SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482906978|ref|YP_007905538.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. U288

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482906978|ref|YP_007905538.1|
Domain Number 1 Region: 6-367
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.7e-31
Family Cystathionine synthase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|482906978|ref|YP_007905538.1|
Sequence length 372
Comment hypothetical protein STU288_22295 [Salmonella enterica subsp. enterica serovar Typhimurium str. U288]
Sequence
MPSIFEKYQLKQVINASGRMTALGVSTPRPEVIDAAMAGMNQYFEMKDLVNKTGEYIAKL
LEVEGATVVSCASAGLAQSVAAVLVQDSDWLLENLHVTPIENNEIVLPKGHNVNFGAPVG
TMVALGGGKLVEAGYANECSAAQLAAAITPRTAAILYIKSHHCVQKSMLSVEQAAVVART
HNLPLIVDAAAEEDLQCYYRVGADLVIYSGAKAIEGPTSGLVIGKTQYVEWVKRQSAGIG
RAMKVGKEGIVGLTCAIELYLRAQKESGAEMVEKMAPFIDTLNTFNGVSARVVWDSAGRD
IARTEIKFDEAVTGIATGELVDALKQGEYAIYFRGYKANEGIIEADVRSVDRAQLAIVAR
RIGEVINQEKQA
Download sequence
Identical sequences A0A0D6HPQ5 A0A0F7JEN1 A0A0H3BUR8 A0A0R9P8S1 A0A0T9X2Q2 A0A0U1IU40 A0A158N0D5 A0A1S1AS73 A0A2D1XWP2 A0A2D3AK07 A0A2I6MD95 Q8ZK43
gi|378987113|ref|YP_005250269.1| gi|538365028|ref|YP_008508313.1| gi|550903780|ref|YP_008672872.1| AE006468|CDS_4687586-4688704 CP001113|CDS_4666572-4667690 gi|16767692|ref|NP_463307.1| 423368.SNSL254_A4792 99287.STM4446 gi|528817531|ref|YP_008358734.1| gi|482906978|ref|YP_007905538.1| 391503 gi|525839638|ref|YP_008256971.1| NP_463307.1.58477 WP_001139182.1.100010 WP_001139182.1.100234 WP_001139182.1.100376 WP_001139182.1.100424 WP_001139182.1.100436 WP_001139182.1.100502 WP_001139182.1.100711 WP_001139182.1.10076 WP_001139182.1.100781 WP_001139182.1.100793 WP_001139182.1.100869 WP_001139182.1.100882 WP_001139182.1.101007 WP_001139182.1.101020 WP_001139182.1.101074 WP_001139182.1.101078 WP_001139182.1.101180 WP_001139182.1.101259 WP_001139182.1.101284 WP_001139182.1.101291 WP_001139182.1.101353 WP_001139182.1.101386 WP_001139182.1.101420 WP_001139182.1.101589 WP_001139182.1.101666 WP_001139182.1.101707 WP_001139182.1.101734 WP_001139182.1.101878 WP_001139182.1.101953 WP_001139182.1.10220 WP_001139182.1.10266 WP_001139182.1.10293 WP_001139182.1.10429 WP_001139182.1.10439 WP_001139182.1.10675 WP_001139182.1.10678 WP_001139182.1.10753 WP_001139182.1.10992 WP_001139182.1.11024 WP_001139182.1.11031 WP_001139182.1.11168 WP_001139182.1.11190 WP_001139182.1.11295 WP_001139182.1.11455 WP_001139182.1.11518 WP_001139182.1.11532 WP_001139182.1.11543 WP_001139182.1.11763 WP_001139182.1.11772 WP_001139182.1.11897 WP_001139182.1.12114 WP_001139182.1.12280 WP_001139182.1.12351 WP_001139182.1.12546 WP_001139182.1.1264 WP_001139182.1.12728 WP_001139182.1.12879 WP_001139182.1.12936 WP_001139182.1.12995 WP_001139182.1.13027 WP_001139182.1.13130 WP_001139182.1.1326 WP_001139182.1.13414 WP_001139182.1.13488 WP_001139182.1.13509 WP_001139182.1.13669 WP_001139182.1.13741 WP_001139182.1.13799 WP_001139182.1.13908 WP_001139182.1.13968 WP_001139182.1.14001 WP_001139182.1.14151 WP_001139182.1.14320 WP_001139182.1.14406 WP_001139182.1.14410 WP_001139182.1.14524 WP_001139182.1.14554 WP_001139182.1.14725 WP_001139182.1.14808 WP_001139182.1.14932 