SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482906788|ref|YP_007905348.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482906788|ref|YP_007905348.1|
Domain Number 1 Region: 1-396
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.45e-118
Family AAT-like 0.00000000000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|482906788|ref|YP_007905348.1|
Sequence length 397
Comment aromatic amino acid aminotransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MFQKVDAYAGDPILSLMERFKDDSRHDKVNLSIGLYYNEDGIIPQLKTVAEAEARLNAQP
HGASLYLPMEGLNTYRHTIAPLLFGADHPVLQQQRVATIQTLGGSGALKVGADFLKRYFP
DAGVWVSDPTWENHIAIFAGAGFEVSTYPWYDDATNGIRFNDLLATLNTLPARSIVLLHP
CCHNPTGADLTPSQWDAVIEIVKARDLIPFLDIAYQGFGAGMDDDAYVIRAIASAGLPAL
VSNSFSKIFSLYGERVGGLSVVCEDAEIAARVLGQLKATVRRIYSSPPCFGAQVVATVLG
DEALKAGWLAEVDAMRNRIISMRQTLVKELKAEMPDRNFDYLLQQRGMFSYTGLSEEQVD
RLRDEFGVYLIASGRMCVAGLNASNVHRVAKAFAAVM
Download sequence
Identical sequences A0A0D6HTW4 A0A0F7JCW8 A0A0H3NIG0 A0A0U1F9K1 A0A0W4P8I1 A0A2D3AJJ0 A0A2H9YCM5 E8X910 P74861
gi|526218703|ref|YP_008263922.1| gi|16767498|ref|NP_463113.1| gi|525839784|ref|YP_008257165.1| gi|549726762|ref|YP_008646952.1| gi|482906788|ref|YP_007905348.1| 99287.STM4248 gi|379703488|ref|YP_005245216.1| gi|378986924|ref|YP_005250080.1| NP_463113.1.58477 WP_000486903.1.100234 WP_000486903.1.100376 WP_000486903.1.100424 WP_000486903.1.100436 WP_000486903.1.100484 WP_000486903.1.100488 WP_000486903.1.100597 WP_000486903.1.10076 WP_000486903.1.100781 WP_000486903.1.100793 WP_000486903.1.100869 WP_000486903.1.100871 WP_000486903.1.100882 WP_000486903.1.101007 WP_000486903.1.101020 WP_000486903.1.101074 WP_000486903.1.101078 WP_000486903.1.101180 WP_000486903.1.101259 WP_000486903.1.101291 WP_000486903.1.101353 WP_000486903.1.101386 WP_000486903.1.101404 WP_000486903.1.101420 WP_000486903.1.101589 WP_000486903.1.101707 WP_000486903.1.101734 WP_000486903.1.101878 WP_000486903.1.101953 WP_000486903.1.10220 WP_000486903.1.10266 WP_000486903.1.10429 WP_000486903.1.10439 WP_000486903.1.10678 WP_000486903.1.10753 WP_000486903.1.10992 WP_000486903.1.11024 WP_000486903.1.11031 WP_000486903.1.11098 WP_000486903.1.11168 WP_000486903.1.11190 WP_000486903.1.11295 WP_000486903.1.11455 WP_000486903.1.11458 WP_000486903.1.11518 WP_000486903.1.11532 WP_000486903.1.11543 WP_000486903.1.11763 WP_000486903.1.11772 WP_000486903.1.11897 WP_000486903.1.12351 WP_000486903.1.12370 WP_000486903.1.12546 WP_000486903.1.1264 WP_000486903.1.12728 WP_000486903.1.12879 WP_000486903.1.12936 WP_000486903.1.12995 WP_000486903.1.13027 WP_000486903.1.13106 WP_000486903.1.13130 WP_000486903.1.13414 WP_000486903.1.13488 WP_000486903.1.13509 WP_000486903.1.13669 WP_000486903.1.13741 WP_000486903.1.1387 WP_000486903.1.13908 WP_000486903.1.13932 WP_000486903.1.13968 WP_000486903.1.14001 WP_000486903.1.14151 WP_000486903.1.14239 WP_000486903.1.14320 WP_000486903.1.14379 WP_000486903.1.14406 WP_000486903.1.14410 WP_000486903.1.14466 WP_000486903.1.14524 WP_000486903.1.14554 WP_000486903.1.14725 WP_000486903.1.14852 