SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022322 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022322
Domain Number 1 Region: 14-185
Classification Level Classification E-value
Superfamily E set domains 2.38e-69
Family Arrestin/Vps26-like 0.000000067
Further Details:      
 
Domain Number 2 Region: 188-392
Classification Level Classification E-value
Superfamily E set domains 7.46e-63
Family Arrestin/Vps26-like 0.0000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022322   Gene: ENSPTRG00000013052   Transcript: ENSPTRT00000024200
Sequence length 405
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:238547281:238587025:1 gene:ENSPTRG00000013052 transcript:ENSPTRT00000024200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGKTSKSEPNHVIFKKISRDKSVTIYLGKRDYIDHVSQVQPVDGVVLVDPDLVKGKK
VYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTY
PFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRK
VQHGPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKK
IKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNQERRGIALD
GKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLM
HPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDIDE
Download sequence
Identical sequences H2QJM8
XP_009442855.1.37143 ENSPTRP00000022322 ENSPTRP00000022322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]