SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024575 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024575
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-22
Family Kringle modules 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024575   Gene: ENSPTRG00000014267   Transcript: ENSPTRT00000026660
Sequence length 263
Comment pep:known chromosome:CHIMP2.1.4:22:29975491:29986416:-1 gene:ENSPTRG00000014267 transcript:ENSPTRT00000026660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAWVQAFLVSNMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASTP
VSGAGNHSYCRNPDEDPRGPWCYVSGEAGVPEKRPCEDLRCPEATSQALPAFTTEIQEAS
EGPGADEVQVFAPANALPARSEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYSYKRGKDLKEQHDQKVCEREMQRITLPLSAFTNPTCEIVDEKTVVVHT
SQTPVDPQEGSTPLMGQAGTPGA
Download sequence
Identical sequences H2QLI4
9598.ENSPTRP00000024575 XP_530409.2.37143 ENSPTRP00000024575 ENSPTRP00000024575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]