SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011100 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011100
Domain Number 1 Region: 448-816
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 5.23e-104
Family Hect, E3 ligase catalytic domain 0.0000033
Further Details:      
 
Domain Number 2 Region: 67-172
Classification Level Classification E-value
Superfamily E set domains 0.00000000173
Family Filamin repeat (rod domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011100   Gene: ENSPTRG00000006539   Transcript: ENSPTRT00000011991
Sequence length 823
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:73925134:73946987:-1 gene:ENSPTRG00000006539 transcript:ENSPTRT00000011991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYVIGGITVSVVAFFFTIKFLFELAARVVSFLQNEDRERRGDRTIYDYVRGNYLDPRSC
KVSWDWKDPYEVGHSMAFRVHLFYKNGQPFPAHRPVGLRVHISHVELAVEIPVTQEVLQE
PNSNVVKVAFTVRKAGRYEITVKLGGLNVAYSPYYKIFQPGMVVPSKTKIVCHFSTLVLT
CGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGVSFEKSVTSNRQT
FQVFLRLTLHSRGCFHACISYQNQPINNGEFDIIVLSEDEKNIVERNVSTSGVSIYFEAY
LYNATNCSSTPWHLPPMHMTSSQRRPSTAVDEEDEDSPSECHTPEKVKKPKKVYCYVSPK
QFSVKEFYLKIIPWRLYTFRVCPGTKFSYLGPDPVHKLLTLVVDDGIQPPVELSCKERNI
LAATFIRSLHKNIGGSETFQDKVNFFQRELRQVHMKRLHSKVTLKVSRHALLESSLKATR
NFSISDWSKNFEVVFQDEEALDWGGPRREWFELICKALFDTTNQLFTRFSDNNQALVHPN
PNRPTHLRLKMYEFAGRLVGKCLYESSLGGAYKQLVRARFTRSFLAQIIGLRMHYKYFET
DDPEFYKSKVCFILNNDMSEMELVFAEEKYNKSGQLDKVVELMTGGAQTPVTNANKIFYL
NLLAQYRLASQVKEEVEHFLKGLNELVPENLLAIFDENELELLMCGTGDISVSDFKAHAV
VVGGSWHFREKVMRWFWTVVSSLTQEELARLLQFTTGSSQLPPGGFAALCPSFQIIAAPT
HSTLPTAHTCFNQLCLPTYDSYEEVHRMLQLAISEGCEGFGML
Download sequence
Identical sequences K7BZP9
ENSPTRP00000011100 9598.ENSPTRP00000011100 ENSPTRP00000011100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]