SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000037502 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000037502
Domain Number 1 Region: 202-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.19e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 315-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-24
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.68e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 146-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.36e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 412-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 95-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000278
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000037502   Gene: ENSPTRG00000021842   Transcript: ENSPTRT00000040584
Sequence length 482
Comment pep:known_by_projection chromosome:CHIMP2.1.4:X:47912174:47915425:1 gene:ENSPTRG00000021842 transcript:ENSPTRT00000040584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSVSFEDVAVDFTRQEWHRLDPAQRTMHKDVMLETYSNLASVGLCVAKPEMIFKLERGEE
LWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCRKGFH
EKTGFVRRKRTPRGDKNFECHECGKAYCRKSNLVEHLRIHTGERPYECGECAKTFSARSY
LIAHQKTHTGERPFECNECGKSFGRKSQLILHTRTHTGERPYECTECGKTFSEKATLTIH
QRTHTGEKPYECSECGKTFRVKISLTQHHRTHTGEKPYECGECGKNFRAKKSLNQHQRIH
TGEKPYECGECGKFFRMKMTLNNHQRTHTGEKPYQCNECGKSFRVHSSLGIHQRIHTGEK
PYECNECGNAFYVKARLIEHQRMHSGEKPYECSECGKIFSMKKSLCQHRRTHTGEKPYEC
NECGNAFYVKVRLIEHQRIHTGERPFECQECGKAFCRKAHLTEHQRTHIGWSWRCTMKKA
SP
Download sequence
Identical sequences A0A2J8IK19
ENSPTRP00000037502 ENSPTRP00000037502 9598.ENSPTRP00000037502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]