SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005383 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005383
Domain Number 1 Region: 253-336
Classification Level Classification E-value
Superfamily E set domains 5.6e-20
Family E-set domains of sugar-utilizing enzymes 0.082
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000005383
Domain Number - Region: 343-390
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0785
Family HLH, helix-loop-helix DNA-binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005383   Gene: ENSPTRG00000003058   Transcript: ENSPTRT00000005817
Sequence length 575
Comment pep:known chromosome:CHIMP2.1.4:8:22132728:22335272:-1 gene:ENSPTRG00000003058 transcript:ENSPTRT00000005817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQDTLGRGPALKEKSLGAEMDSVRSWVRNVGVVDANVAAQSGVALSRAHFEKQPPSN
LRKSNFFHFVLALYDRQGQPVEIERTAFVDFVENDKEQGNEKTNNGTHYKLQLLYSNGVR
TEQDLYVRLIDSVTKQPIAYEGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPV
IIDRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSTTVNVDGHVLAVSDNMFVHNNSKHG
RRARRLDPSEATPCIKAISPSEGWTTGGAMVIIIGDNFFDGLQVVFGTMLVWSELITPHA
IRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFIYTALNEPTIDYGFQRLQKVIPRHPGD
PERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRNPSQLPALSSSPA
HSGMMGINSYGSQLGVSISESTQGNNQGYIRNTSSISPRGYSSSSTPQQSNYSTSSNSMN
GYSNVPMANLGVPGSPGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPFSSSVFPAVKQKS
AFAPVIRPQGSPSPACSSGNGNGFRAMTGLVVPPM
Download sequence
Identical sequences A0A096N690 A0A2I3SV18 A0A2K5CLW3 A0A2K5N446 A0A2K5W2Z7 A0A2K5Z2U8 A0A2K6DG31 A0A2K6JTM6 A0A2K6PZ09 A0A2K6U1L3 F6S1T9 G1S2A8 G3QGU9 H2PPV8 M3XVR2
ENSNLEP00000019646 XP_001108135.1.72884 XP_002818966.1.23681 XP_003272934.1.23891 XP_003937235.1.74449 XP_004046850.1.27298 XP_004763296.1.14098 XP_005562933.1.63531 XP_007960161.1.81039 XP_010376445.1.97406 XP_011740201.1.29376 XP_011839227.1.47321 XP_011901093.1.92194 XP_012290781.1.9421 XP_017740910.1.44346 XP_519669.2.37143 ENSMPUP00000003162 9600.ENSPPYP00000020682 ENSPTRP00000005383 ENSPTRP00000005383 ENSGGOP00000001563 ENSNLEP00000019646 ENSGGOP00000001563 ENSPPYP00000020682 ENSPANP00000007983 ENSPPYP00000020682 ENSMPUP00000003162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]