SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004326 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004326
Domain Number 1 Region: 369-675
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.29e-89
Family Protein kinases, catalytic subunit 0.000000188
Further Details:      
 
Domain Number 2 Region: 226-343
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-33
Family cAMP-binding domain 0.00058
Further Details:      
 
Domain Number 3 Region: 95-218
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-30
Family cAMP-binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004326   Gene: ENSPTRG00000002509   Transcript: ENSPTRT00000004693
Sequence length 686
Comment pep:known chromosome:CHIMP2.1.4:10:49482886:50705289:1 gene:ENSPTRG00000002509 transcript:ENSPTRT00000004693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMK
NLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKV
FGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSL
PEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLG
KGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKY
EAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEH
IRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYT
ACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYV
APEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAK
NAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTD
TSNFDSFPEDNDEPPPDDNSGWDIDF
Download sequence
Identical sequences A0A096P593 A0A2I2ZKF7 A0A2J8WQS8 A0A2K5IJK1 A0A2K5VZ44 A0A2K5XK15 A0A2K6BZM7 F7G3L7 H2Q1X0
ENSP00000363092 ENSP00000363087 gi|10835242|ref|NP_006249.1| ENSPTRP00000004326 NP_006249.1.87134 NP_006249.1.92137 XP_001099460.1.72884 XP_001162858.1.37143 XP_005565904.1.63531 XP_007961639.1.81039 XP_011738662.1.29376 XP_011794151.1.43180 XP_011845665.1.47321 XP_018890509.1.27298 ENSPTRP00000004326 ENSP00000363092 9598.ENSPTRP00000004326 9606.ENSP00000363092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]