.1.6638 WP_000197217.1.6640 WP_000197217.1.66534 WP_000197217.1.66698 WP_000197217.1.6680 WP_000197217.1.66834 WP_000197217.1.66901 WP_000197217.1.66962 WP_000197217.1.67037 WP_000197217.1.67045 WP_000197217.1.67181 WP_000197217.1.67184 WP_000197217.1.67268 WP_000197217.1.67347 WP_000197217.1.67374 WP_000197217.1.67552 WP_000197217.1.67682 WP_000197217.1.67829 WP_000197217.1.67887 WP_000197217.1.68073 WP_000197217.1.68201 WP_000197217.1.68206 WP_000197217.1.6827 WP_000197217.1.68275 WP_000197217.1.6849 WP_000197217.1.68547 WP_000197217.1.68589 WP_000197217.1.68655 WP_000197217.1.68656 WP_000197217.1.6869 WP_000197217.1.68778 WP_000197217.1.68787 WP_000197217.1.68818 WP_000197217.1.68894 WP_000197217.1.68928 WP_000197217.1.68975 WP_000197217.1.69006 WP_000197217.1.6913 WP_000197217.1.69146 WP_000197217.1.69255 WP_000197217.1.69288 WP_000197217.1.69397 WP_000197217.1.69564 WP_000197217.1.69644 WP_000197217.1.69704 WP_000197217.1.7014 WP_000197217.1.7021 WP_000197217.1.70241 WP_000197217.1.70269 WP_000197217.1.70289 WP_000197217.1.70326 WP_000197217.1.70447 WP_000197217.1.70485 WP_000197217.1.70523 WP_000197217.1.70547 WP_000197217.1.70643 WP_000197217.1.70683 WP_000197217.1.70883 WP_000197217.1.70922 WP_000197217.1.70948 WP_000197217.1.71116 WP_000197217.1.71146 WP_000197217.1.71165 WP_000197217.1.71188 WP_000197217.1.71202 WP_000197217.1.71243 WP_000197217.1.71306 WP_000197217.1.71337 WP_000197217.1.71401 WP_000197217.1.71418 WP_000197217.1.71691 WP_000197217.1.71702 WP_000197217.1.71750 WP_000197217.1.71845 WP_000197217.1.71881 WP_000197217.1.71908 WP_000197217.1.71952 WP_000197217.1.71973 WP_000197217.1.72065 WP_000197217.1.72105 WP_000197217.1.72203 WP_000197217.1.72372 WP_000197217.1.72376 WP_000197217.1.72594 WP_000197217.1.72871 WP_000197217.1.72975 WP_000197217.1.73062 WP_000197217.1.73144 WP_000197217.1.7315 WP_000197217.1.73200 WP_000197217.1.7334 WP_000197217.1.73377 WP_000197217.1.73481 WP_000197217.1.7356 WP_000197217.1.73561 WP_000197217.1.73581 WP_000197217.1.73617 WP_000197217.1.73667 WP_000197217.1.73753 WP_000197217.1.73758 WP_000197217.1.73794 WP_000197217.1.7387 WP_000197217.1.73924 WP_000197217.1.73926 WP_000197217.1.74029 WP_000197217.1.74181 WP_000197217.1.74191 WP_000197217.1.7433 WP_000197217.1.74379 WP_000197217.1.74410 WP_000197217.1.74466 WP_000197217.1.74529 WP_000197217.1.74545 WP_000197217.1.74745 WP_000197217.1.74996 WP_000197217.1.75129 WP_000197217.1.75187 WP_000197217.1.75288 WP_000197217.1.75334 WP_000197217.1.75362 WP_000197217.1.75385 WP_000197217.1.75392 WP_000197217.1.75760 WP_000197217.1.75764 WP_000197217.1.75793 WP_000197217.1.75837 WP_000197217.1.75874 WP_000197217.1.75945 WP_000197217.1.76020 WP_000197217.1.76162 WP_000197217.1.76208 WP_000197217.1.76252 WP_000197217.1.76445 WP_000197217.1.7660 WP_000197217.1.76673 WP_000197217.1.76706 WP_000197217.1.76721 WP_000197217.1.76756 WP_000197217.1.76760 WP_000197217.1.76875 WP_000197217.1.76880 WP_000197217.1.76899 WP_000197217.1.77038 WP_000197217.1.77047 WP_000197217.1.77080 WP_000197217.1.7712 WP_000197217.1.77180 WP_000197217.1.77244 WP_000197217.1.77292 WP_000197217.1.77349 WP_000197217.1.77514 WP_000197217.1.77529 WP_000197217.1.77543 WP_000197217.1.77549 WP_000197217.1.77692 WP_000197217.1.7782 WP_000197217.1.77851 