WP_000486903.1.1489 WP_000486903.1.14932 WP_000486903.1.15055 WP_000486903.1.15124 WP_000486903.1.15223 WP_000486903.1.15226 WP_000486903.1.15316 WP_000486903.1.15369 WP_000486903.1.1540 WP_000486903.1.15508 WP_000486903.1.15784 WP_000486903.1.15830 WP_000486903.1.16062 WP_000486903.1.16063 WP_000486903.1.16103 WP_000486903.1.16226 WP_000486903.1.16233 WP_000486903.1.16284 WP_000486903.1.16328 WP_000486903.1.1635 WP_000486903.1.16468 WP_000486903.1.16614 WP_000486903.1.16650 WP_000486903.1.16686 WP_000486903.1.16691 WP_000486903.1.16732 WP_000486903.1.16735 WP_000486903.1.16786 WP_000486903.1.16858 WP_000486903.1.16896 WP_000486903.1.1700 WP_000486903.1.17307 WP_000486903.1.174 WP_000486903.1.17480 WP_000486903.1.17546 WP_000486903.1.17702 WP_000486903.1.17705 WP_000486903.1.18019 WP_000486903.1.18111 WP_000486903.1.18163 WP_000486903.1.18265 WP_000486903.1.18267 WP_000486903.1.18468 WP_000486903.1.18607 WP_000486903.1.18705 WP_000486903.1.18715 WP_000486903.1.18776 WP_000486903.1.18822 WP_000486903.1.18881 WP_000486903.1.18940 WP_000486903.1.18949 WP_000486903.1.19053 WP_000486903.1.19320 WP_000486903.1.19458 WP_000486903.1.19460 WP_000486903.1.19461 WP_000486903.1.19614 WP_000486903.1.19702 WP_000486903.1.19706 WP_000486903.1.19724 WP_000486903.1.19749 WP_000486903.1.19784 WP_000486903.1.19802 WP_000486903.1.19809 WP_000486903.1.19867 WP_000486903.1.1998 WP_000486903.1.20 WP_000486903.1.2010 WP_000486903.1.20212 WP_000486903.1.20271 WP_000486903.1.20362 WP_000486903.1.20418 WP_000486903.1.20443 WP_000486903.1.20525 WP_000486903.1.2054 WP_000486903.1.20553 WP_000486903.1.20626 WP_000486903.1.20646 WP_000486903.1.20886 WP_000486903.1.21049 WP_000486903.1.21146 WP_000486903.1.21245 WP_000486903.1.21246 WP_000486903.1.21269 WP_000486903.1.21400 WP_000486903.1.21497 WP_000486903.1.21499 WP_000486903.1.21603 WP_000486903.1.21751 WP_000486903.1.21757 WP_000486903.1.22024 WP_000486903.1.2205 WP_000486903.1.22062 WP_000486903.1.22067 WP_000486903.1.2221 WP_000486903.1.2235 WP_000486903.1.22379 WP_000486903.1.22427 WP_000486903.1.2246 WP_000486903.1.22485 WP_000486903.1.22620 WP_000486903.1.22870 WP_000486903.1.22979 WP_000486903.1.23102 WP_000486903.1.23114 WP_000486903.1.2314 WP_000486903.1.23192 WP_000486903.1.23259 WP_000486903.1.23460 WP_000486903.1.23472 WP_000486903.1.23482 WP_000486903.1.23634 WP_000486903.1.2364 WP_000486903.1.23932 WP_000486903.1.24017 WP_000486903.1.24206 WP_000486903.1.24308 WP_000486903.1.24578 WP_000486903.1.24737 WP_000486903.1.24779 WP_000486903.1.25008 WP_000486903.1.25015 WP_000486903.1.25405 WP_000486903.1.25454 WP_000486903.1.25493 WP_000486903.1.25668 WP_000486903.1.25690 WP_000486903.1.2570 WP_000486903.1.25740 WP_000486903.1.25793 WP_000486903.1.25814 WP_000486903.1.25988 WP_000486903.1.26282 WP_000486903.1.26311 WP_000486903.1.26319 WP_000486903.1.26429 WP_000486903.1.26440 WP_000486903.1.26493 WP_000486903.1.26551 WP_000486903.1.26567 WP_000486903.1.27010 WP_000486903.1.27173 WP_000486903.1.27206 WP_000486903.1.27423 