WP_001139182.1.15055 WP_001139182.1.15223 WP_001139182.1.15226 WP_001139182.1.15316 WP_001139182.1.15353 WP_001139182.1.15369 WP_001139182.1.1540 WP_001139182.1.15483 WP_001139182.1.15508 WP_001139182.1.15625 WP_001139182.1.15708 WP_001139182.1.15784 WP_001139182.1.15830 WP_001139182.1.16062 WP_001139182.1.16063 WP_001139182.1.16103 WP_001139182.1.16226 WP_001139182.1.16233 WP_001139182.1.16284 WP_001139182.1.16328 WP_001139182.1.16331 WP_001139182.1.1635 WP_001139182.1.16468 WP_001139182.1.16614 WP_001139182.1.16650 WP_001139182.1.16686 WP_001139182.1.16691 WP_001139182.1.16732 WP_001139182.1.16735 WP_001139182.1.16786 WP_001139182.1.16858 WP_001139182.1.16896 WP_001139182.1.16941 WP_001139182.1.16965 WP_001139182.1.1700 WP_001139182.1.17285 WP_001139182.1.174 WP_001139182.1.17447 WP_001139182.1.17546 WP_001139182.1.17702 WP_001139182.1.17991 WP_001139182.1.18019 WP_001139182.1.18089 WP_001139182.1.18111 WP_001139182.1.18163 WP_001139182.1.18265 WP_001139182.1.18267 WP_001139182.1.18365 WP_001139182.1.18441 WP_001139182.1.18468 WP_001139182.1.18607 WP_001139182.1.18705 WP_001139182.1.18715 WP_001139182.1.18822 WP_001139182.1.18881 WP_001139182.1.18940 WP_001139182.1.18949 WP_001139182.1.1897 WP_001139182.1.19053 WP_001139182.1.19064 WP_001139182.1.19163 WP_001139182.1.19458 WP_001139182.1.19460 WP_001139182.1.19461 WP_001139182.1.19614 WP_001139182.1.19702 WP_001139182.1.19724 WP_001139182.1.19784 WP_001139182.1.19809 WP_001139182.1.19867 WP_001139182.1.19967 WP_001139182.1.1998 WP_001139182.1.20119 WP_001139182.1.20212 WP_001139182.1.20266 WP_001139182.1.20271 WP_001139182.1.20362 WP_001139182.1.20391 WP_001139182.1.20418 WP_001139182.1.20425 WP_001139182.1.20443 WP_001139182.1.2054 WP_001139182.1.20553 WP_001139182.1.20626 WP_001139182.1.20646 WP_001139182.1.20695 WP_001139182.1.20886 WP_001139182.1.20894 WP_001139182.1.21049 WP_001139182.1.21146 WP_001139182.1.21245 WP_001139182.1.21246 WP_001139182.1.21269 WP_001139182.1.21400 WP_001139182.1.21497 WP_001139182.1.21499 WP_001139182.1.21751 WP_001139182.1.21757 WP_001139182.1.21792 WP_001139182.1.21825 WP_001139182.1.22024 WP_001139182.1.22030 WP_001139182.1.2205 WP_001139182.1.22062 WP_001139182.1.22067 WP_001139182.1.22069 WP_001139182.1.2235 WP_001139182.1.22379 WP_001139182.1.22427 WP_001139182.1.2246 WP_001139182.1.22485 WP_001139182.1.22514 WP_001139182.1.22582 WP_001139182.1.22620 WP_001139182.1.22870 WP_001139182.1.22979 WP_001139182.1.23053 WP_001139182.1.23102 WP_001139182.1.23114 WP_001139182.1.2314 WP_001139182.1.23148 WP_001139182.1.23192 WP_001139182.1.23259 WP_001139182.1.23460 WP_001139182.1.23472 WP_001139182.1.23634 WP_001139182.1.2364 WP_001139182.1.23736 WP_001139182.1.23932 WP_001139182.1.24017 WP_001139182.1.24163 WP_001139182.1.24206 WP_001139182.1.24308 WP_001139182.1.24578 WP_001139182.1.24723 WP_001139182.1.24737 WP_001139182.1.25008 WP_001139182.1.25015 WP_001139182.1.25036 WP_001139182.1.25405 WP_001139182.1.25454 WP_001139182.1.25493 WP_001139182.1.25498 WP_001139182.1.2554 WP_001139182.1.25668 WP_001139182.1.25690 WP_001139182.1.2570 WP_001139182.1.25740 WP_001139182.1.25793 WP_001139182.1.25814 WP_001139182.1.25944 WP_001139182.1.26269 