SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007256 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007256
Domain Number 1 Region: 273-465
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.19e-62
Family Hemopexin-like domain 0.00000109
Further Details:      
 
Domain Number 2 Region: 101-261
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.18e-54
Family Matrix metalloproteases, catalytic domain 0.00000601
Further Details:      
 
Domain Number 3 Region: 18-96
Classification Level Classification E-value
Superfamily PGBD-like 4.4e-21
Family MMP N-terminal domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007256   Gene: ENSPTRG00000004217   Transcript: ENSPTRT00000007864
Sequence length 513
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:100537075:100551187:-1 gene:ENSPTRG00000004217 transcript:ENSPTRT00000007864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLLLLFLFFITFSSAFPSVRMTENEENVQLAQAYLNQFYSLEIEGNHLVQSKNRSLID
DKIREMQEFFGLTVTGKLDSNTLEIMKTPRCGVPDVGQYGYTLPGWRKYNLTYRIINYTP
DMARAAVDEAIQEGLEVWSKVTPLKFTKISKGIADIMIAFRTRVHGRCPRYFDGPLGVLG
HAFPPGPGLGGDTHFDEDENWTKDGAGFNLFLVAAHEFGHALGLSHSNDQTALMFPNYVS
LDPRKYPLSQDDISGIQSIYGGLPKVPAKPKEPTIPHACDPDLTFDAITTFRREVMFFKG
RHLWRIYYDIMDVEFELIASFWPSLPADLQAAYENPRDKILVFKDENFWMIRGYAVLPDY
PKSIHTLGFPGRVKKIDAAVCDKTTRKTYFFVGIWCWRFDEMTQTMDKGFPQRVVKHFPG
ISIRVDAAFQYKGFFYFSRGSKQFEYDIKTKNITRIMRTNTWFQCKEPKNSSFGFDINKE
KAHSGGIKILYHKSLSLFIFGIVHLLKNTSIYQ
Download sequence
Identical sequences H2Q4M9
ENSPTRP00000007256 ENSPTRP00000007256 XP_522163.1.37143 9598.ENSPTRP00000007256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]