SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034899 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034899
Domain Number 1 Region: 336-532
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.7e-70
Family Hemopexin-like domain 0.00000734
Further Details:      
 
Domain Number 2 Region: 119-294
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.22e-55
Family Matrix metalloproteases, catalytic domain 0.0000000543
Further Details:      
 
Domain Number 3 Region: 29-106
Classification Level Classification E-value
Superfamily PGBD-like 5.81e-21
Family MMP N-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034899   Gene: ENSPTRG00000020403   Transcript: ENSPTRT00000037759
Sequence length 607
Comment pep:known chromosome:CHIMP2.1.4:8:86210374:86500888:-1 gene:ENSPTRG00000020403 transcript:ENSPTRT00000037759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRY
ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
PGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVW
KGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVK
EGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCK
RSMQEWV
Download sequence
Identical sequences A0A0D9RKH8 A0A2I2Y1M9 A0A2I3MBZ0 A0A2J8UFW7 A0A2K5I8L7 A0A2K5N2Y6 A0A2K6ANU7 A0A2K6KSY6 A0A2K6PVV2 F6XP71 G7PC63 K7ASR0 P51512
ENSP00000286614 ENSPTRP00000034899 ENSPTRP00000034899 ENSGGOP00000021432 ENSGGOP00000021432 ENSMMUP00000017328 ENSMMUP00000017328 9544.ENSMMUP00000017328 9598.ENSPTRP00000034899 9606.ENSP00000286614 ENSP00000286614 ENSP00000286614 NP_005932.2.87134 NP_005932.2.92137 XP_001084206.1.72884 XP_003821197.1.60992 XP_004047299.1.27298 XP_005563717.1.63531 XP_007999226.1.81039 XP_010369997.1.97406 XP_011766605.1.29376 XP_011792466.1.43180 XP_011887175.1.92194 XP_017751905.1.44346 gi|13027802|ref|NP_005932.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]