WP_001139182.1.26282 WP_001139182.1.26311 WP_001139182.1.26426 WP_001139182.1.26429 WP_001139182.1.26440 WP_001139182.1.26493 WP_001139182.1.26567 WP_001139182.1.26576 WP_001139182.1.26856 WP_001139182.1.27206 WP_001139182.1.27419 WP_001139182.1.27423 WP_001139182.1.27561 WP_001139182.1.27665 WP_001139182.1.27707 WP_001139182.1.2777 WP_001139182.1.27857 WP_001139182.1.27977 WP_001139182.1.2829 WP_001139182.1.28302 WP_001139182.1.2835 WP_001139182.1.28370 WP_001139182.1.28504 WP_001139182.1.28538 WP_001139182.1.28575 WP_001139182.1.28612 WP_001139182.1.28655 WP_001139182.1.28694 WP_001139182.1.2879 WP_001139182.1.2890 WP_001139182.1.28938 WP_001139182.1.28946 WP_001139182.1.29006 WP_001139182.1.29010 WP_001139182.1.2910 WP_001139182.1.29174 WP_001139182.1.29588 WP_001139182.1.29601 WP_001139182.1.29606 WP_001139182.1.29615 WP_001139182.1.29704 WP_001139182.1.29924 WP_001139182.1.29969 WP_001139182.1.30006 WP_001139182.1.30180 WP_001139182.1.30469 WP_001139182.1.30505 WP_001139182.1.30507 WP_001139182.1.30535 WP_001139182.1.30547 WP_001139182.1.30794 WP_001139182.1.30833 WP_001139182.1.30835 WP_001139182.1.30909 WP_001139182.1.31 WP_001139182.1.3113 WP_001139182.1.31185 WP_001139182.1.31190 WP_001139182.1.31196 WP_001139182.1.31210 WP_001139182.1.31251 WP_001139182.1.31281 WP_001139182.1.31362 WP_001139182.1.31476 WP_001139182.1.31658 WP_001139182.1.31940 WP_001139182.1.31967 WP_001139182.1.31972 WP_001139182.1.32192 WP_001139182.1.32206 WP_001139182.1.32275 WP_001139182.1.32515 WP_001139182.1.32660 WP_001139182.1.32714 WP_001139182.1.32786 WP_001139182.1.32804 WP_001139182.1.32907 WP_001139182.1.32961 WP_001139182.1.33030 WP_001139182.1.3304 WP_001139182.1.33127 WP_001139182.1.33143 WP_001139182.1.33144 WP_001139182.1.33248 WP_001139182.1.33261 WP_001139182.1.333 WP_001139182.1.33492 WP_001139182.1.33592 WP_001139182.1.33825 WP_001139182.1.33894 WP_001139182.1.34043 WP_001139182.1.34075 WP_001139182.1.34257 WP_001139182.1.34453 WP_001139182.1.34975 WP_001139182.1.35129 WP_001139182.1.35184 WP_001139182.1.35404 WP_001139182.1.35425 WP_001139182.1.35509 WP_001139182.1.35590 WP_001139182.1.35777 WP_001139182.1.35940 WP_001139182.1.36003 WP_001139182.1.3601 WP_001139182.1.3610 WP_001139182.1.36157 WP_001139182.1.36542 WP_001139182.1.36609 WP_001139182.1.36690 WP_001139182.1.3670 WP_001139182.1.36705 WP_001139182.1.36918 WP_001139182.1.36931 WP_001139182.1.37063 WP_001139182.1.37111 WP_001139182.1.37112 WP_001139182.1.37256 WP_001139182.1.37293 WP_001139182.1.37320 WP_001139182.1.3734 WP_001139182.1.37370 WP_001139182.1.37376 WP_001139182.1.3744 WP_001139182.1.37498 WP_001139182.1.37504 WP_001139182.1.37558 WP_001139182.1.37618 WP_001139182.1.37968 WP_001139182.1.38125 WP_001139182.1.38145 WP_001139182.1.38199 WP_001139182.1.383 WP_001139182.1.38393 WP_001139182.1.38613 WP_001139182.1.38673 WP_001139182.1.38693 WP_001139182.1.38740 WP_001139182.1.38773 WP_001139182.1.38882 WP_001139182.1.3891 WP_001139182.1.39003 WP_001139182.1.39136 WP_001139182.1.39197 WP_001139182.1.39229 WP_001139182.1.39405 WP_001139182.1.39420 WP_001139182.1.39449 WP_001139182.1.39512 WP_001139182.1.39629 WP_001139182.1.39632 WP_001139182.1.39763 