WP_000486903.1.27561 WP_000486903.1.2763 WP_000486903.1.27665 WP_000486903.1.27707 WP_000486903.1.27761 WP_000486903.1.2777 WP_000486903.1.27857 WP_000486903.1.27977 WP_000486903.1.28094 WP_000486903.1.28170 WP_000486903.1.28302 WP_000486903.1.2835 WP_000486903.1.28370 WP_000486903.1.28538 WP_000486903.1.28575 WP_000486903.1.28625 WP_000486903.1.28655 WP_000486903.1.28694 WP_000486903.1.2890 WP_000486903.1.28938 WP_000486903.1.29006 WP_000486903.1.29010 WP_000486903.1.2910 WP_000486903.1.29588 WP_000486903.1.29601 WP_000486903.1.29606 WP_000486903.1.29615 WP_000486903.1.29619 WP_000486903.1.29704 WP_000486903.1.29969 WP_000486903.1.30006 WP_000486903.1.30027 WP_000486903.1.30180 WP_000486903.1.30469 WP_000486903.1.30505 WP_000486903.1.30507 WP_000486903.1.30535 WP_000486903.1.30547 WP_000486903.1.30794 WP_000486903.1.30833 WP_000486903.1.30835 WP_000486903.1.30972 WP_000486903.1.31 WP_000486903.1.3113 WP_000486903.1.31185 WP_000486903.1.3119 WP_000486903.1.31190 WP_000486903.1.31195 WP_000486903.1.31196 WP_000486903.1.31281 WP_000486903.1.31504 WP_000486903.1.31515 WP_000486903.1.31578 WP_000486903.1.31658 WP_000486903.1.31940 WP_000486903.1.31967 WP_000486903.1.31972 WP_000486903.1.32192 WP_000486903.1.32206 WP_000486903.1.32438 WP_000486903.1.32515 WP_000486903.1.32660 WP_000486903.1.32702 WP_000486903.1.32714 WP_000486903.1.32786 WP_000486903.1.32804 WP_000486903.1.32907 WP_000486903.1.33030 WP_000486903.1.33127 WP_000486903.1.33143 WP_000486903.1.33248 WP_000486903.1.33261 WP_000486903.1.333 WP_000486903.1.33492 WP_000486903.1.33553 WP_000486903.1.33592 WP_000486903.1.33825 WP_000486903.1.33894 WP_000486903.1.34043 WP_000486903.1.34075 WP_000486903.1.34257 WP_000486903.1.34279 WP_000486903.1.34319 WP_000486903.1.34453 WP_000486903.1.34610 WP_000486903.1.34856 WP_000486903.1.34975 WP_000486903.1.35045 WP_000486903.1.35129 WP_000486903.1.35184 WP_000486903.1.35404 WP_000486903.1.35408 WP_000486903.1.35425 WP_000486903.1.35446 WP_000486903.1.35463 WP_000486903.1.35503 WP_000486903.1.35509 WP_000486903.1.35590 WP_000486903.1.35940 WP_000486903.1.36003 WP_000486903.1.3601 WP_000486903.1.36609 WP_000486903.1.36690 WP_000486903.1.3670 WP_000486903.1.36705 WP_000486903.1.36918 WP_000486903.1.36931 WP_000486903.1.37073 WP_000486903.1.37111 WP_000486903.1.37112 WP_000486903.1.37256 WP_000486903.1.37293 WP_000486903.1.37370 WP_000486903.1.37376 WP_000486903.1.3744 WP_000486903.1.37498 WP_000486903.1.37504 WP_000486903.1.37618 WP_000486903.1.37968 WP_000486903.1.37978 WP_000486903.1.38125 WP_000486903.1.38145 WP_000486903.1.383 WP_000486903.1.3848 WP_000486903.1.38613 WP_000486903.1.38673 WP_000486903.1.38693 WP_000486903.1.38773 WP_000486903.1.38882 WP_000486903.1.38913 WP_000486903.1.39003 WP_000486903.1.39136 WP_000486903.1.39197 WP_000486903.1.39229 WP_000486903.1.39405 WP_000486903.1.39420 WP_000486903.1.39449 WP_000486903.1.39512 WP_000486903.1.39763 WP_000486903.1.39862 WP_000486903.1.39921 WP_000486903.1.40017 WP_000486903.1.40072 WP_000486903.1.40073 