WP_000197217.1.77898 WP_000197217.1.77918 WP_000197217.1.77960 WP_000197217.1.78033 WP_000197217.1.78076 WP_000197217.1.78096 WP_000197217.1.78100 WP_000197217.1.78110 WP_000197217.1.78120 WP_000197217.1.78383 WP_000197217.1.78407 WP_000197217.1.78602 WP_000197217.1.7861 WP_000197217.1.78618 WP_000197217.1.78673 WP_000197217.1.78735 WP_000197217.1.78802 WP_000197217.1.78830 WP_000197217.1.78835 WP_000197217.1.78871 WP_000197217.1.78874 WP_000197217.1.78918 WP_000197217.1.78930 WP_000197217.1.79151 WP_000197217.1.79167 WP_000197217.1.79203 WP_000197217.1.79335 WP_000197217.1.79462 WP_000197217.1.79472 WP_000197217.1.79490 WP_000197217.1.79495 WP_000197217.1.79529 WP_000197217.1.79570 WP_000197217.1.7964 WP_000197217.1.79659 WP_000197217.1.79668 WP_000197217.1.79708 WP_000197217.1.79845 WP_000197217.1.80077 WP_000197217.1.80137 WP_000197217.1.80182 WP_000197217.1.80296 WP_000197217.1.80366 WP_000197217.1.80780 WP_000197217.1.80831 WP_000197217.1.80850 WP_000197217.1.80881 WP_000197217.1.80939 WP_000197217.1.8096 WP_000197217.1.81037 WP_000197217.1.81069 WP_000197217.1.81149 WP_000197217.1.81175 WP_000197217.1.8119 WP_000197217.1.81193 WP_000197217.1.81354 WP_000197217.1.81410 WP_000197217.1.81425 WP_000197217.1.81667 WP_000197217.1.81750 WP_000197217.1.81785 WP_000197217.1.81902 WP_000197217.1.81974 WP_000197217.1.82337 WP_000197217.1.82479 WP_000197217.1.82503 WP_000197217.1.82515 WP_000197217.1.82676 WP_000197217.1.82761 WP_000197217.1.8282 WP_000197217.1.82895 WP_000197217.1.82944 WP_000197217.1.82956 WP_000197217.1.82992 WP_000197217.1.83061 WP_000197217.1.83092 WP_000197217.1.83128 WP_000197217.1.83163 WP_000197217.1.83305 WP_000197217.1.83365 WP_000197217.1.83413 WP_000197217.1.83491 WP_000197217.1.83523 WP_000197217.1.8354 WP_000197217.1.83721 WP_000197217.1.83760 WP_000197217.1.83995 WP_000197217.1.84103 WP_000197217.1.84283 WP_000197217.1.84392 WP_000197217.1.8441 WP_000197217.1.84532 WP_000197217.1.84554 WP_000197217.1.84659 WP_000197217.1.84693 WP_000197217.1.84899 WP_000197217.1.8497 WP_000197217.1.85040 WP_000197217.1.85120 WP_000197217.1.85134 WP_000197217.1.85178 WP_000197217.1.85180 WP_000197217.1.85190 WP_000197217.1.8533 WP_000197217.1.8545 WP_000197217.1.85481 WP_000197217.1.85483 WP_000197217.1.8552 WP_000197217.1.85541 WP_000197217.1.8556 WP_000197217.1.85615 WP_000197217.1.85617 WP_000197217.1.85663 WP_000197217.1.85671 WP_000197217.1.85672 WP_000197217.1.85777 WP_000197217.1.85855 WP_000197217.1.85886 WP_000197217.1.85900 WP_000197217.1.85904 WP_000197217.1.85976 WP_000197217.1.86306 WP_000197217.1.86356 WP_000197217.1.86450 WP_000197217.1.86469 WP_000197217.1.86580 WP_000197217.1.86588 WP_000197217.1.86634 WP_000197217.1.86661 WP_000197217.1.8672 WP_000197217.1.8678 WP_000197217.1.86810 WP_000197217.1.8684 WP_000197217.1.86895 WP_000197217.1.86906 WP_000197217.1.86982 WP_000197217.1.87095 WP_000197217.1.87148 WP_000197217.1.87323 WP_000197217.1.8736 WP_000197217.1.87460 WP_000197217.1.87552 WP_000197217.1.87779 WP_000197217.1.87945 WP_000197217.1.88019 WP_000197217.1.88073 WP_000197217.1.8809 WP_000197217.1.88291 WP_000197217.1.88293 WP_000197217.1.8837 WP_000197217.1.88393 WP_000197217.1.88703 WP_000197217.1.88792 WP_000197217.1.88902 WP_000197217.1.8891 WP_000197217.1.88981 WP_000197217.1.89008 