WP_001139182.1.39862 WP_001139182.1.40017 WP_001139182.1.40072 WP_001139182.1.40073 WP_001139182.1.40208 WP_001139182.1.40292 WP_001139182.1.40305 WP_001139182.1.40311 WP_001139182.1.40395 WP_001139182.1.40465 WP_001139182.1.40710 WP_001139182.1.4075 WP_001139182.1.4087 WP_001139182.1.40877 WP_001139182.1.41017 WP_001139182.1.41086 WP_001139182.1.41091 WP_001139182.1.41226 WP_001139182.1.41279 WP_001139182.1.41310 WP_001139182.1.41440 WP_001139182.1.41516 WP_001139182.1.41554 WP_001139182.1.41662 WP_001139182.1.41708 WP_001139182.1.41761 WP_001139182.1.41882 WP_001139182.1.41979 WP_001139182.1.41985 WP_001139182.1.42104 WP_001139182.1.42238 WP_001139182.1.42320 WP_001139182.1.42342 WP_001139182.1.42422 WP_001139182.1.4276 WP_001139182.1.42797 WP_001139182.1.42829 WP_001139182.1.42861 WP_001139182.1.4288 WP_001139182.1.42887 WP_001139182.1.43018 WP_001139182.1.43041 WP_001139182.1.43437 WP_001139182.1.43522 WP_001139182.1.43613 WP_001139182.1.43668 WP_001139182.1.43875 WP_001139182.1.43886 WP_001139182.1.44043 WP_001139182.1.4405 WP_001139182.1.44121 WP_001139182.1.44291 WP_001139182.1.44310 WP_001139182.1.44386 WP_001139182.1.44440 WP_001139182.1.44479 WP_001139182.1.44593 WP_001139182.1.44607 WP_001139182.1.44702 WP_001139182.1.44747 WP_001139182.1.4485 WP_001139182.1.44877 WP_001139182.1.44927 WP_001139182.1.45027 WP_001139182.1.45079 WP_001139182.1.45098 WP_001139182.1.45154 WP_001139182.1.45177 WP_001139182.1.45259 WP_001139182.1.45349 WP_001139182.1.45365 WP_001139182.1.45468 WP_001139182.1.45550 WP_001139182.1.45660 WP_001139182.1.45690 WP_001139182.1.458 WP_001139182.1.46011 WP_001139182.1.46069 WP_001139182.1.46173 WP_001139182.1.46174 WP_001139182.1.46187 WP_001139182.1.46250 WP_001139182.1.46322 WP_001139182.1.46499 WP_001139182.1.46595 WP_001139182.1.46675 WP_001139182.1.46693 WP_001139182.1.46730 WP_001139182.1.46749 WP_001139182.1.46961 WP_001139182.1.47057 WP_001139182.1.47067 WP_001139182.1.47214 WP_001139182.1.47429 WP_001139182.1.47448 WP_001139182.1.4747 WP_001139182.1.47621 WP_001139182.1.47714 WP_001139182.1.47799 WP_001139182.1.47849 WP_001139182.1.48242 WP_001139182.1.48253 WP_001139182.1.483 WP_001139182.1.48367 WP_001139182.1.48377 WP_001139182.1.4853 WP_001139182.1.48788 WP_001139182.1.48894 WP_001139182.1.48919 WP_001139182.1.49084 WP_001139182.1.49102 WP_001139182.1.49155 WP_001139182.1.49204 WP_001139182.1.49226 WP_001139182.1.49239 WP_001139182.1.49256 WP_001139182.1.49290 WP_001139182.1.49340 WP_001139182.1.49366 WP_001139182.1.49490 WP_001139182.1.49572 WP_001139182.1.4979 WP_001139182.1.49803 WP_001139182.1.49805 WP_001139182.1.49929 WP_001139182.1.49931 WP_001139182.1.50007 WP_001139182.1.5009 WP_001139182.1.50161 WP_001139182.1.50211 WP_001139182.1.50374 WP_001139182.1.50676 WP_001139182.1.50800 WP_001139182.1.50804 WP_001139182.1.50808 WP_001139182.1.5088 WP_001139182.1.50908 WP_001139182.1.50941 WP_001139182.1.51014 WP_001139182.1.51022 WP_001139182.1.51179 WP_001139182.1.51182 WP_001139182.1.51186 WP_001139182.1.51487 WP_001139182.1.51488 WP_001139182.1.51611 WP_001139182.1.51634 WP_001139182.1.51686 WP_001139182.1.51700 WP_001139182.1.51888 WP_001139182.1.51911 