WP_000486903.1.4011 WP_000486903.1.40208 WP_000486903.1.40240 WP_000486903.1.40257 WP_000486903.1.40292 WP_000486903.1.40305 WP_000486903.1.40311 WP_000486903.1.40380 WP_000486903.1.40395 WP_000486903.1.40465 WP_000486903.1.40508 WP_000486903.1.40710 WP_000486903.1.4075 WP_000486903.1.4087 WP_000486903.1.40877 WP_000486903.1.41017 WP_000486903.1.41086 WP_000486903.1.41091 WP_000486903.1.41226 WP_000486903.1.41279 WP_000486903.1.41516 WP_000486903.1.41554 WP_000486903.1.41572 WP_000486903.1.41591 WP_000486903.1.41662 WP_000486903.1.41708 WP_000486903.1.41761 WP_000486903.1.41882 WP_000486903.1.41979 WP_000486903.1.41985 WP_000486903.1.42104 WP_000486903.1.42320 WP_000486903.1.42422 WP_000486903.1.4276 WP_000486903.1.42864 WP_000486903.1.4288 WP_000486903.1.43018 WP_000486903.1.43041 WP_000486903.1.43244 WP_000486903.1.43312 WP_000486903.1.43334 WP_000486903.1.43437 WP_000486903.1.43522 WP_000486903.1.43613 WP_000486903.1.43668 WP_000486903.1.43886 WP_000486903.1.44005 WP_000486903.1.44043 WP_000486903.1.44099 WP_000486903.1.44121 WP_000486903.1.44291 WP_000486903.1.44310 WP_000486903.1.44386 WP_000486903.1.44479 WP_000486903.1.44640 WP_000486903.1.4467 WP_000486903.1.44747 WP_000486903.1.4485 WP_000486903.1.44877 WP_000486903.1.44927 WP_000486903.1.45067 WP_000486903.1.45074 WP_000486903.1.45079 WP_000486903.1.45098 WP_000486903.1.45177 WP_000486903.1.45184 WP_000486903.1.45259 WP_000486903.1.45349 WP_000486903.1.45365 WP_000486903.1.45550 WP_000486903.1.45585 WP_000486903.1.45660 WP_000486903.1.45690 WP_000486903.1.458 WP_000486903.1.46011 WP_000486903.1.46069 WP_000486903.1.46173 WP_000486903.1.46174 WP_000486903.1.46187 WP_000486903.1.46303 WP_000486903.1.46595 WP_000486903.1.46675 WP_000486903.1.47057 WP_000486903.1.47214 WP_000486903.1.47429 WP_000486903.1.47448 WP_000486903.1.4747 WP_000486903.1.47472 WP_000486903.1.47478 WP_000486903.1.47621 WP_000486903.1.47799 WP_000486903.1.48242 WP_000486903.1.48253 WP_000486903.1.483 WP_000486903.1.48367 WP_000486903.1.48377 WP_000486903.1.4853 WP_000486903.1.48788 WP_000486903.1.4885 WP_000486903.1.48894 WP_000486903.1.48919 WP_000486903.1.49084 WP_000486903.1.49155 WP_000486903.1.49204 WP_000486903.1.49239 WP_000486903.1.49256 WP_000486903.1.49290 WP_000486903.1.49340 WP_000486903.1.49366 WP_000486903.1.49490 WP_000486903.1.49515 WP_000486903.1.4979 WP_000486903.1.49803 WP_000486903.1.49805 WP_000486903.1.49929 WP_000486903.1.50080 WP_000486903.1.50161 WP_000486903.1.50211 WP_000486903.1.50376 WP_000486903.1.50389 WP_000486903.1.50676 WP_000486903.1.50804 WP_000486903.1.50808 WP_000486903.1.5088 WP_000486903.1.50908 WP_000486903.1.50941 WP_000486903.1.51014 WP_000486903.1.51022 WP_000486903.1.51179 WP_000486903.1.51182 WP_000486903.1.51186 WP_000486903.1.51487 WP_000486903.1.51488 WP_000486903.1.51634 WP_000486903.1.51649 WP_000486903.1.51686 WP_000486903.1.51756 WP_000486903.1.51911 WP_000486903.1.51932 WP_000486903.1.51989 WP_000486903.1.52121 WP_000486903.1.52346 WP_000486903.1.52353 WP_000486903.1.52361 WP_000486903.1.52653 