SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031521 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031521
Domain Number 1 Region: 125-237
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000471
Family cAMP-binding domain 0.073
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000031521
Domain Number - Region: 61-117
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 0.00353
Family Taf5 N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031521   Gene: ENSPTRG00000018455   Transcript: ENSPTRT00000034106
Sequence length 291
Comment pep:known chromosome:CHIMP2.1.4:6:106160246:106183179:-1 gene:ENSPTRG00000018455 transcript:ENSPTRT00000034106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLG
FLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLG
ISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQF
LDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIA
DKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK
Download sequence
Identical sequences G3RLV4 H2QTG9 Q9HBV1
ENSP00000254765 ENSP00000254765 gi|21359947|ref|NP_071756.2| ENSGGOP00000016765 ENSPTRP00000031521 9598.ENSPTRP00000031521 9606.ENSP00000254765 NP_071756.2.87134 NP_071756.2.92137 XP_003824395.1.60992 XP_011534369.1.92137 XP_016811549.1.37143 XP_016811550.1.37143 XP_016866683.1.92137 XP_016866684.1.92137 XP_018885767.1.27298 XP_518655.2.37143 ENSPTRP00000031521 ENSGGOP00000016765 ENSP00000254765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]