SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023561 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023561
Domain Number 1 Region: 447-540
Classification Level Classification E-value
Superfamily TAFH domain-like 6.67e-36
Family TAFH domain-like 0.00000269
Further Details:      
 
Domain Number 2 Region: 734-781
Classification Level Classification E-value
Superfamily Histone-fold 3.81e-17
Family TBP-associated factors, TAFs 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023561   Gene: ENSPTRG00000013695   Transcript: ENSPTRT00000025528
Sequence length 947
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:59239356:59330561:-1 gene:ENSPTRG00000013695 transcript:ENSPTRT00000025528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRGLLQQRGGRESGPAPPAAKLRPPPEGSAGACAPVPAAAAVAAGPEPAPAGPAKPAGPA
ALAARAGPGPGPGPGPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALL
PLPKPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPPAAAQNGGSAGAAPAPAPA
AGGPAGVSGQPGPGAAAAAPAPGVKAESPKTVVQAAPPAAQTLAASGPASTAASMVIGPT
MQGALPSPAAVPPPAPGTPTGLPKGATGAVTQSLPRTPTATTSGIRATLTPTVLAPRLPQ
PPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAPRPATPTSA
PPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQT
ASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAA
NVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQS
QQQPPPPASQATTALTAVVLSSSVQRTAGKTAATVTSALQPPVLSLTQPTQVGVGKQGQP
TPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAV
LPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSE
LVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKIS
ETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQED
PEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVV
PGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences ENSPTRP00000023561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]