WP_000486903.1.52656 WP_000486903.1.52743 WP_000486903.1.52857 WP_000486903.1.52898 WP_000486903.1.52915 WP_000486903.1.53190 WP_000486903.1.53406 WP_000486903.1.53466 WP_000486903.1.53529 WP_000486903.1.53543 WP_000486903.1.53757 WP_000486903.1.53812 WP_000486903.1.54033 WP_000486903.1.54075 WP_000486903.1.54196 WP_000486903.1.54209 WP_000486903.1.54271 WP_000486903.1.54274 WP_000486903.1.54319 WP_000486903.1.54364 WP_000486903.1.54400 WP_000486903.1.54644 WP_000486903.1.54662 WP_000486903.1.54722 WP_000486903.1.54749 WP_000486903.1.54764 WP_000486903.1.55008 WP_000486903.1.55152 WP_000486903.1.55156 WP_000486903.1.55285 WP_000486903.1.55475 WP_000486903.1.55647 WP_000486903.1.55743 WP_000486903.1.55768 WP_000486903.1.55782 WP_000486903.1.55796 WP_000486903.1.56002 WP_000486903.1.56012 WP_000486903.1.56105 WP_000486903.1.56238 WP_000486903.1.56286 WP_000486903.1.56304 WP_000486903.1.56414 WP_000486903.1.56438 WP_000486903.1.56560 WP_000486903.1.56601 WP_000486903.1.56614 WP_000486903.1.56671 WP_000486903.1.56682 WP_000486903.1.56875 WP_000486903.1.56877 WP_000486903.1.57168 WP_000486903.1.57187 WP_000486903.1.57377 WP_000486903.1.57418 WP_000486903.1.57433 WP_000486903.1.57515 WP_000486903.1.57529 WP_000486903.1.57576 WP_000486903.1.57601 WP_000486903.1.57607 WP_000486903.1.57763 WP_000486903.1.57862 WP_000486903.1.57890 WP_000486903.1.57891 WP_000486903.1.57978 WP_000486903.1.5801 WP_000486903.1.58041 WP_000486903.1.58418 WP_000486903.1.58548 WP_000486903.1.5858 WP_000486903.1.58662 WP_000486903.1.58669 WP_000486903.1.58745 WP_000486903.1.58803 WP_000486903.1.5886 WP_000486903.1.59094 WP_000486903.1.59224 WP_000486903.1.59321 WP_000486903.1.59375 WP_000486903.1.59458 WP_000486903.1.59490 WP_000486903.1.59508 WP_000486903.1.59684 WP_000486903.1.59694 WP_000486903.1.59771 WP_000486903.1.5979 WP_000486903.1.59953 WP_000486903.1.60008 WP_000486903.1.60021 WP_000486903.1.60069 WP_000486903.1.60140 WP_000486903.1.60155 WP_000486903.1.60285 WP_000486903.1.60379 WP_000486903.1.60464 WP_000486903.1.60874 WP_000486903.1.60941 WP_000486903.1.61078 WP_000486903.1.6114 WP_000486903.1.61232 WP_000486903.1.61296 WP_000486903.1.61345 WP_000486903.1.61417 WP_000486903.1.61574 WP_000486903.1.61712 WP_000486903.1.61714 WP_000486903.1.61730 WP_000486903.1.61857 WP_000486903.1.61918 WP_000486903.1.61952 WP_000486903.1.62007 WP_000486903.1.62025 WP_000486903.1.62204 WP_000486903.1.62304 WP_000486903.1.62364 WP_000486903.1.62374 WP_000486903.1.6253 WP_000486903.1.62853 WP_000486903.1.62903 WP_000486903.1.62910 WP_000486903.1.62955 WP_000486903.1.63181 WP_000486903.1.63203 WP_000486903.1.63256 WP_000486903.1.63290 WP_000486903.1.63382 WP_000486903.1.63432 WP_000486903.1.63461 WP_000486903.1.63479 WP_000486903.1.63577 WP_000486903.1.63664 WP_000486903.1.63718 WP_000486903.1.6375 WP_000486903.1.63757 WP_000486903.1.63834 WP_000486903.1.64046 WP_000486903.1.6423 WP_000486903.1.64244 WP_000486903.1.64403 WP_000486903.1.64649 WP_000486903.1.64702 WP_000486903.1.64757 