SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008621 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008621
Domain Number 1 Region: 279-469
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.63e-59
Family Hemopexin-like domain 0.00012
Further Details:      
 
Domain Number 2 Region: 81-255
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.8e-45
Family Matrix metalloproteases, catalytic domain 0.0000389
Further Details:      
 
Domain Number 3 Region: 29-89
Classification Level Classification E-value
Superfamily PGBD-like 0.0000000000000188
Family MMP N-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008621   Gene: ENSPTRG00000005066   Transcript: ENSPTRT00000009320
Sequence length 505
Comment pep:known chromosome:CHIMP2.1.4:12:33524040:33530109:1 gene:ENSPTRG00000005066 transcript:ENSPTRT00000009320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAF
QEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTL
PPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHA
DIPELGSVHFDEDEFWTEGTYHGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPH
FKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPEPSPMPDPCSSELDAMMLGPRGK
TYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINF
KMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFT
GVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNIAHNWMHCRPQTIDTTPSG
GNTTPSGTGITLDTTLSATETTFEY
Download sequence
Identical sequences H2Q667
ENSPTRP00000008621 XP_001154045.2.37143 ENSPTRP00000008621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]