SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029857 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029857
Domain Number 1 Region: 262-345
Classification Level Classification E-value
Superfamily E set domains 5.88e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000029857
Domain Number - Region: 352-402
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00204
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029857   Gene: ENSPTRG00000017477   Transcript: ENSPTRT00000032315
Sequence length 591
Comment pep:known chromosome:CHIMP2.1.4:5:159606007:160003745:-1 gene:ENSPTRG00000017477 transcript:ENSPTRT00000032315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPS
NLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGI
RTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDP
VIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKH
GRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLV
WSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQ
KVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQ
LPALANTSVHAGMMGVNSFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYVPSTTPQQTN
YNSVTTSMNGYGSAAMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGI
FSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
Download sequence
Identical sequences A0A1D5R8G8 A0A1S3GT39 A0A2I3HUT3 A0A2I3N9Y7 A0A2K5EVF8 A0A2K5NL69 A0A2K5RVI7 A0A2K5WH55 A0A2K6BUH7 A0A2K6FKJ5 A0A2K6NZE9 F7I410 G3QCT5 H2PH80 H2QRX0 Q07802 Q5SWK5 Q9UH73
ENSP00000322898 ENSCJAP00000035335 ENSP00000322898 ENSMUSP00000080020 ENSPPYP00000017900 ENSCJAP00000035333 HR3014 ENSPPYP00000017900 NP_031923.1.92730 NP_076870.1.87134 NP_076870.1.92137 XP_001140192.1.37143 XP_002710390.1.1745 XP_003268637.1.23891 XP_004042961.1.27298 XP_004836533.1.39548 XP_005558464.1.63531 XP_006246180.1.100692 XP_008013352.1.81039 XP_008819875.1.79516 XP_008970653.1.60992 XP_008982369.1.60252 XP_009239508.1.23681 XP_010370854.1.97406 XP_011740693.1.29376 XP_011906248.1.92194 XP_012316462.1.9421 XP_012500246.1.63892 XP_012662664.1.62490 XP_012891860.1.60039 XP_014996820.1.72884 XP_017357583.1.71028 XP_020139253.1.48125 XP_021067656.1.100879 XP_021492367.1.76796 gi|31415878|ref|NP_076870.1| ENSGGOP00000000032 ENSGGOP00000000032 ENSPTRP00000029857 ENSP00000322898 ENSPTRP00000029857 9598.ENSPTRP00000029857 9600.ENSPPYP00000017900 9606.ENSP00000322898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]