WP_000486903.1.64781 WP_000486903.1.64831 WP_000486903.1.6489 WP_000486903.1.65018 WP_000486903.1.65028 WP_000486903.1.65171 WP_000486903.1.65248 WP_000486903.1.6535 WP_000486903.1.65474 WP_000486903.1.65633 WP_000486903.1.6565 WP_000486903.1.65696 WP_000486903.1.6575 WP_000486903.1.65782 WP_000486903.1.6630 WP_000486903.1.66314 WP_000486903.1.66358 WP_000486903.1.66362 WP_000486903.1.6640 WP_000486903.1.66600 WP_000486903.1.66698 WP_000486903.1.6680 WP_000486903.1.66834 WP_000486903.1.66901 WP_000486903.1.66962 WP_000486903.1.67037 WP_000486903.1.67045 WP_000486903.1.67181 WP_000486903.1.67268 WP_000486903.1.67347 WP_000486903.1.67465 WP_000486903.1.67552 WP_000486903.1.67682 WP_000486903.1.67829 WP_000486903.1.67887 WP_000486903.1.68073 WP_000486903.1.68201 WP_000486903.1.68206 WP_000486903.1.6827 WP_000486903.1.68275 WP_000486903.1.6849 WP_000486903.1.68547 WP_000486903.1.68589 WP_000486903.1.68655 WP_000486903.1.68656 WP_000486903.1.68778 WP_000486903.1.68787 WP_000486903.1.68894 WP_000486903.1.68928 WP_000486903.1.68975 WP_000486903.1.69006 WP_000486903.1.6913 WP_000486903.1.69146 WP_000486903.1.69255 WP_000486903.1.69397 WP_000486903.1.69564 WP_000486903.1.69644 WP_000486903.1.69704 WP_000486903.1.7021 WP_000486903.1.70241 WP_000486903.1.70269 WP_000486903.1.70289 WP_000486903.1.70447 WP_000486903.1.70485 WP_000486903.1.70643 WP_000486903.1.70683 WP_000486903.1.70883 WP_000486903.1.70922 WP_000486903.1.70948 WP_000486903.1.71116 WP_000486903.1.71146 WP_000486903.1.71165 WP_000486903.1.71188 WP_000486903.1.71202 WP_000486903.1.71243 WP_000486903.1.71306 WP_000486903.1.71337 WP_000486903.1.71378 WP_000486903.1.71401 WP_000486903.1.71481 WP_000486903.1.71702 WP_000486903.1.71750 WP_000486903.1.71845 WP_000486903.1.71881 WP_000486903.1.71908 WP_000486903.1.71952 WP_000486903.1.71973 WP_000486903.1.72105 WP_000486903.1.72203 WP_000486903.1.72376 WP_000486903.1.72594 WP_000486903.1.72871 WP_000486903.1.72975 WP_000486903.1.7315 WP_000486903.1.73200 WP_000486903.1.7334 WP_000486903.1.73377 WP_000486903.1.73481 WP_000486903.1.7356 WP_000486903.1.73581 WP_000486903.1.73617 WP_000486903.1.73753 WP_000486903.1.73758 WP_000486903.1.73794 WP_000486903.1.7387 WP_000486903.1.73924 WP_000486903.1.74029 WP_000486903.1.74181 WP_000486903.1.74191 WP_000486903.1.7433 WP_000486903.1.74379 WP_000486903.1.74410 WP_000486903.1.74466 WP_000486903.1.74529 WP_000486903.1.74545 WP_000486903.1.74745 WP_000486903.1.75129 WP_000486903.1.75187 WP_000486903.1.75288 WP_000486903.1.75334 WP_000486903.1.75362 WP_000486903.1.75385 WP_000486903.1.75392 WP_000486903.1.75760 WP_000486903.1.75764 WP_000486903.1.75828 WP_000486903.1.75837 WP_000486903.1.75874 WP_000486903.1.75945 WP_000486903.1.76020 WP_000486903.1.76252 WP_000486903.1.76445 WP_000486903.1.7660 WP_000486903.1.76673 WP_000486903.1.76706 WP_000486903.1.76721 WP_000486903.1.76756 WP_000486903.1.76760 WP_000486903.1.76875 WP_000486903.1.76880 WP_000486903.1.76899 WP_000486903.1.77038 WP_000486903.1.77047 WP_000486903.1.77080 WP_000486903.1.7712 