SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015140 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015140
Domain Number 1 Region: 4-429
Classification Level Classification E-value
Superfamily ALDH-like 1.03e-126
Family ALDH-like 0.000000000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015140   Gene: ENSPTRG00000008872   Transcript: ENSPTRT00000016358
Sequence length 485
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:36322267:36351384:-1 gene:ENSPTRG00000008872 transcript:ENSPTRT00000016358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILAAIASDLCKSEFNVYSQE
VITVLGEIEGMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIIINGGVEETTELLKQRFDH
IFYTGNTAVGKIIMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLA
LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFMLNSFPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLV
KAEYY
Download sequence
Identical sequences ENSPTRP00000015140 ENSPTRP00000015140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]