SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017725 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017725
Domain Number 1 Region: 123-165
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000576
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 2 Region: 53-88
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000903
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017725   Gene: ENSPTRG00000010417   Transcript: ENSPTRT00000019149
Sequence length 280
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:8432745:8439303:-1 gene:ENSPTRG00000010417 transcript:ENSPTRT00000019149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGGWMARVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQ
CLTSGLCVPLTWRCYRDLDCEGSDEEECIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDK
KLRNCSRLACPAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMG
PPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASL
VTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP
Download sequence
Identical sequences ENSPTRP00000017725 ENSPTRP00000017725 9598.ENSPTRP00000017725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]