SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014885 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014885
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 4.45e-59
Family Ran-binding protein mog1p 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014885   Gene: ENSPTRG00000008737   Transcript: ENSPTRT00000016088
Sequence length 186
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:47840694:47842275:-1 gene:ENSPTRG00000008737 transcript:ENSPTRT00000016088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTRDCPLFGGAFSAILPMGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRG
EAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGCCQEAWVLSGKQQIAKENQQVAK
DVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPAPWSLGDFEQLVTSLTLHDP
NIFGPQ
Download sequence
Identical sequences H2QC78
ENSPTRP00000014885 XP_003315648.1.37143 ENSPTRP00000014885 9598.ENSPTRP00000014885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]