WP_000486903.1.77180 WP_000486903.1.77244 WP_000486903.1.77292 WP_000486903.1.77349 WP_000486903.1.77514 WP_000486903.1.77529 WP_000486903.1.77549 WP_000486903.1.77692 WP_000486903.1.7782 WP_000486903.1.77898 WP_000486903.1.77918 WP_000486903.1.77960 WP_000486903.1.78033 WP_000486903.1.78076 WP_000486903.1.78096 WP_000486903.1.78100 WP_000486903.1.78110 WP_000486903.1.78120 WP_000486903.1.78383 WP_000486903.1.78407 WP_000486903.1.7861 WP_000486903.1.78618 WP_000486903.1.78673 WP_000486903.1.78735 WP_000486903.1.78802 WP_000486903.1.78830 WP_000486903.1.78835 WP_000486903.1.78871 WP_000486903.1.78874 WP_000486903.1.78918 WP_000486903.1.78930 WP_000486903.1.79151 WP_000486903.1.79167 WP_000486903.1.79462 WP_000486903.1.79472 WP_000486903.1.79490 WP_000486903.1.79495 WP_000486903.1.79529 WP_000486903.1.79570 WP_000486903.1.79659 WP_000486903.1.79668 WP_000486903.1.79708 WP_000486903.1.79845 WP_000486903.1.80077 WP_000486903.1.80137 WP_000486903.1.80182 WP_000486903.1.80296 WP_000486903.1.80366 WP_000486903.1.80780 WP_000486903.1.80831 WP_000486903.1.80850 WP_000486903.1.80881 WP_000486903.1.80939 WP_000486903.1.8096 WP_000486903.1.81037 WP_000486903.1.81149 WP_000486903.1.81175 WP_000486903.1.8119 WP_000486903.1.81193 WP_000486903.1.81354 WP_000486903.1.81425 WP_000486903.1.81750 WP_000486903.1.81785 WP_000486903.1.81902 WP_000486903.1.81974 WP_000486903.1.82337 WP_000486903.1.82479 WP_000486903.1.82503 WP_000486903.1.82515 WP_000486903.1.82676 WP_000486903.1.82761 WP_000486903.1.8282 WP_000486903.1.82944 WP_000486903.1.82956 WP_000486903.1.83092 WP_000486903.1.83163 WP_000486903.1.83305 WP_000486903.1.83413 WP_000486903.1.83491 WP_000486903.1.83523 WP_000486903.1.8354 WP_000486903.1.83651 WP_000486903.1.83721 WP_000486903.1.83760 WP_000486903.1.83995 WP_000486903.1.84103 WP_000486903.1.84283 WP_000486903.1.84392 WP_000486903.1.8441 WP_000486903.1.84532 WP_000486903.1.84554 WP_000486903.1.84659 WP_000486903.1.84899 WP_000486903.1.8497 WP_000486903.1.85040 WP_000486903.1.85134 WP_000486903.1.85178 WP_000486903.1.85180 WP_000486903.1.85190 WP_000486903.1.8533 WP_000486903.1.8545 WP_000486903.1.85481 WP_000486903.1.85483 WP_000486903.1.85541 WP_000486903.1.8556 WP_000486903.1.85615 WP_000486903.1.85617 WP_000486903.1.85663 WP_000486903.1.85671 WP_000486903.1.85672 WP_000486903.1.85777 WP_000486903.1.85886 WP_000486903.1.85900 WP_000486903.1.85904 WP_000486903.1.85976 WP_000486903.1.86306 WP_000486903.1.86356 WP_000486903.1.86450 WP_000486903.1.86469 WP_000486903.1.86580 WP_000486903.1.86588 WP_000486903.1.86661 WP_000486903.1.8672 WP_000486903.1.8678 WP_000486903.1.86810 WP_000486903.1.8684 WP_000486903.1.86895 WP_000486903.1.86906 WP_000486903.1.87095 WP_000486903.1.8736 WP_000486903.1.87460 WP_000486903.1.87552 WP_000486903.1.87779 WP_000486903.1.87945 WP_000486903.1.88019 WP_000486903.1.88073 WP_000486903.1.8809 WP_000486903.1.88291 WP_000486903.1.88293 WP_000486903.1.8837 WP_000486903.1.88393 WP_000486903.1.88703 WP_000486903.1.88792 WP_000486903.1.88902 