SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014687 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014687
Domain Number 1 Region: 7-176
Classification Level Classification E-value
Superfamily E set domains 8.05e-81
Family Arrestin/Vps26-like 0.000000116
Further Details:      
 
Domain Number 2 Region: 178-393
Classification Level Classification E-value
Superfamily E set domains 2.33e-68
Family Arrestin/Vps26-like 0.0000000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014687   Gene: ENSPTRG00000008601   Transcript: ENSPTRT00000015872
Sequence length 409
Comment pep:known chromosome:CHIMP2.1.4:17:4734339:4745934:1 gene:ENSPTRG00000008601 transcript:ENSPTRT00000015872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLSVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQS
AAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
Download sequence
Identical sequences G3QRU2 K7D106
ENSPTRP00000014687 XP_003810253.1.60992 XP_004058369.1.27298 XP_009429931.1.37143 ENSPTRP00000014687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]