WP_000197217.1.89116 WP_000197217.1.89138 WP_000197217.1.89304 WP_000197217.1.89512 WP_000197217.1.89527 WP_000197217.1.89570 WP_000197217.1.89604 WP_000197217.1.89622 WP_000197217.1.89659 WP_000197217.1.89902 WP_000197217.1.8996 WP_000197217.1.90097 WP_000197217.1.90252 WP_000197217.1.90417 WP_000197217.1.90453 WP_000197217.1.90458 WP_000197217.1.90557 WP_000197217.1.90585 WP_000197217.1.90641 WP_000197217.1.90734 WP_000197217.1.91003 WP_000197217.1.91069 WP_000197217.1.91278 WP_000197217.1.9131 WP_000197217.1.91512 WP_000197217.1.91564 WP_000197217.1.91628 WP_000197217.1.91655 WP_000197217.1.91724 WP_000197217.1.91732 WP_000197217.1.91788 WP_000197217.1.92013 WP_000197217.1.92047 WP_000197217.1.92060 WP_000197217.1.92093 WP_000197217.1.92108 WP_000197217.1.92171 WP_000197217.1.92183 WP_000197217.1.92208 WP_000197217.1.92268 WP_000197217.1.92310 WP_000197217.1.92318 WP_000197217.1.92375 WP_000197217.1.92439 WP_000197217.1.92443 WP_000197217.1.92482 WP_000197217.1.92669 WP_000197217.1.92671 WP_000197217.1.92738 WP_000197217.1.93086 WP_000197217.1.93101 WP_000197217.1.93136 WP_000197217.1.93155 WP_000197217.1.93275 WP_000197217.1.93322 WP_000197217.1.93365 WP_000197217.1.93376 WP_000197217.1.93543 WP_000197217.1.93596 WP_000197217.1.93650 WP_000197217.1.93656 WP_000197217.1.93662 WP_000197217.1.937 WP_000197217.1.93705 WP_000197217.1.93804 WP_000197217.1.9389 WP_000197217.1.93994 WP_000197217.1.94072 WP_000197217.1.94162 WP_000197217.1.94168 WP_000197217.1.94198 WP_000197217.1.9432 WP_000197217.1.94354 WP_000197217.1.94380 WP_000197217.1.94458 WP_000197217.1.94565 WP_000197217.1.94584 WP_000197217.1.94674 WP_000197217.1.94796 WP_000197217.1.94959 WP_000197217.1.95051 WP_000197217.1.95085 WP_000197217.1.95121 WP_000197217.1.9516 WP_000197217.1.95282 WP_000197217.1.95546 WP_000197217.1.95630 WP_000197217.1.95911 WP_000197217.1.96139 WP_000197217.1.96317 WP_000197217.1.96343 WP_000197217.1.9644 WP_000197217.1.96469 WP_000197217.1.96497 WP_000197217.1.96500 WP_000197217.1.96555 WP_000197217.1.96563 WP_000197217.1.96590 WP_000197217.1.96732 WP_000197217.1.96771 WP_000197217.1.96798 WP_000197217.1.97015 WP_000197217.1.97145 WP_000197217.1.97190 WP_000197217.1.97318 WP_000197217.1.97369 WP_000197217.1.97597 WP_000197217.1.97613 WP_000197217.1.97620 WP_000197217.1.97727 WP_000197217.1.97732 WP_000197217.1.97736 WP_000197217.1.9775 WP_000197217.1.97846 WP_000197217.1.98006 WP_000197217.1.98019 WP_000197217.1.98022 WP_000197217.1.98110 WP_000197217.1.98146 WP_000197217.1.98219 WP_000197217.1.9841 WP_000197217.1.98495 WP_000197217.1.98513 WP_000197217.1.98531 WP_000197217.1.98577 WP_000197217.1.98676 WP_000197217.1.98677 WP_000197217.1.98760 WP_000197217.1.98843 WP_000197217.1.9898 WP_000197217.1.99098 WP_000197217.1.99184 WP_000197217.1.99267 WP_000197217.1.99276 WP_000197217.1.99426 WP_000197217.1.99646 WP_000197217.1.99657 WP_000197217.1.99660 WP_000197217.1.99712 WP_000197217.1.99813 WP_000197217.1.99858 WP_000197217.1.99889 WP_000197217.1.99958 gi|62182561|ref|YP_218978.1| gi|378986788|ref|YP_005249944.1| ABAM02000001|CDS_4677487-4678647 ABAO01000008|CDS_116776-117936 AE006468|CDS_4309713-4310873 AE017220|CDS_4244089-4245249 CP001113|CDS_4301340-4302500 FN424405|CDS_4332468-4333628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]