WP_000486903.1.8891 WP_000486903.1.89008 WP_000486903.1.89116 WP_000486903.1.89138 WP_000486903.1.89304 WP_000486903.1.89512 WP_000486903.1.89527 WP_000486903.1.89570 WP_000486903.1.89604 WP_000486903.1.89622 WP_000486903.1.89659 WP_000486903.1.89902 WP_000486903.1.8996 WP_000486903.1.90097 WP_000486903.1.90252 WP_000486903.1.90417 WP_000486903.1.90453 WP_000486903.1.90458 WP_000486903.1.90557 WP_000486903.1.90585 WP_000486903.1.90641 WP_000486903.1.90734 WP_000486903.1.91003 WP_000486903.1.91069 WP_000486903.1.91278 WP_000486903.1.91512 WP_000486903.1.91524 WP_000486903.1.91628 WP_000486903.1.91655 WP_000486903.1.91724 WP_000486903.1.91732 WP_000486903.1.91788 WP_000486903.1.92013 WP_000486903.1.92093 WP_000486903.1.92108 WP_000486903.1.92183 WP_000486903.1.92208 WP_000486903.1.92268 WP_000486903.1.92310 WP_000486903.1.92443 WP_000486903.1.92482 WP_000486903.1.92531 WP_000486903.1.92669 WP_000486903.1.92671 WP_000486903.1.92738 WP_000486903.1.93086 WP_000486903.1.93101 WP_000486903.1.93136 WP_000486903.1.93155 WP_000486903.1.93365 WP_000486903.1.93543 WP_000486903.1.93650 WP_000486903.1.93656 WP_000486903.1.93662 WP_000486903.1.937 WP_000486903.1.93705 WP_000486903.1.93804 WP_000486903.1.9389 WP_000486903.1.93994 WP_000486903.1.94072 WP_000486903.1.94162 WP_000486903.1.94198 WP_000486903.1.9432 WP_000486903.1.94354 WP_000486903.1.94380 WP_000486903.1.94458 WP_000486903.1.94565 WP_000486903.1.94584 WP_000486903.1.94674 WP_000486903.1.94796 WP_000486903.1.94959 WP_000486903.1.95051 WP_000486903.1.95085 WP_000486903.1.95121 WP_000486903.1.95282 WP_000486903.1.95546 WP_000486903.1.95630 WP_000486903.1.95911 WP_000486903.1.96139 WP_000486903.1.96317 WP_000486903.1.96343 WP_000486903.1.9644 WP_000486903.1.96469 WP_000486903.1.96500 WP_000486903.1.96555 WP_000486903.1.96563 WP_000486903.1.96732 WP_000486903.1.96771 WP_000486903.1.97015 WP_000486903.1.97145 WP_000486903.1.97190 WP_000486903.1.97369 WP_000486903.1.97594 WP_000486903.1.97597 WP_000486903.1.97613 WP_000486903.1.97620 WP_000486903.1.97727 WP_000486903.1.97732 WP_000486903.1.97736 WP_000486903.1.9775 WP_000486903.1.98006 WP_000486903.1.98019 WP_000486903.1.98022 WP_000486903.1.98110 WP_000486903.1.98146 WP_000486903.1.98219 WP_000486903.1.9841 WP_000486903.1.98495 WP_000486903.1.98531 WP_000486903.1.98577 WP_000486903.1.98676 WP_000486903.1.98677 WP_000486903.1.98760 WP_000486903.1.98843 WP_000486903.1.9898 WP_000486903.1.99072 WP_000486903.1.99098 WP_000486903.1.99184 WP_000486903.1.99267 WP_000486903.1.99276 WP_000486903.1.99646 WP_000486903.1.99657 WP_000486903.1.99660 WP_000486903.1.99712 WP_000486903.1.99813 WP_000486903.1.99858 WP_000486903.1.99889 WP_000486903.1.99958 gi|378991517|ref|YP_005254681.1| gi|550903592|ref|YP_008672684.1| ABAO01000007|CDS_69414-70607 AE006468|CDS_4469303-4470496 FN424405|CDS_4492002-4493195 gi|378447567|ref|YP_005235199.1| gi|378702091|ref|YP_005184049.1| gi|410023220|ref|YP_005240541.2| gi|383498828|ref|YP_005399517.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]