SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015290 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015290
Domain Number 1 Region: 274-427
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-40
Family Dual specificity phosphatase-like 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000015290
Domain Number - Region: 229-276
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.000589
Family DEK C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015290   Gene: ENSPTRG00000008955   Transcript: ENSPTRT00000016519
Sequence length 1402
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:27260574:27434960:1 gene:ENSPTRG00000008955 transcript:ENSPTRT00000016519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EADSGEEECRSQPRSISESFLTVKGAALFLPRGNGSSTPRISHRRNKHAGDLQQHLQAMF
ILLRPEDNIRLAVRLESTYQNRTRYMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLV
LPLWSDTLIHLDGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSL
FLTWVSYYESHINSDQSSVNEWNAMQDVQSHRPDSPALFTDIPTERERTERLIKTKLREI
MMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEW
NASNLEDLQNRGVRYILNVTREIDNFFPGVFEYHNIRVYDEEATDLLAYWNDTYKFISKA
KKHGSKCLVHCKMGVSRSASTVIAYAMKEYGWNLDRAYDYVKERRTVTKPNPSFMRQLEE
YQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHP
PIPPVFVEHMVPQDANQKGLCTKERMICLEFTSREFHAGQMEDELNLNDINGCSSGCCLN
ESKLPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDALKADMNVHLLPMEELTSPLK
DLPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGG
GRNESCRLSVVEVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQS
HSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKKNSIHELLLERAQTPENKPG
HMEQDEGSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKW
YPGSVRRATLEFEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEH
SFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPKVLEFDHLPDPQEGPGSDTGTQQE
GVLKDLRTVIPYQESETQAVPLPLPKRVEIIEYTHIVTSPNHTGPGSEIATGEKSGEQGL
RKVNVEKSVTVLCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPE
DRGSSLSTALEIAAPFVSHTTHLLSASLDYLHPQIMVHLEGFTEQSSTTDEPSAEQVSWE
ESQESPLSSGGEVPYKDSQLSSADLSLISKLGDNTGELQEKMDPLSVACRLPHSSSSENI
KSLSHSPGVVKERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASC
ESPHLKLLQPFLRTDSGMHTMEDQESLENPGAPHNPEPTKSFVEQLTTTECIVQSKPVER
PLVQYAKEFGSSQQYLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTH
PLRRLKKANDKKRTTNPFYNTM
Download sequence
Identical sequences ENSPTRP00000015290 9598.ENSPTRP00000015290 ENSPTRP00000015290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]