WP_001139182.1.51932 WP_001139182.1.51989 WP_001139182.1.52121 WP_001139182.1.52353 WP_001139182.1.52361 WP_001139182.1.52653 WP_001139182.1.52743 WP_001139182.1.52857 WP_001139182.1.52898 WP_001139182.1.52915 WP_001139182.1.53190 WP_001139182.1.5333 WP_001139182.1.53466 WP_001139182.1.53529 WP_001139182.1.53543 WP_001139182.1.53675 WP_001139182.1.53694 WP_001139182.1.53757 WP_001139182.1.53812 WP_001139182.1.54061 WP_001139182.1.54082 WP_001139182.1.54196 WP_001139182.1.54209 WP_001139182.1.54271 WP_001139182.1.54274 WP_001139182.1.54319 WP_001139182.1.54364 WP_001139182.1.54644 WP_001139182.1.54662 WP_001139182.1.54722 WP_001139182.1.54749 WP_001139182.1.54764 WP_001139182.1.5493 WP_001139182.1.55008 WP_001139182.1.55152 WP_001139182.1.55156 WP_001139182.1.5517 WP_001139182.1.55223 WP_001139182.1.5523 WP_001139182.1.55285 WP_001139182.1.55475 WP_001139182.1.5555 WP_001139182.1.55647 WP_001139182.1.55782 WP_001139182.1.55796 WP_001139182.1.56002 WP_001139182.1.56059 WP_001139182.1.56105 WP_001139182.1.56238 WP_001139182.1.56247 WP_001139182.1.56261 WP_001139182.1.56286 WP_001139182.1.56304 WP_001139182.1.56393 WP_001139182.1.56414 WP_001139182.1.56438 WP_001139182.1.56512 WP_001139182.1.56560 WP_001139182.1.56614 WP_001139182.1.56642 WP_001139182.1.56682 WP_001139182.1.56875 WP_001139182.1.56877 WP_001139182.1.57084 WP_001139182.1.57149 WP_001139182.1.57168 WP_001139182.1.57187 WP_001139182.1.57357 WP_001139182.1.57377 WP_001139182.1.57418 WP_001139182.1.57433 WP_001139182.1.57515 WP_001139182.1.57529 WP_001139182.1.57534 WP_001139182.1.57576 WP_001139182.1.57601 WP_001139182.1.57735 WP_001139182.1.57763 WP_001139182.1.57862 WP_001139182.1.57890 WP_001139182.1.57978 WP_001139182.1.5801 WP_001139182.1.58041 WP_001139182.1.58249 WP_001139182.1.58251 WP_001139182.1.58301 WP_001139182.1.58442 WP_001139182.1.58548 WP_001139182.1.5858 WP_001139182.1.58662 WP_001139182.1.58669 WP_001139182.1.58836 WP_001139182.1.59094 WP_001139182.1.59125 WP_001139182.1.59224 WP_001139182.1.59375 WP_001139182.1.59458 WP_001139182.1.59508 WP_001139182.1.59684 WP_001139182.1.59694 WP_001139182.1.59771 WP_001139182.1.5979 WP_001139182.1.59928 WP_001139182.1.59953 WP_001139182.1.60008 WP_001139182.1.60021 WP_001139182.1.60069 WP_001139182.1.60140 WP_001139182.1.60155 WP_001139182.1.60285 WP_001139182.1.60379 WP_001139182.1.60464 WP_001139182.1.60469 WP_001139182.1.60746 WP_001139182.1.60794 WP_001139182.1.60838 WP_001139182.1.60874 WP_001139182.1.60941 WP_001139182.1.60988 WP_001139182.1.61078 WP_001139182.1.6114 WP_001139182.1.61232 WP_001139182.1.61233 WP_001139182.1.6129 WP_001139182.1.61417 WP_001139182.1.61712 WP_001139182.1.61714 WP_001139182.1.61730 WP_001139182.1.61857 WP_001139182.1.61952 WP_001139182.1.62007 WP_001139182.1.62025 WP_001139182.1.6210 WP_001139182.1.62108 WP_001139182.1.62304 WP_001139182.1.62364 WP_001139182.1.62374 WP_001139182.1.62403 WP_001139182.1.6253 WP_001139182.1.62619 WP_001139182.1.62853 WP_001139182.1.62903 WP_001139182.1.62955 WP_001139182.1.63043 WP_001139182.1.63155 WP_001139182.1.63203 WP_001139182.1.63234 WP_001139182.1.63256 WP_001139182.1.63290 WP_001139182.1.63382 WP_001139182.1.63461 WP_001139182.1.63479 