SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019905 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019905
Domain Number 1 Region: 214-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.86e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 298-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 158-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 10-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.07e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 341-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 117-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000102
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 261-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000635
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 81-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000113
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019905   Gene: ENSPTRG00000011571   Transcript: ENSPTRT00000021569
Sequence length 402
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:62820640:62831876:1 gene:ENSPTRG00000011571 transcript:ENSPTRT00000021569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAALRAPAQSSVTFEDVAVNFSLEEWSLLNEAQRCLYRDVMLETLTLISSLGCWHGG
EDEAAPSKQSTCIHIYKDQGGHSGERPYECGEYRKLFKNKSCLTEPRRDHKHRNVRTGER
PYECSKYGKLFHQKPTLHIHERFHTGQKTYECSECGKSFHQSSSLLQHQTLHTRERPYEC
IECGKAFAEKSSLINHRKVHSGAKRYECNECGKSFAYTSSLIKHRRIHTGERPYECSECG
RSFAENSSLIKHLRVHTGERPYECVECGKSFRRSSSLLQHQRVHTRERPYECSECGKSFS
LRSNLIHHQRVHTGERHECGQCGKSFSRKSSLIIHLRVHTGERPYECSDCGKSFAENSSL
IKHLRVHTGERPYECIDCGKSFRHSSSFRRHQRVHTGMRPYK
Download sequence
Identical sequences H2QHA9
XP_003316786.3.37143 ENSPTRP00000019905 9598.ENSPTRP00000019905 ENSPTRP00000019905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]