SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009274 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009274
Domain Number 1 Region: 2-427
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-161
Family ALDH-like 0.00000000000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009274   Gene: ENSPTRG00000005463   Transcript: ENSPTRT00000010028
Sequence length 432
Comment pep:known chromosome:CHIMP2.1.4:12:112226948:112254179:1 gene:ENSPTRG00000005463 transcript:ENSPTRT00000010028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKALETLDNGKPYVISYLVDLDMVLKC
LRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNV
VVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTE
IGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRT
FVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLL
CGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLA
AAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEV
KTVTVKVPQKNS
Download sequence
Identical sequences ENSPTRP00000009274 9598.ENSPTRP00000009274 ENSPTRP00000009274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]