WP_001139182.1.63525 WP_001139182.1.63577 WP_001139182.1.63664 WP_001139182.1.63718 WP_001139182.1.6375 WP_001139182.1.63766 WP_001139182.1.63824 WP_001139182.1.63834 WP_001139182.1.63992 WP_001139182.1.64046 WP_001139182.1.6423 WP_001139182.1.64242 WP_001139182.1.64244 WP_001139182.1.64649 WP_001139182.1.64702 WP_001139182.1.64757 WP_001139182.1.64781 WP_001139182.1.64831 WP_001139182.1.6489 WP_001139182.1.64919 WP_001139182.1.64972 WP_001139182.1.65018 WP_001139182.1.65028 WP_001139182.1.65171 WP_001139182.1.65248 WP_001139182.1.65474 WP_001139182.1.65633 WP_001139182.1.6565 WP_001139182.1.65696 WP_001139182.1.6575 WP_001139182.1.65782 WP_001139182.1.65838 WP_001139182.1.66074 WP_001139182.1.66167 WP_001139182.1.66272 WP_001139182.1.66314 WP_001139182.1.66362 WP_001139182.1.6638 WP_001139182.1.6640 WP_001139182.1.66534 WP_001139182.1.66698 WP_001139182.1.6680 WP_001139182.1.66834 WP_001139182.1.66901 WP_001139182.1.66962 WP_001139182.1.67037 WP_001139182.1.67045 WP_001139182.1.67175 WP_001139182.1.67181 WP_001139182.1.67184 WP_001139182.1.67268 WP_001139182.1.67374 WP_001139182.1.67682 WP_001139182.1.67887 WP_001139182.1.68201 WP_001139182.1.68206 WP_001139182.1.6827 WP_001139182.1.68275 WP_001139182.1.6849 WP_001139182.1.68547 WP_001139182.1.68589 WP_001139182.1.68591 WP_001139182.1.68655 WP_001139182.1.68656 WP_001139182.1.68778 WP_001139182.1.68787 WP_001139182.1.68818 WP_001139182.1.68894 WP_001139182.1.68928 WP_001139182.1.68975 WP_001139182.1.6913 WP_001139182.1.69146 WP_001139182.1.69255 WP_001139182.1.69288 WP_001139182.1.69385 WP_001139182.1.69397 WP_001139182.1.69564 WP_001139182.1.69644 WP_001139182.1.69704 WP_001139182.1.70087 WP_001139182.1.7014 WP_001139182.1.70241 WP_001139182.1.70269 WP_001139182.1.70289 WP_001139182.1.70326 WP_001139182.1.70447 WP_001139182.1.70485 WP_001139182.1.70523 WP_001139182.1.70547 WP_001139182.1.70643 WP_001139182.1.70883 WP_001139182.1.70922 WP_001139182.1.70948 WP_001139182.1.70971 WP_001139182.1.71116 WP_001139182.1.71146 WP_001139182.1.71165 WP_001139182.1.71188 WP_001139182.1.71202 WP_001139182.1.71243 WP_001139182.1.71306 WP_001139182.1.71368 WP_001139182.1.71401 WP_001139182.1.71481 WP_001139182.1.71750 WP_001139182.1.71881 WP_001139182.1.71908 WP_001139182.1.71952 WP_001139182.1.71973 WP_001139182.1.72105 WP_001139182.1.72188 WP_001139182.1.72203 WP_001139182.1.72594 WP_001139182.1.72871 WP_001139182.1.72892 WP_001139182.1.72975 WP_001139182.1.73144 WP_001139182.1.73200 WP_001139182.1.73481 WP_001139182.1.7356 WP_001139182.1.73581 WP_001139182.1.73617 WP_001139182.1.73669 WP_001139182.1.73701 WP_001139182.1.73753 WP_001139182.1.73758 WP_001139182.1.73794 WP_001139182.1.7386 WP_001139182.1.7387 WP_001139182.1.73956 WP_001139182.1.74181 WP_001139182.1.74191 WP_001139182.1.74379 WP_001139182.1.74410 WP_001139182.1.74418 WP_001139182.1.74428 WP_001139182.1.74466 WP_001139182.1.74529 WP_001139182.1.74545 WP_001139182.1.74745 WP_001139182.1.74996 WP_001139182.1.75288 WP_001139182.1.7531 WP_001139182.1.75334 WP_001139182.1.75385 WP_001139182.1.75392 WP_001139182.1.75760 WP_001139182.1.75793 WP_001139182.1.75874 WP_001139182.1.75884 WP_001139182.1.75945 WP_001139182.1.76020 