SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026193 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026193
Domain Number 1 Region: 102-187
Classification Level Classification E-value
Superfamily E set domains 0.000000000867
Family Filamin repeat (rod domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000026193
Domain Number - Region: 448-550
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0494
Family Putative acetylxylan esterase-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026193   Gene: ENSPTRG00000015178   Transcript: ENSPTRT00000028383
Sequence length 559
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:104961612:104998409:1 gene:ENSPTRG00000015178 transcript:ENSPTRT00000028383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTNFFKLRLFCCLLAVLMVVVLVINVTQVEYLDHETVSATFIDSSGQFVSSQVTGISRN
PYCGYDQQTLSSQERMEEDSLLAALHRQVPDVGPVPFVKSTDPSSSYFVILNSAAFFKVG
SQLEVLVHVQDFQRKPKKYGGDYLQARIHSPKLQAGAVGRVVDYQNGFYKVFFTLLWPGK
VKVSVSLVHPSEGIRVLQRLQEDKPDRVYFKSLFRSGRISETTECNVCLPGNLPLCNFTD
LYTGEPWFCFKPKKLPCSSRITHFKGGYLKGLLTAAESAFFQSGVNIKMPVNSSGPDWVT
VIPRRIKETNSLELSQGSGTFPSGYYYKDQWRPRKFKMRQFNDPDNITECLQRKVVHLFG
DSTIRQWFEYLTAFVPDLVEFNLGSPKNVGPFLAVDQKHNILLKYRCHGPPIRFTTVFSN
ELHYVANELNGIVGGKNTVVAIAVWSHFSTFPLEVYIRRLRNIRRAVVRLLDRSPKTVVV
IRTANAQELGPEVSLFNSDWYNFQLDTILRRMFSGVGVYLVDAWEMTLAHYLPHKLHPDE
VIVKNQLDMFLSFVCPLET
Download sequence
Identical sequences H2QN15
9598.ENSPTRP00000026193 ENSPTRP00000026193 XP_001148874.1.37143 XP_001149373.1.37143 XP_009444351.1.37143 XP_009444353.1.37143 XP_009444355.1.37143 XP_009444356.1.37143 XP_009444357.1.37143 XP_016797074.1.37143 ENSPTRP00000026193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]