WP_001139182.1.76024 WP_001139182.1.76055 WP_001139182.1.76208 WP_001139182.1.76252 WP_001139182.1.76445 WP_001139182.1.7660 WP_001139182.1.76673 WP_001139182.1.76706 WP_001139182.1.76721 WP_001139182.1.76738 WP_001139182.1.76756 WP_001139182.1.76760 WP_001139182.1.76875 WP_001139182.1.76880 WP_001139182.1.76899 WP_001139182.1.77038 WP_001139182.1.77047 WP_001139182.1.77080 WP_001139182.1.7712 WP_001139182.1.77180 WP_001139182.1.77244 WP_001139182.1.77292 WP_001139182.1.77349 WP_001139182.1.77514 WP_001139182.1.77543 WP_001139182.1.77549 WP_001139182.1.77692 WP_001139182.1.7782 WP_001139182.1.77851 WP_001139182.1.77918 WP_001139182.1.78033 WP_001139182.1.78076 WP_001139182.1.78096 WP_001139182.1.78100 WP_001139182.1.78110 WP_001139182.1.78120 WP_001139182.1.78339 WP_001139182.1.78383 WP_001139182.1.78407 WP_001139182.1.78602 WP_001139182.1.7861 WP_001139182.1.78618 WP_001139182.1.78673 WP_001139182.1.78735 WP_001139182.1.78802 WP_001139182.1.78830 WP_001139182.1.78835 WP_001139182.1.78871 WP_001139182.1.78874 WP_001139182.1.78918 WP_001139182.1.78930 WP_001139182.1.79151 WP_001139182.1.79297 WP_001139182.1.79335 WP_001139182.1.79462 WP_001139182.1.79472 WP_001139182.1.79529 WP_001139182.1.7964 WP_001139182.1.79642 WP_001139182.1.79645 WP_001139182.1.79668 WP_001139182.1.79845 WP_001139182.1.80149 WP_001139182.1.80182 WP_001139182.1.80296 WP_001139182.1.80366 WP_001139182.1.80780 WP_001139182.1.80831 WP_001139182.1.80850 WP_001139182.1.80881 WP_001139182.1.80939 WP_001139182.1.8096 WP_001139182.1.80973 WP_001139182.1.81037 WP_001139182.1.81069 WP_001139182.1.81149 WP_001139182.1.81175 WP_001139182.1.8119 WP_001139182.1.81354 WP_001139182.1.81425 WP_001139182.1.81667 WP_001139182.1.81750 WP_001139182.1.81760 WP_001139182.1.81785 WP_001139182.1.81974 WP_001139182.1.81977 WP_001139182.1.82337 WP_001139182.1.82479 WP_001139182.1.82503 WP_001139182.1.8282 WP_001139182.1.82895 WP_001139182.1.82944 WP_001139182.1.82956 WP_001139182.1.83061 WP_001139182.1.83092 WP_001139182.1.83163 WP_001139182.1.8322 WP_001139182.1.83413 WP_001139182.1.83491 WP_001139182.1.83523 WP_001139182.1.83651 WP_001139182.1.83721 WP_001139182.1.83759 WP_001139182.1.83760 WP_001139182.1.83995 WP_001139182.1.84103 WP_001139182.1.84283 WP_001139182.1.84359 WP_001139182.1.84392 WP_001139182.1.84403 WP_001139182.1.8441 WP_001139182.1.84532 WP_001139182.1.84554 WP_001139182.1.84899 WP_001139182.1.8497 WP_001139182.1.85040 WP_001139182.1.85120 WP_001139182.1.85190 WP_001139182.1.8533 WP_001139182.1.8545 WP_001139182.1.85481 WP_001139182.1.85483 WP_001139182.1.8552 WP_001139182.1.85541 WP_001139182.1.8556 WP_001139182.1.85615 WP_001139182.1.85663 WP_001139182.1.85671 WP_001139182.1.85672 WP_001139182.1.85777 WP_001139182.1.85886 WP_001139182.1.85900 WP_001139182.1.85904 WP_001139182.1.86306 WP_001139182.1.86356 WP_001139182.1.86450 WP_001139182.1.86469 WP_001139182.1.86580 WP_001139182.1.86588 WP_001139182.1.86661 WP_001139182.1.8672 WP_001139182.1.8678 WP_001139182.1.86810 WP_001139182.1.8684 WP_001139182.1.86859 WP_001139182.1.86895 WP_001139182.1.86906 WP_001139182.1.86982 WP_001139182.1.87323 WP_001139182.1.8736 WP_001139182.1.87460 WP_001139182.1.87779 WP_001139182.1.8809 WP_001139182.1.88291 WP_001139182.1.88293 WP_001139182.1.8837 WP_001139182.1.88393 WP_001139182.1.88703 WP_001139182.1.88792 WP_001139182.1.88902 WP_001139182.1.8891 WP_001139182.1.88981 WP_001139182.1.89116 WP_001139182.1.89138 WP_001139182.1.89291 WP_001139182.1.89512 WP_001139182.1.89527 WP_001139182.1.89604 WP_001139182.1.89622 WP_001139182.1.89659 WP_001139182.1.89902 WP_001139182.1.8996 WP_001139182.1.90097 WP_001139182.1.90248 WP_001139182.1.90252 WP_001139182.1.90417 WP_001139182.1.90458 WP_001139182.1.90472 WP_001139182.1.90521 WP_001139182.1.90557 WP_001139182.1.90585 WP_001139182.1.90625 WP_001139182.1.90641 WP_001139182.1.90734 WP_001139182.1.90866 WP_001139182.1.91069 WP_001139182.1.91278 WP_001139182.1.91381 WP_001139182.1.91512 WP_001139182.1.91524 WP_001139182.1.91528 WP_001139182.1.91580 WP_001139182.1.91628 WP_001139182.1.91724 WP_001139182.1.91732 WP_001139182.1.91788 WP_001139182.1.92013 WP_001139182.1.92047 WP_001139182.1.92093 WP_001139182.1.92108 WP_001139182.1.92208 WP_001139182.1.92268 WP_001139182.1.92310 WP_001139182.1.92439 WP_001139182.1.92482 WP_001139182.1.92562 WP_001139182.1.92669 WP_001139182.1.92671 WP_001139182.1.92738 WP_001139182.1.93086 WP_001139182.1.93101 WP_001139182.1.93155 WP_001139182.1.93213 WP_001139182.1.93365 WP_001139182.1.93543 WP_001139182.1.93596 WP_001139182.1.93650 WP_001139182.1.93656 WP_001139182.1.93662 WP_001139182.1.937 WP_001139182.1.93705 WP_001139182.1.93761 WP_001139182.1.93804 WP_001139182.1.9389 WP_001139182.1.94072 WP_001139182.1.94162 WP_001139182.1.94168 WP_001139182.1.94198 WP_001139182.1.9432 WP_001139182.1.94354 WP_001139182.1.94380 WP_001139182.1.94565 WP_001139182.1.94674 WP_001139182.1.94796 WP_001139182.1.94959 WP_001139182.1.94967 WP_001139182.1.94986 WP_001139182.1.95085 WP_001139182.1.95121 WP_001139182.1.9516 WP_001139182.1.95282 WP_001139182.1.95320 WP_001139182.1.95546 WP_001139182.1.95911 WP_001139182.1.96139 WP_001139182.1.96317 WP_001139182.1.96343 WP_001139182.1.9644 WP_001139182.1.96469 WP_001139182.1.96555 WP_001139182.1.96563 WP_001139182.1.96732 WP_001139182.1.96771 WP_001139182.1.96798 WP_001139182.1.96902 WP_001139182.1.97005 WP_001139182.1.97015 WP_001139182.1.97190 WP_001139182.1.97318 WP_001139182.1.97369 WP_001139182.1.97496 WP_001139182.1.97594 WP_001139182.1.97597 WP_001139182.1.97613 WP_001139182.1.97620 WP_001139182.1.97626 WP_001139182.1.97727 WP_001139182.1.97732 WP_001139182.1.97736 WP_001139182.1.9775 WP_001139182.1.97846 WP_001139182.1.98006 WP_001139182.1.98022 WP_001139182.1.9805 WP_001139182.1.98110 WP_001139182.1.98146 WP_001139182.1.9841 WP_001139182.1.98446 WP_001139182.1.98495 WP_001139182.1.98513 WP_001139182.1.98531 WP_001139182.1.98577 WP_001139182.1.98608 WP_001139182.1.98627 WP_001139182.1.98751 WP_001139182.1.98760 WP_001139182.1.98843 WP_001139182.1.99072 WP_001139182.1.99098 WP_001139182.1.99184 WP_001139182.1.99276 WP_001139182.1.99646 WP_001139182.1.99657 WP_001139182.1.99660 WP_001139182.1.99725 WP_001139182.1.99813 WP_001139182.1.99858 WP_001139182.1.99889 WP_001139182.1.99958 gi|194446149|ref|YP_002043684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]